RAD51 paralog B

Overview
NameRAD51 paralog B
Smed IDSMED30017521
Length (bp)1184
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RAD51 paralog B (SMED30017521) t-SNE clustered cells

Violin plots show distribution of expression levels for RAD51 paralog B (SMED30017521) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RAD51 paralog B (SMED30017521) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RAD51 paralog B (SMED30017521) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017521

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017521h1SMcG0015289 SmedASXL_009022SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RAD51 paralog B vs. Ensembl Human
Match: RAD51B (RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822])

HSP 1 Score: 106.301 bits (264), Expect = 4.718e-25
Identity = 80/252 (31.75%), Postives = 123/252 (48.81%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN-----------------------AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+  G++TE+ GPPG GK+QFC  M+ +A    N+   + ++ YIDT   FS  RL +I +       +++   +L  SK++ +     D+      +L E + +   KL+I+D +A  +R   D      L ER +  ++  S LK  A EF++ V+LTNQIT   S                             AALGN+WSH +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. Ensembl Human
Match: RAD51B (RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822])

HSP 1 Score: 105.916 bits (263), Expect = 7.275e-25
Identity = 80/252 (31.75%), Postives = 123/252 (48.81%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN-----------------------AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+  G++TE+ GPPG GK+QFC  M+ +A    N+   + ++ YIDT   FS  RL +I +       +++   +L  SK++ +     D+      +L E + +   KL+I+D +A  +R   D      L ER +  ++  S LK  A EF++ V+LTNQIT   S                             AALGN+WSH +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. Ensembl Human
Match: RAD51B (RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822])

HSP 1 Score: 105.916 bits (263), Expect = 9.008e-25
Identity = 80/252 (31.75%), Postives = 123/252 (48.81%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN-----------------------AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+  G++TE+ GPPG GK+QFC  M+ +A    N+   + ++ YIDT   FS  RL +I +       +++   +L  SK++ +     D+      +L E + +   KL+I+D +A  +R   D      L ER +  ++  S LK  A EF++ V+LTNQIT   S                             AALGN+WSH +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. Ensembl Human
Match: RAD51B (RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822])

HSP 1 Score: 105.531 bits (262), Expect = 1.806e-24
Identity = 80/252 (31.75%), Postives = 123/252 (48.81%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN-----------------------AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+  G++TE+ GPPG GK+QFC  M+ +A    N+   + ++ YIDT   FS  RL +I +       +++   +L  SK++ +     D+      +L E + +   KL+I+D +A  +R   D      L ER +  ++  S LK  A EF++ V+LTNQIT   S                             AALGN+WSH +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. Ensembl Human
Match: RAD51C (RAD51 paralog C [Source:HGNC Symbol;Acc:HGNC:9820])

HSP 1 Score: 89.7373 bits (221), Expect = 3.543e-19
Identity = 78/278 (28.06%), Postives = 127/278 (45.68%), Query Frame = 3
Query:  204 LYEQMNQK--VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDT-------------NNMLSKLYFFEPTDKDDFYAIFINLREYL-QAFKPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQI-TGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI*ITNFISF 959
            L EQ + +  +IT   +L+ IL GG+P    TE+ G PG GK+Q CM       +      +   ++F IDT G+F ++R+  +     ++L L  +                +N+LS +Y+F   D  +  A    L ++L +  K +L+I+D +A+  R  + DL  RTR+ + +   +   A    + V+LTNQ+ T ++ N  L   ALG SW H    R+    D   RL         A + KS       V F+I   G  +  +T+  S 
Sbjct:   90 LLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVF-IDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRL---------ATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSL 357          
BLAST of RAD51 paralog B vs. Ensembl Celegans
Match: rad-51 (DNA repair protein RAD51 homolog [Source:UniProtKB/TrEMBL;Acc:L8E822])

HSP 1 Score: 74.7146 bits (182), Expect = 1.491e-14
Identity = 54/208 (25.96%), Postives = 95/208 (45.67%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIR----TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT----GVNSNFYLENAA--LGNSWSHYINTRIYL 806
            ++ T   SL+++L GG+ +G+ITE+ G   +GK+Q C +        I+    +    YIDTN  F   R+  I ++      + D+ ++L  +      + +   A+ I     +   +  ++I+DC   + R       DL ER    S  +  L K A E+ + V++TNQ+     G  S F  +      G+  +H   TR+YL
Sbjct:  122 QIRTGSASLDRLLGGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDTNATFRPERIIAIAQR-----YNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQMKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGGASMFQADAKKPIGGHIIAHMSTTRLYL 324          
BLAST of RAD51 paralog B vs. Ensembl Celegans
Match: rad-51 (DNA repair protein RAD51 homolog [Source:UniProtKB/TrEMBL;Acc:L8E822])

HSP 1 Score: 74.7146 bits (182), Expect = 1.553e-14
Identity = 54/208 (25.96%), Postives = 95/208 (45.67%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIR----TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT----GVNSNFYLENAA--LGNSWSHYINTRIYL 806
            ++ T   SL+++L GG+ +G+ITE+ G   +GK+Q C +        I+    +    YIDTN  F   R+  I ++      + D+ ++L  +      + +   A+ I     +   +  ++I+DC   + R       DL ER    S  +  L K A E+ + V++TNQ+     G  S F  +      G+  +H   TR+YL
Sbjct:  117 QIRTGSASLDRLLGGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDTNATFRPERIIAIAQR-----YNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQMKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGGASMFQADAKKPIGGHIIAHMSTTRLYL 319          
BLAST of RAD51 paralog B vs. Ensembl Celegans
Match: rad-51 (DNA repair protein RAD51 homolog [Source:UniProtKB/TrEMBL;Acc:L8E822])

HSP 1 Score: 74.3294 bits (181), Expect = 2.059e-14
Identity = 54/208 (25.96%), Postives = 95/208 (45.67%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIR----TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT----GVNSNFYLENAA--LGNSWSHYINTRIYL 806
            ++ T   SL+++L GG+ +G+ITE+ G   +GK+Q C +        I+    +    YIDTN  F   R+  I ++      + D+ ++L  +      + +   A+ I     +   +  ++I+DC   + R       DL ER    S  +  L K A E+ + V++TNQ+     G  S F  +      G+  +H   TR+YL
Sbjct:  155 QIRTGSASLDRLLGGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDTNATFRPERIIAIAQR-----YNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQMKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGGASMFQADAKKPIGGHIIAHMSTTRLYL 357          
BLAST of RAD51 paralog B vs. Ensembl Fly
Match: spn-D (gene:FBgn0003482 transcript:FBtr0085116)

HSP 1 Score: 77.411 bits (189), Expect = 7.798e-16
Identity = 56/209 (26.79%), Postives = 96/209 (45.93%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVAN----HLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSD---------TNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKP-KLLIIDCMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITG--VNSNFYLENAALGNSWSHYINTRIY 803
            K++T   +L+    GG+  G + EL+G  G+GK+Q C+    N          + S  +IDT  +F  +RL       L L L+            + ML K+++      D   A  ++   +L      KL++ID +A+ +R + D   R  M  ++   +++   +  +T + TN +T   V   F +E  ALG+  SH IN RI+
Sbjct:   45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLM-----GLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLRMLEDGAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQVE-PALGDLHSHLINERIW 247          
BLAST of RAD51 paralog B vs. Ensembl Fly
Match: spn-A (gene:FBgn0003479 transcript:FBtr0085590)

HSP 1 Score: 67.3958 bits (163), Expect = 2.191e-12
Identity = 60/216 (27.78%), Postives = 96/216 (44.44%), Query Frame = 3
Query:  213 QMNQKVI---TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQ----SSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIID-CMAYYIRTISDLVERTRMSSK------IISILKKTAIEFNMTVLLTNQIT----GVNSNFYLENAALGNSWSHYINTRIYL 806
            QM   V+   T    L+K+L GG+ +G+ITE+ G    GK+Q C T        I+Q        YIDT   F   RL  I ++        + + +L  + F    + D    +       L   +  LLI+D  MA Y    SD + R  ++++       + +L++ A EF + V++TNQ+T    G    F  +    G+  +H   TR+YL
Sbjct:   34 QMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPISQKGGEGKCMYIDTENTFRPERLAAIAQR-----YKLNESEVLDNVAFTRAHNSDQQTKLIQMAAGMLFESRYALLIVDSAMALY---RSDYIGRGELAARQNHLGLFLRMLQRLADEFGVAVVITNQVTASLDGAPGMFDAKKPIGGHIMAHSSTTRLYL 241          
BLAST of RAD51 paralog B vs. Ensembl Fly
Match: spn-A (gene:FBgn0003479 transcript:FBtr0085589)

HSP 1 Score: 67.3958 bits (163), Expect = 4.453e-12
Identity = 60/216 (27.78%), Postives = 96/216 (44.44%), Query Frame = 3
Query:  213 QMNQKVI---TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQ----SSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIID-CMAYYIRTISDLVERTRMSSK------IISILKKTAIEFNMTVLLTNQIT----GVNSNFYLENAALGNSWSHYINTRIYL 806
            QM   V+   T    L+K+L GG+ +G+ITE+ G    GK+Q C T        I+Q        YIDT   F   RL  I ++        + + +L  + F    + D    +       L   +  LLI+D  MA Y    SD + R  ++++       + +L++ A EF + V++TNQ+T    G    F  +    G+  +H   TR+YL
Sbjct:   91 QMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPISQKGGEGKCMYIDTENTFRPERLAAIAQR-----YKLNESEVLDNVAFTRAHNSDQQTKLIQMAAGMLFESRYALLIVDSAMALY---RSDYIGRGELAARQNHLGLFLRMLQRLADEFGVAVVITNQVTASLDGAPGMFDAKKPIGGHIMAHSSTTRLYL 298          
BLAST of RAD51 paralog B vs. Ensembl Fly
Match: spn-B (gene:FBgn0003480 transcript:FBtr0082933)

HSP 1 Score: 65.4698 bits (158), Expect = 1.694e-11
Identity = 50/191 (26.18%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  246 SLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFIN-LREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRI 800
            +L++   GG+ +  ITEL G  G GK+Q  +       +   L  + +  + YI T  +F   RL Q+ K       + +  N L  ++     + +   A  IN +   +Q     L+IID +A   R  +D +ER R   ++   L   A ++N  V+  NQ+   +     E   LG  W+H   TR+
Sbjct:   94 ALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLPRELGGLGK-GVAYICTESSFPARRLLQMSKACEKRHPEMEL-NFLGNIFVENHIEAEPLLACVINRIPRLMQQHGIGLIIIDSVAAIFRLYNDYLERARHMRRLADALLSYADKYNCAVVCVNQVATRDGQD--EIPCLGLQWAHLGRTRL 280          
BLAST of RAD51 paralog B vs. Ensembl Zebrafish
Match: rad51b (RAD51 paralog B [Source:ZFIN;Acc:ZDB-GENE-040426-2750])

HSP 1 Score: 104.76 bits (260), Expect = 1.265e-24
Identity = 75/261 (28.74%), Postives = 123/261 (47.13%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLT--LPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT-------------GVNSNFYLEN----AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGV 926
            T L +L+++L+GGLP G +TE+ GP G GK+Q CM       +   L  ++ S + YIDT   FS  RL ++ +        +      M ++++ F      D       L E + A +  L+I+D +A  +R   D      L  R+    +  ++LK  + EF + V+LTNQIT               +++F  ++    AALGN+WSH +NTR+ +  +  +R        RQ  + KS  A   V+ + I   G+
Sbjct:   81 TSLPALDRLLHGGLPRGALTEVTGPSGCGKTQLCMMLSVLATLPKSLGGLD-SGVVYIDTESAFSAERLVEMAQSRFPEFFSVKERLLEMAARVHLFRELTCQDVLKRLERLEEDIIACRAGLVILDSVASVVRKEFDTSLPGNLTHRSNFLGQEAAVLKYLSQEFCIPVVLTNQITTHVGEKLHCPQWNQTDASFEEDSGFVTAALGNTWSHSVNTRLIVQYEDSER--------RQIVIAKSPVAPFAVLSYTIQKEGI 332          
BLAST of RAD51 paralog B vs. Ensembl Zebrafish
Match: rad51d (RAD51 paralog D [Source:ZFIN;Acc:ZDB-GENE-040426-2490])

HSP 1 Score: 95.9005 bits (237), Expect = 8.123e-22
Identity = 67/196 (34.18%), Postives = 99/196 (50.51%), Query Frame = 3
Query:  246 SLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREY------LQAFKPKLLIIDCMAYYIRTISDLVERTRMS--SKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLD 809
            SL+K+L+ GL +G ITEL G PGSGK+Q C +   N  + + Q ++ YIDT G    NRL Q+L+   +   + +    L K+  F   D     A   NLR        +     K L++D ++  +  I    +   MS   ++   LK  A +FN+ VL+TN +T  + N  L+ A LG SWSH   TR+ L 
Sbjct:   88 SLDKLLDSGLYTGEITELTGSPGSGKTQVCFSVAVNISHQLKQ-TVVYIDTKGGMCANRLLQMLQTKTS--NEQEQMEALQKIKVFRVFDVFSLLACLQNLRSTGLQKTSVGGGSVKALMVDSVSAVLSPILGGKQNEGMSLLMQVAGELKMIAKDFNIAVLVTNHVTK-DGNGQLK-AGLGLSWSHVPRTRVLLQ 278          
BLAST of RAD51 paralog B vs. Ensembl Zebrafish
Match: rad51c (RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-204])

HSP 1 Score: 88.9669 bits (219), Expect = 4.027e-19
Identity = 74/259 (28.57%), Postives = 116/259 (44.79%), Query Frame = 3
Query:  210 EQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDTNN-----------MLSKLYFFEPTDKDDFYAIFINLREYLQAF-KPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLE-NAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNG 923
            EQ    ++T    L+  + GG+P G  TE+ G PG GK+Q CM    +    +          YIDT G+F + R+  + +   ++ TL L  DT             +LS L+     D  +  A    L ++L    + +L++ID +A+  R    DL +RTR+ + +   L + A +  + V+LTNQ+T   SN   +   ALG SW H    R+ L  +   RL         A + KS       V ++I V G
Sbjct:   80 EQTLGSIVTFCSGLDDAIGGGVPVGKTTEICGAPGVGKTQLCMQLAVDVQIPVCFGGLGGKALYIDTEGSFLVQRVADMAEAAVQHCTL-LAEDTEQKGALEELNVEKILSNLFLVRCHDYVELLAEVYLLPDFLSEHPEVRLVVIDSIAFPFRHDFEDLSQRTRLLNGLAQQLIQLATQHRVAVVLTNQMTTRVSNGQSKLVPALGESWGHAATQRLILHWEGQRRL---------ASLYKSPSQMEATVQYQITVQG 328          
BLAST of RAD51 paralog B vs. Ensembl Zebrafish
Match: rad51c (RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-204])

HSP 1 Score: 88.9669 bits (219), Expect = 4.027e-19
Identity = 74/259 (28.57%), Postives = 116/259 (44.79%), Query Frame = 3
Query:  210 EQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDTNN-----------MLSKLYFFEPTDKDDFYAIFINLREYLQAF-KPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLE-NAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNG 923
            EQ    ++T    L+  + GG+P G  TE+ G PG GK+Q CM    +    +          YIDT G+F + R+  + +   ++ TL L  DT             +LS L+     D  +  A    L ++L    + +L++ID +A+  R    DL +RTR+ + +   L + A +  + V+LTNQ+T   SN   +   ALG SW H    R+ L  +   RL         A + KS       V ++I V G
Sbjct:   80 EQTLGSIVTFCSGLDDAIGGGVPVGKTTEICGAPGVGKTQLCMQLAVDVQIPVCFGGLGGKALYIDTEGSFLVQRVADMAEAAVQHCTL-LAEDTEQKGALEELNVEKILSNLFLVRCHDYVELLAEVYLLPDFLSEHPEVRLVVIDSIAFPFRHDFEDLSQRTRLLNGLAQQLIQLATQHRVAVVLTNQMTTRVSNGQSKLVPALGESWGHAATQRLILHWEGQRRL---------ASLYKSPSQMEATVQYQITVQG 328          
BLAST of RAD51 paralog B vs. Ensembl Zebrafish
Match: rad51 (RAD51 recombinase [Source:ZFIN;Acc:ZDB-GENE-040426-2286])

HSP 1 Score: 67.3958 bits (163), Expect = 5.335e-12
Identity = 54/212 (25.47%), Postives = 91/212 (42.92%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSS----IFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAAL----------GNSWSHYINTRIYL 806
            ++ T    L+K+L GG+ +G+ITE+ G   +GK+Q C T        I+Q        YIDT G F   RL  + ++   +  D     +L  + +    + D    +       +   +  LLI+D      RT      +L  R     + + +L + A EF + V++TNQ+        ++ AA+          GN  +H   TR+YL
Sbjct:  102 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSD-----VLDNVAYARAFNTDHQTQLLYQASAMMTESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFGVAVVITNQVVA-----QVDGAAMFSADPKKPIGGNILAHASTTRLYL 303          
BLAST of RAD51 paralog B vs. Ensembl Xenopus
Match: mcts1 (malignant T-cell amplified sequence 1 [Source:Xenbase;Acc:XB-GENE-998581])

HSP 1 Score: 93.9745 bits (232), Expect = 1.205e-20
Identity = 86/287 (29.97%), Postives = 124/287 (43.21%), Query Frame = 3
Query:  147 SEYSKKRSRQNNMRH*MFYLY--EQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILKK-----NLTLPLDSDT-----------NNMLSKLYFFEPTDKDDFYAIFINLREYLQAF-KPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT---GVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNG 923
             E     S Q   +H  F L   EQ    VIT   +L++IL GG+P   ITE+ G PG GK+Q CM       +      +   ++F IDT  +F + RL  I        NL      D            N +LS++Y+F   D  +  A    L ++L +  K KL++ID +A+  R +  DL  RTR+ +     L   A  FN+ V+LTNQ+T   G + +  +   ALG SW H    R+ L      R  +         + KS       VP+ I   G
Sbjct:   65 GEAQSSSSYQIIQKHTAFDLLGQEQSQGFVITFCSALDEILGGGIPVAKITEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGETVF-IDTECSFRLERLMDIANACVQHCNLIAQGHQDKDHIKAMQTFTLNEILSQIYYFSCHDYIELLAQINLLPDFLSSHPKVKLVVIDSIAFPFRHSFEDLSLRTRLLNGFGQQLISLAHNFNLAVVLTNQMTTKIGPSDSKLV--PALGESWGHASTIRLVLHWKSKQRFVT---------LCKSPSQKKATVPYGITSQG 339          
BLAST of RAD51 paralog B vs. Ensembl Xenopus
Match: tln2 (talin 2 [Source:Xenbase;Acc:XB-GENE-481871])

HSP 1 Score: 78.5666 bits (192), Expect = 1.403e-15
Identity = 59/212 (27.83%), Postives = 104/212 (49.06%), Query Frame = 3
Query:  249 LNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAI---FINLR-----EYLQAFKP-KLLIID--CMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT--GVNSNFYLENAALGNSWSHYINTRIYL---DIDCPDRLFS 836
            L+ +L+ GL +G +TE+ G  GSGK+Q C +   N   N+ Q ++ Y+DT G  + +RL Q+++           +  ++ L   E     D Y +   F +LR     + L++ +P +L+I+D  C   Y        E   +  ++   L+  A ++++ +L++N IT  G   N      ALG SWS   +TRI L   +++C   + S
Sbjct:   89 LDILLDSGLYTGEVTEIAGAAGSGKTQTCQSIAVNVAYNLKQ-TVLYVDTTGGLTASRLLQLVQSR-----TKSEDEQVASLQRIEVIRVFDIYKLFDAFQDLRHQISQQLLRSGEPLRLVIVDSVCAVIYPMLGGKHTEGMAIMMQLARELQTLAHDYHLAILISNSITKDGATGN----RPALGRSWSFVPSTRILLTPTELNCGHSIVS 290          
BLAST of RAD51 paralog B vs. Ensembl Xenopus
Match: rad51 (RAD51 recombinase [Source:NCBI gene;Acc:549147])

HSP 1 Score: 65.855 bits (159), Expect = 2.790e-11
Identity = 52/212 (24.53%), Postives = 92/212 (43.40%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAAL----------GNSWSHYINTRIYL 806
            ++ T    L+K+L GG+ +G+ITE+ G   +GK+Q C T        I+    +    YIDT G F   RL  + ++          +++L  + +    + D    +       +   +  LLI+D      RT      +L  R    ++ + +L + A EF + V++TNQ+        ++ AA+          GN  +H   TR+YL
Sbjct:   98 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAER-----YGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVA-----QVDGAAMFAADPKKPIGGNIIAHASTTRLYL 299          
BLAST of RAD51 paralog B vs. Ensembl Xenopus
Match: rad51 (RAD51 recombinase [Source:NCBI gene;Acc:549147])

HSP 1 Score: 60.8474 bits (146), Expect = 8.758e-10
Identity = 43/174 (24.71%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQI 722
            ++ T    L+K+L GG+ +G+ITE+ G   +GK+Q C T        I+    +    YIDT G F   RL  + ++          +++L  + +    + D    +       +   +  LLI+D      RT      +L  R    ++ + +L + A EF + V++TNQ+
Sbjct:   98 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAER-----YGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQV 266          
BLAST of RAD51 paralog B vs. Ensembl Xenopus
Match: mcu (mitochondrial calcium uniporter [Source:Xenbase;Acc:XB-GENE-1012212])

HSP 1 Score: 49.6766 bits (117), Expect = 4.076e-6
Identity = 52/196 (26.53%), Postives = 83/196 (42.35%), Query Frame = 3
Query:  246 SLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT---GVNSNFYLE--NAALGNSWSHYINTRIYL 806
              +K+L GG+ S  ITE  G          +T      N      I +IDT   F  +RL  I  +  ++  D+  +N+L    +      +    +     E    FK  LLIID +    R       +L ER +  ++++S L+K + E+N+ V +TNQ+T   G    F  +      G+  +H   TRI L
Sbjct:   97 EFDKLLGGGIESMAITETFG----------VTAQLPGPNGYTGGKIIFIDTENTFRPDRLHDIADR-FSVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEPGIFK--LLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISL 279          
BLAST of RAD51 paralog B vs. Ensembl Mouse
Match: Rad51b (RAD51 paralog B [Source:MGI Symbol;Acc:MGI:1099436])

HSP 1 Score: 102.834 bits (255), Expect = 4.329e-24
Identity = 77/253 (30.43%), Postives = 124/253 (49.01%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------------GVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+P G++TE+ GPPG GK+QFC  M+ +A    ++   + ++ YIDT   F+  RL +I +       +++   +L  S+++       +       +L E + +   KL+I+D +A  +R   D      + ER +   K  S+LK  A EF++ V+LTNQIT                        G + +  L  AALGN+W H +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLCALDEALHGGVPCGSLTEITGPPGCGKTQFCIMMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCL-VAALGNTWGHCVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. Ensembl Mouse
Match: Rad51b (RAD51 paralog B [Source:MGI Symbol;Acc:MGI:1099436])

HSP 1 Score: 102.834 bits (255), Expect = 4.329e-24
Identity = 77/253 (30.43%), Postives = 124/253 (49.01%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------------GVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+P G++TE+ GPPG GK+QFC  M+ +A    ++   + ++ YIDT   F+  RL +I +       +++   +L  S+++       +       +L E + +   KL+I+D +A  +R   D      + ER +   K  S+LK  A EF++ V+LTNQIT                        G + +  L  AALGN+W H +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLCALDEALHGGVPCGSLTEITGPPGCGKTQFCIMMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCL-VAALGNTWGHCVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. Ensembl Mouse
Match: Rad51d (RAD51 paralog D [Source:MGI Symbol;Acc:MGI:1261809])

HSP 1 Score: 90.8929 bits (224), Expect = 6.018e-20
Identity = 61/217 (28.11%), Postives = 108/217 (49.77%), Query Frame = 3
Query:  204 LYEQMNQKVI---TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIF---------INLREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMS--SKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDI 812
            LYE++        T + SL+K+L+ GL +G +TE+VG PGSGK+Q C+   AN  +++ Q ++ Y+D+NG  + +RL Q+L+         D     S L   +     D + +          I  +E   +   K++I+D +   +  +    +R  ++   ++   LK  A +  + V++TN +T  + +      ALG SWS   +TRI LD+
Sbjct:   71 LYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQ-NVLYVDSNGGMTASRLLQLLQAR-----TQDEEKQASALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLT-RDWDGRRFKPALGRSWSFVPSTRILLDV 280          
BLAST of RAD51 paralog B vs. Ensembl Mouse
Match: Rad51c (RAD51 paralog C [Source:MGI Symbol;Acc:MGI:2150020])

HSP 1 Score: 88.9669 bits (219), Expect = 3.880e-19
Identity = 78/273 (28.57%), Postives = 127/273 (46.52%), Query Frame = 3
Query:  204 LYEQMNQK--VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDT-------------NNMLSKLYFFEPTDKDDFYAIFINLREYLQAF-KPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQI-TGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI*IT 944
            L EQ + +  +IT   +L+ IL GG+P    TE+ G PG GK+Q CM       +      +   ++F IDT G+F ++R+  +     ++L L   + T              N+LS +Y+F   D  +  A    L ++L    K +L+IID +A+  R  + DL  RTR+ + +   +   A    + V+LTNQ+ T ++ N  L   ALG SW H    R+         +F  +  +R A + KS       +PF+I   G  +  +T
Sbjct:   81 LLEQEHTQGFIITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAVF-IDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTLENILSHIYYFRCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDKNQALLVPALGESWGHAATIRL---------IFHWEQKQRFATLYKSPSQKESTIPFQITPQGFRDAVVT 343          
BLAST of RAD51 paralog B vs. Ensembl Mouse
Match: Rad51c (RAD51 paralog C [Source:MGI Symbol;Acc:MGI:2150020])

HSP 1 Score: 88.9669 bits (219), Expect = 4.391e-19
Identity = 78/273 (28.57%), Postives = 127/273 (46.52%), Query Frame = 3
Query:  204 LYEQMNQK--VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDT-------------NNMLSKLYFFEPTDKDDFYAIFINLREYLQAF-KPKLLIIDCMAYYIRT-ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQI-TGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI*IT 944
            L EQ + +  +IT   +L+ IL GG+P    TE+ G PG GK+Q CM       +      +   ++F IDT G+F ++R+  +     ++L L   + T              N+LS +Y+F   D  +  A    L ++L    K +L+IID +A+  R  + DL  RTR+ + +   +   A    + V+LTNQ+ T ++ N  L   ALG SW H    R+         +F  +  +R A + KS       +PF+I   G  +  +T
Sbjct:   99 LLEQEHTQGFIITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAVF-IDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTLENILSHIYYFRCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDKNQALLVPALGESWGHAATIRL---------IFHWEQKQRFATLYKSPSQKESTIPFQITPQGFRDAVVT 361          
BLAST of RAD51 paralog B vs. UniProt/SwissProt
Match: sp|O15315|RA51B_HUMAN (DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 4.326e-24
Identity = 80/252 (31.75%), Postives = 123/252 (48.81%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN-----------------------AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+  G++TE+ GPPG GK+QFC  M+ +A    N+   + ++ YIDT   FS  RL +I +       +++   +L  SK++ +     D+      +L E + +   KL+I+D +A  +R   D      L ER +  ++  S LK  A EF++ V+LTNQIT   S                             AALGN+WSH +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. UniProt/SwissProt
Match: sp|O35719|RA51B_MOUSE (DNA repair protein RAD51 homolog 2 OS=Mus musculus OX=10090 GN=Rad51b PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 3.028e-23
Identity = 77/253 (30.43%), Postives = 124/253 (49.01%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------------GVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFA 884
            T L +L++ L+GG+P G++TE+ GPPG GK+QFC  M+ +A    ++   + ++ YIDT   F+  RL +I +       +++   +L  S+++       +       +L E + +   KL+I+D +A  +R   D      + ER +   K  S+LK  A EF++ V+LTNQIT                        G + +  L  AALGN+W H +NTR+ L       L SE+   RQ  + KS  A
Sbjct:   85 TTLCALDEALHGGVPCGSLTEITGPPGCGKTQFCIMMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCL-VAALGNTWGHCVNTRLILQY-----LDSER---RQILIAKSPLA 328          
BLAST of RAD51 paralog B vs. UniProt/SwissProt
Match: sp|O55230|RA51D_MOUSE (DNA repair protein RAD51 homolog 4 OS=Mus musculus OX=10090 GN=Rad51d PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.209e-19
Identity = 61/217 (28.11%), Postives = 108/217 (49.77%), Query Frame = 3
Query:  204 LYEQMNQKVI---TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIF---------INLREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMS--SKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDI 812
            LYE++        T + SL+K+L+ GL +G +TE+VG PGSGK+Q C+   AN  +++ Q ++ Y+D+NG  + +RL Q+L+         D     S L   +     D + +          I  +E   +   K++I+D +   +  +    +R  ++   ++   LK  A +  + V++TN +T  + +      ALG SWS   +TRI LD+
Sbjct:   71 LYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQ-NVLYVDSNGGMTASRLLQLLQAR-----TQDEEKQASALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVVIVDSVTAVVAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLT-RDWDGRRFKPALGRSWSFVPSTRILLDV 280          
BLAST of RAD51 paralog B vs. UniProt/SwissProt
Match: sp|O43502|RA51C_HUMAN (DNA repair protein RAD51 homolog 3 OS=Homo sapiens OX=9606 GN=RAD51C PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.702e-18
Identity = 78/278 (28.06%), Postives = 127/278 (45.68%), Query Frame = 3
Query:  204 LYEQMNQK--VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDT-------------NNMLSKLYFFEPTDKDDFYAIFINLREYL-QAFKPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQI-TGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI*ITNFISF 959
            L EQ + +  +IT   +L+ IL GG+P    TE+ G PG GK+Q CM       +      +   ++F IDT G+F ++R+  +     ++L L  +                +N+LS +Y+F   D  +  A    L ++L +  K +L+I+D +A+  R  + DL  RTR+ + +   +   A    + V+LTNQ+ T ++ N  L   ALG SW H    R+    D   RL         A + KS       V F+I   G  +  +T+  S 
Sbjct:   90 LLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVF-IDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRL---------ATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSL 357          
BLAST of RAD51 paralog B vs. UniProt/SwissProt
Match: sp|Q924H5|RA51C_MOUSE (DNA repair protein RAD51 homolog 3 OS=Mus musculus OX=10090 GN=Rad51c PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.714e-18
Identity = 78/273 (28.57%), Postives = 127/273 (46.52%), Query Frame = 3
Query:  204 LYEQMNQK--VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDT-------------NNMLSKLYFFEPTDKDDFYAIFINLREYLQAF-KPKLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQI-TGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI*IT 944
            L EQ + +  +IT   +L+ IL GG+P    TE+ G PG GK+Q CM       +      +   ++F IDT G+F ++R+  +     ++L L   + T              N+LS +Y+F   D  +  A    L ++L    K +L+IID +A+  R  + DL  RTR+ + +   +   A    + V+LTNQ+ T ++ N  L   ALG SW H    R+         +F  +  +R A + KS       +PF+I   G  +  +T
Sbjct:   81 LLEQEHTQGFIITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAVF-IDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTLENILSHIYYFRCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDKNQALLVPALGESWGHAATIRL---------IFHWEQKQRFATLYKSPSQKESTIPFQITPQGFRDAVVT 343          
BLAST of RAD51 paralog B vs. TrEMBL
Match: A0A2I0MPX0 (RAD51 paralog B OS=Columba livia OX=8932 GN=RAD51B PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 6.546e-25
Identity = 85/261 (32.57%), Postives = 126/261 (48.28%), Query Frame = 3
Query:  195 MFYLYEQMNQKVITP--------LYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVAN---HLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTN--NMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------------GVNSNFYLEN----AALGNSWSHYINTRIYLDI-DCPDR 827
            M   YE   +K ++P        L+SL+K+L+GG+P G++TE+  PPG GK+QFC  M+ +A     +  +N  ++ YIDT   FS  RL +I    L    DSD     M   ++ +            ++L E + + K KL+IID +A  +R   D      L ER+   ++  S+LK  A EF++ V+LTNQIT                        G +     E+    AALGN+WSH +NTR+ L   D P R
Sbjct:   64 MQTAYEMKLKKSVSPSSAFLSTTLHSLDKVLHGGVPCGSLTEITSPPGCGKTQFCIMMSVLATLPLSMGGLN-GAVIYIDTESAFSAERLIEIAGNRLPTYFDSDEKLFCMTRSVHVYRDLTCGSVLKRIMSLEEEIISKKVKLIIIDSVASVVRKEFDTKLQGNLAERSNFLARGASMLKYLAEEFSIPVILTNQITTSLSNSPAIQADLVSPADDLSLSEGASGGGKRESGCVTAALGNTWSHSVNTRLILQYHDLPTR 323          
BLAST of RAD51 paralog B vs. TrEMBL
Match: A0A1V4KF76 (DNA repair RAD51-like protein 2 isoform B OS=Patagioenas fasciata monilis OX=372326 GN=RAD51B PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 7.683e-25
Identity = 85/261 (32.57%), Postives = 125/261 (47.89%), Query Frame = 3
Query:  195 MFYLYEQMNQKVITP--------LYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVAN---HLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTN--NMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------------GVNSNFYLEN----AALGNSWSHYINTRIYLDI-DCPDR 827
            M   YE   +K ++P        L+SL+K+L GG+P G++TE+  PPG GK+QFC  M+ +A     +  +N  ++ YIDT   FS  RL +I    L    DSD     M   ++ +            ++L E + + K KL+IID +A  +R   D      L ER+   ++  S+LK  A EF++ V+LTNQIT                        G +     E+    AALGN+WSH +NTR+ L   D P R
Sbjct:  111 MQTAYEMKLKKSVSPSSAFLSTTLHSLDKVLRGGVPCGSLTEITSPPGCGKTQFCIMMSVLATLPVSMGGLN-GAVIYIDTESAFSAERLIEIAGNRLPTYFDSDEKLFCMTCSVHVYRDLTCGSVLKRIMSLEEEIISKKVKLIIIDSVASVVRKEFDTKLQGNLAERSNFLARGASMLKYLAEEFSIPVILTNQITTSLSNNPAIQADLVSPADDLSLSEGASGGGKRESGCVTAALGNTWSHSVNTRLILQYHDLPTR 370          
BLAST of RAD51 paralog B vs. TrEMBL
Match: A0A1V4KF68 (DNA repair RAD51-like protein 2 isoform A OS=Patagioenas fasciata monilis OX=372326 GN=RAD51B PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.133e-24
Identity = 85/261 (32.57%), Postives = 125/261 (47.89%), Query Frame = 3
Query:  195 MFYLYEQMNQKVITP--------LYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVAN---HLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTN--NMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------------GVNSNFYLEN----AALGNSWSHYINTRIYLDI-DCPDR 827
            M   YE   +K ++P        L+SL+K+L GG+P G++TE+  PPG GK+QFC  M+ +A     +  +N  ++ YIDT   FS  RL +I    L    DSD     M   ++ +            ++L E + + K KL+IID +A  +R   D      L ER+   ++  S+LK  A EF++ V+LTNQIT                        G +     E+    AALGN+WSH +NTR+ L   D P R
Sbjct:  111 MQTAYEMKLKKSVSPSSAFLSTTLHSLDKVLRGGVPCGSLTEITSPPGCGKTQFCIMMSVLATLPVSMGGLN-GAVIYIDTESAFSAERLIEIAGNRLPTYFDSDEKLFCMTCSVHVYRDLTCGSVLKRIMSLEEEIISKKVKLIIIDSVASVVRKEFDTKLQGNLAERSNFLARGASMLKYLAEEFSIPVILTNQITTSLSNNPAIQADLVSPADDLSLSEGASGGGKRESGCVTAALGNTWSHSVNTRLILQYHDLPTR 370          
BLAST of RAD51 paralog B vs. TrEMBL
Match: A0A1B0A550 (RECA_2 domain-containing protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.971e-24
Identity = 78/256 (30.47%), Postives = 131/256 (51.17%), Query Frame = 3
Query:  198 FYLYEQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVAN---HL--NNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLR-EYLQAFKPKLLIIDCMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVN-SNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMV---KSSFAFNFVVPFKIDVNGVYEI 935
             +  E ++ K++T +  L+  L GGLP G ITEL G  G+GK+QFC+    N   HL    I   ++F IDTNG FS  RL +I +  +      +   +L+ + + + ++  +      NLR   L+  K KL+IID  ++ +R + D+  R+R+  +I++ L   A++FN+ V++TN++T  +    +    ALG++ SH IN R++            K I+     V   KS       VPF+I   G+  +
Sbjct:    9 LWCKETVSGKIVTLVKELDTHLGGGLPLGQITELCGASGAGKTQFCLQLCINVQFHLTVGGIEGKAMF-IDTNGGFSPFRLREIAQGMVRCFHPFNAEKLLNNISYVDCSNHMELMIAVSNLRNTLLEDQKIKLIIIDSFSFRLRFVEDISLRSRIGYEILTDLHSLALKFNVAVVITNELTTRHMDEEWTITPALGDTHSHKINQRLWF----------RKEIDTGCHFVTIDKSLICGEVSVPFQIKSTGIRRV 253          
BLAST of RAD51 paralog B vs. TrEMBL
Match: A0A1S3F6C6 (DNA repair protein RAD51 homolog 2 OS=Dipodomys ordii OX=10020 GN=Rad51b PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.501e-24
Identity = 74/227 (32.60%), Postives = 115/227 (50.66%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFC--MTFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNML--SKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN-----------------------AALGNSWSHYINTRIYLD 809
            T L +L++ L+GG+  G++TE+ GPPG GK+QFC  M+ +A    N+   + ++ YIDT   FS  RL +I +       D++   +L  SK++ +     D+      +L E + +   KL+IID +A  +R   D      + ER ++ +K  S+LK  A EF++ V+LTNQIT   S                             AALGN+WSH +NTR+ L 
Sbjct:   85 TTLAALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSVLATLPTNMGGLEGAVVYIDTESAFSAERLIEIAESRFPGYFDTEEKLILTSSKVHLYRELTCDEVLQRIQSLEEEIISKGVKLVIIDSIASVVRKEFDTQLQGNMRERNKLLAKEASLLKHLAEEFSVPVILTNQITTHLSGARAAQADLVSPADDLSLTEGTSGSSCVVAALGNTWSHSVNTRLILQ 311          
BLAST of RAD51 paralog B vs. Ensembl Cavefish
Match: rad51d (RAD51 paralog D [Source:NCBI gene;Acc:103022755])

HSP 1 Score: 94.3597 bits (233), Expect = 2.717e-21
Identity = 76/257 (29.57%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  204 LYEQM---NQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLRE------YLQAFKPKLLIIDCMAYYIRTI--SDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLD-IDCPDRLFSEKFIERQARMVKSSF-AFNFVVPFKIDVNGVYEI 935
            LYE++      + T + S++K+L+ GL SG ITEL G PG+GK+Q C +   N  + + Q ++ YIDT+G     RL Q+L+   +    ++    L ++  F   D         NLR        +     K +I+D ++  I  +      E   +  ++   LK  A +FN+ VL+TN +T  + N  L++  LG SWSH   TRI L  ++ P    S     R A + KSS  + N +  F + +    E+
Sbjct:   71 LYEELLSSTSILSTGIPSVDKLLDSGLYSGEITELAGGPGTGKTQMCFSVAVNTAHELKQ-NVLYIDTSGGVCAGRLLQMLQAKTSST--AEQMKALQRIRVFRVFDVFTLLCCLQNLRSNDLQKGSVGGGSVKAVIVDSVSAVISCVLGGKQTEGMSLMMQVAFELKMIAKDFNIAVLVTNHVT-RDGNGKLKS-GLGQSWSHVPRTRILLQRVEQPGAASS----LRTATLTKSSRQSCNLMEEFNLSLQSEEEV 318          
BLAST of RAD51 paralog B vs. Ensembl Cavefish
Match: rad51d (RAD51 paralog D [Source:NCBI gene;Acc:103022755])

HSP 1 Score: 85.5001 bits (210), Expect = 2.383e-18
Identity = 70/251 (27.89%), Postives = 115/251 (45.82%), Query Frame = 3
Query:  204 LYEQM---NQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTI--SDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLD-IDCPDRLFSEKFIERQARMVKSSF-AFNFVVPFKIDVNGVYEI 935
            LYE++      + T + S++K+L+ GL SG ITEL G PG+GK+Q C +   N  + + Q ++ YIDT+G     RL Q+L+   +   +  +                            +     K +I+D ++  I  +      E   +  ++   LK  A +FN+ VL+TN +T  + N  L++  LG SWSH   TRI L  ++ P    S     R A + KSS  + N +  F + +    E+
Sbjct:   71 LYEELLSSTSILSTGIPSVDKLLDSGLYSGEITELAGGPGTGKTQMCFSVAVNTAHELKQ-NVLYIDTSGGVCAGRLLQMLQAKTSSTAEQGS----------------------------VGGGSVKAVIVDSVSAVISCVLGGKQTEGMSLMMQVAFELKMIAKDFNIAVLVTNHVT-RDGNGKLKS-GLGQSWSHVPRTRILLQRVEQPGAASS----LRTATLTKSSRQSCNLMEEFNLSLQSEEEV 286          
BLAST of RAD51 paralog B vs. Ensembl Cavefish
Match: rad51c (RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-204])

HSP 1 Score: 83.9593 bits (206), Expect = 1.683e-17
Identity = 63/230 (27.39%), Postives = 109/230 (47.39%), Query Frame = 3
Query:  210 EQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVAN-----HLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDTN----------NMLSKLYFFEPTDKDDFYAIFINLREYLQAFKP--KLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLE-NAALGNSWSHYINTRIYLDIDCPDRLF 833
            EQ++  V+T    L+ +L GG+P G  TE+ G PG GK+Q C+    +         +   ++ YIDT G+F + R+  + +   ++ TL  + +             +LS ++        +  A    L ++L A  P  +L++ID +A+  R    DL +RTR+ + +   L   A + +  ++LTNQ+T   S+   +   ALG SW H    R+ L  D P  + 
Sbjct:   80 EQIHSGVVTFCSELDAVLGGGVPVGKTTEICGAPGVGKTQLCIQLAVDVQIPLCFGGLGGKAV-YIDTEGSFVVQRVVDMAEAAVEHCTLLAEDEEQRKALEEFTKEKILSGIFLIRCHGYVELLAEAYLLPDFL-AKHPEVRLVVIDSIAFPFRHDFDDLSQRTRLLNGLAQKLILLATQHSAAIVLTNQMTTKVSDGQSKLIPALGESWGHAATQRLILHWDGPQTMM 307          
BLAST of RAD51 paralog B vs. Ensembl Cavefish
Match: rad51c (RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-204])

HSP 1 Score: 82.4185 bits (202), Expect = 3.837e-17
Identity = 62/224 (27.68%), Postives = 107/224 (47.77%), Query Frame = 3
Query:  210 EQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVAN-----HLNNINQSSIFYIDTNGNFSMNRLFQILK---KNLTLPLDSDTN----------NMLSKLYFFEPTDKDDFYAIFINLREYLQAFKP--KLLIIDCMAYYIR-TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLE-NAALGNSWSHYINTRIYLDID 815
            EQ++  V+T    L+ +L GG+P G  TE+ G PG GK+Q C+    +         +   ++ YIDT G+F + R+  + +   ++ TL  + +             +LS ++        +  A    L ++L A  P  +L++ID +A+  R    DL +RTR+ + +   L   A + +  ++LTNQ+T   S+   +   ALG SW H    R+ L  D
Sbjct:   93 EQIHSGVVTFCSELDAVLGGGVPVGKTTEICGAPGVGKTQLCIQLAVDVQIPLCFGGLGGKAV-YIDTEGSFVVQRVVDMAEAAVEHCTLLAEDEEQRKALEEFTKEKILSGIFLIRCHGYVELLAEAYLLPDFL-AKHPEVRLVVIDSIAFPFRHDFDDLSQRTRLLNGLAQKLILLATQHSAAIVLTNQMTTKVSDGQSKLIPALGESWGHAATQRLILHWD 314          
BLAST of RAD51 paralog B vs. Ensembl Cavefish
Match: rad51 (RAD51 recombinase [Source:NCBI gene;Acc:103041530])

HSP 1 Score: 66.2402 bits (160), Expect = 9.918e-12
Identity = 53/212 (25.00%), Postives = 91/212 (42.92%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSS----IFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAAL----------GNSWSHYINTRIYL 806
            ++ T    L+K+L GG+ +G+ITE+ G   +GK+Q C T        I+Q        YIDT G F   RL  + ++   +  D     +L  + +    + D    +       +   +  LLI+D      RT      +L  R     + + +L + A EF + V+++NQ+        ++ AA+          GN  +H   TR+YL
Sbjct:  102 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSD-----VLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFGVAVVISNQVVA-----QVDGAAMFSADPKKPIGGNILAHASTTRLYL 303          
BLAST of RAD51 paralog B vs. Ensembl Sea Lamprey
Match: rad51b (RAD51 paralog B [Source:ZFIN;Acc:ZDB-GENE-040426-2750])

HSP 1 Score: 82.4185 bits (202), Expect = 2.391e-18
Identity = 53/170 (31.18%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVA-----NHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLT--LPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISDL------VERTRMSSKIISILKKTAIEFNMTV 704
            T L +L++ L GG+P G+ITE+ GP G GK+QFCM   A       L  ++   + YIDT   FS  RL +I +         D     M ++++ +         +   +L E L A + +LL++D +A  +R   DL       ER+ + S   ++LK  A EF++ V
Sbjct:   81 TSLPALDRDLQGGIPCGSITEVAGPSGCGKTQFCMMLSALATLPASLGGLD-GGVIYIDTESAFSAERLVEIARGRHPEYFCTDEHVIAMTNRVHIYRELTTQSVLSRLESLEEELIAKRVRLLVLDSVASVLRKEIDLRFLAGVAERSELLSHQAALLKYLAQEFSLPV 249          
BLAST of RAD51 paralog B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002572.1 (pep scaffold:Pmarinus_7.0:GL481125:3469:15813:1 gene:ENSPMAG00000002329.1 transcript:ENSPMAT00000002572.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.365e-11
Identity = 51/212 (24.06%), Postives = 93/212 (43.87%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYL-QAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAAL----------GNSWSHYINTRIY 803
            ++ T    L+K+L GG+ +G+ITEL G   +GK+Q C T        I+    +    Y+DT G F   RL  + ++          +++L  + +    + D    +       + ++ +  LLI+D      RT      +L  R    ++ + +L + A EF + V++TNQ+        ++ AA+          GN  +H   TR+Y
Sbjct:   98 QISTGSKELDKLLQGGIETGSITELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYVDTEGTFRPERLLAVAER-----FGLSGSDVLDNVAYARAYNSDHQTQLLYQASAMMAESSRYALLIVDSATALYRTDYSGRGELAARQMHLARFLRMLLRLADEFGVAVVITNQVVA-----QVDGAAMFTADPKKPIGGNIMAHSSTTRLY 299          
BLAST of RAD51 paralog B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002568.1 (pep scaffold:Pmarinus_7.0:GL481125:3469:15813:1 gene:ENSPMAG00000002329.1 transcript:ENSPMAT00000002568.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.218e-9
Identity = 51/211 (24.17%), Postives = 91/211 (43.13%), Query Frame = 3
Query:  228 VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYL-QAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAAL----------GNSWSHYINTRIY 803
            V+  +YSL     GG+ +G+ITEL G   +GK+Q C T        I+    +    Y+DT G F   RL  + ++          +++L  + +    + D    +       + ++ +  LLI+D      RT      +L  R    ++ + +L + A EF + V++TNQ+        ++ AA+          GN  +H   TR+Y
Sbjct:  106 VVGLVYSL-----GGIETGSITELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYVDTEGTFRPERLLAVAER-----FGLSGSDVLDNVAYARAYNSDHQTQLLYQASAMMAESSRYALLIVDSATALYRTDYSGRGELAARQMHLARFLRMLLRLADEFGVAVVITNQVVA-----QVDGAAMFTADPKKPIGGNIMAHSSTTRLY 301          
BLAST of RAD51 paralog B vs. Ensembl Sea Lamprey
Match: dmc1 (DNA meiotic recombinase 1 [Source:ZFIN;Acc:ZDB-GENE-060331-93])

HSP 1 Score: 56.225 bits (134), Expect = 4.610e-9
Identity = 56/206 (27.18%), Postives = 91/206 (44.17%), Query Frame = 3
Query:  228 VITPLYSLNKILNGGLPSGTITELVGPPGSGKSQ----FCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT---GVNSNFYLE--NAALGNSWSHYINTRIYL 806
            + T    L+K+L GG+ S  ITE  G   +GK+Q    FC+T             +  IDT   F   RL  I ++    P D+  +N+L    +      +    +     E    F  KLLIID +    R       +L +R +  ++++S L+K + E+N+ + +TNQ+T   G   +F  +      G+  +H   TRI L
Sbjct:  104 ISTGSQELDKLLGGGVESMAITEAFGEFRTGKTQMAHTFCVTAQLATPKGYAGGKVILIDTENTFRPERLRDIAERFNVDP-DAVLDNVLYARAYTSEHQMELLDYVAGKFHEEGGQF--KLLIIDSIMALFRVDFTGRGELADRQQKLAQMLSRLQKISEEYNVAIFITNQMTADPGAAMSFQADPKKPIGGHILAHASTTRISL 306          
BLAST of RAD51 paralog B vs. Ensembl Sea Lamprey
Match: xrcc3 (X-ray repair complementing defective repair in Chinese hamster cells 3 [Source:ZFIN;Acc:ZDB-GENE-050320-116])

HSP 1 Score: 56.225 bits (134), Expect = 4.826e-9
Identity = 51/208 (24.52%), Postives = 92/208 (44.23%), Query Frame = 3
Query:  249 LNKILNGGLPSGTITELVGPPGSGKSQFCM--TFVANHLNNIN--QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFE------PTDKDDFY-AIFINLREYLQAFKPKLLIIDCMAYYIR---TISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITG-VNSNFYLENA------ALGNSWSHYINTRIYLD 809
            L+  L GG P   ++ELVG   +GK+Q CM  +    +       ++   Y+ T   F   RL Q+++    +  D    ++L+K+ F E        D    Y  I   L   L     +L+++D +A   R   ++ + V R +   K  + L + +  ++  V+  NQ+TG V+   +   A      ALG +W++ +  RI + 
Sbjct:   87 LDAFLQGGFPVPGVSELVGESATGKTQICMQLSLTVQYPREYGGLEAGAVYVCTEDAFPNKRLCQMIQAQAKMREDVPP-DVLAKISFGENIYIEHAADVASLYTCITRRLPVLLSRGVVRLIVVDSIAALFRSEFSVHEAVARAQQLRKFGAQLHELSNTYSAPVICVNQVTGNVSGQDHGSGAQSKVIPALGITWANMLLMRIMVS 293          
BLAST of RAD51 paralog B vs. Ensembl Yeast
Match: DMC1 (Meiosis-specific recombinase required for double-strand break repair; also required for pairing between homologous chromosomes; required for the normal morphogenesis of synaptonemal complex; homolog of Rad51p and the bacterial RecA protein; binds ssDNA and dsDNA, forms helical filaments; stimulated by Rdh54p [Source:SGD;Acc:S000000981])

HSP 1 Score: 57.7658 bits (138), Expect = 8.942e-10
Identity = 52/200 (26.00%), Postives = 90/200 (45.00%), Query Frame = 3
Query:  249 LNKILNGGLPSGTITELVGPPGSGKSQ----FCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT---GVNSNFYLENAAL---GNSWSHYINTRIYL 806
            L+ IL GG+ + +ITE+ G    GK+Q     C+T          +  + YIDT G F   R+ QI +       + D  + L+ + +    + +    +   L E L +   +L+++D +    R       +L ER +  ++ +  L + A EFN+ V LTNQ+    G ++ F   +      G+  +H   TRI L
Sbjct:  103 LDSILGGGIMTMSITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGTFRPERIKQIAE-----GYELDPESCLANVSYARALNSEHQMELVEQLGEELSSGDYRLIVVDSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEEFNVAVFLTNQVQSDPGASALFASADGRKPIGGHVLAHASATRILL 297          
BLAST of RAD51 paralog B vs. Ensembl Yeast
Match: RAD51 (Strand exchange protein; forms a helical filament with DNA that searches for homology; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; homolog of Dmc1p and bacterial RecA protein [Source:SGD;Acc:S000000897])

HSP 1 Score: 49.6766 bits (117), Expect = 3.713e-7
Identity = 38/146 (26.03%), Postives = 67/146 (45.89%), Query Frame = 3
Query:  249 LNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMSSKIISILK 674
            L+ +L GG+ +G+ITEL G   +GKSQ C T        ++    +    YIDT G F   RL  I ++     LD D  + L+ + +    + D    +     + +   +  L+++D +    RT  D   R  +S++ + + K
Sbjct:  167 LDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQR---FGLDPD--DALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRT--DFSGRGELSARQMHLAK 305          
BLAST of RAD51 paralog B vs. Ensembl Yeast
Match: RAD55 (Protein that stimulates strand exchange; stimulates strand exchange by stabilizing the binding of Rad51p to single-stranded DNA; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; forms heterodimer with Rad57p [Source:SGD;Acc:S000002483])

HSP 1 Score: 48.9062 bits (115), Expect = 7.483e-7
Identity = 40/137 (29.20%), Postives = 66/137 (48.18%), Query Frame = 3
Query:  234 TPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSS-----IFYIDTNGNFSMNRL------FQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYI 611
            + +  L++ILN G  + +I E+ GPPG GK+ F +  V N L  I QS      I +I+T     +N L      F+I+++N+     +    +   LYFF+            NL +  Q+ + KL+IID  +  +
Sbjct:   20 SGITGLDEILNLGFQARSIYEIFGPPGIGKTNFGIQLVCNSLEGIQQSEINDDKILWIETFQEMPINILRERFQKFKIVEENVKRVRITKFGQL---LYFFQ------------NLFKLSQSVRYKLVIIDGFSQLV 141          
BLAST of RAD51 paralog B vs. Ensembl Nematostella
Match: EDO40247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7T2])

HSP 1 Score: 73.1738 bits (178), Expect = 7.097e-15
Identity = 68/217 (31.34%), Postives = 105/217 (48.39%), Query Frame = 3
Query:  375 SSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLS---KLY-FFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISD------LVERTRMSSKIISILKKTAIEFNMTVLLTNQIT------------------GVNSNFYLEN-----AALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGV 926
            +++ YIDT   FS  R+ + + +N    L  + N++LS   K++ F+EPT K   +    +L E + + K KL+++D +A  IR   D      + ERT + SK  +ILK  A  FN+ V++TNQIT                  GV      E      AALGN+WSH +NTR+ +      +   E +  RQ  + KS  A   V  + I + G+
Sbjct:   17 ANVIYIDTEAAFSATRMVE-MAENRFPGLFENQNSVLSLTEKIHVFWEPTCKA-LWERLQSLEEEVISRKVKLIVLDSVASLIRKEFDSQSSRNIKERTNLLSKEAAILKYIAETFNIPVVVTNQITSRFAPSKHVTEADIPDVDGVEVEADEEGSDHVIAALGNTWSHAVNTRLIV------QFLDETY--RQVMIAKSPIAPFDVFTYSIQIEGL 223          
BLAST of RAD51 paralog B vs. Ensembl Medaka
Match: rad51d (RAD51 paralog D [Source:NCBI gene;Acc:101156999])

HSP 1 Score: 89.3521 bits (220), Expect = 1.577e-19
Identity = 72/232 (31.03%), Postives = 108/232 (46.55%), Query Frame = 3
Query:  246 SLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTN-NMLSKLYFFEPTDKDDFYAIFINLRE--YLQAFKP---KLLIIDCMAYYIRTISDLVERTRMSSKIIS--ILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLD------IDCPDRLFSEKFIE--RQARMVKSSFAFNF 893
            SL+K+L+ GL +G +TEL G PGSGKSQ C   VA H+++  +  + YIDT G  + +RL ++L+   +   D D     L +++ F   D          LR    LQA      K +I+D ++  I  +    +   MS  I +   LK  A +F + VL+TN +T            LG SWSH   +RI L+        C   L S   I+  RQ  ++K      +
Sbjct:   88 SLDKLLDSGLYTGEVTELSGGPGSGKSQVCFG-VAVHVSHQLKQRVIYIDTTGGLTASRLLEMLQSETS---DRDEQMEALQRIHVFRLFDAYSLRDRLSTLRSGGLLQASGGGSVKAVIVDSVSAVISPLLGGKQNEGMSLMIQAALALKTMAKDFGVAVLVTNHVTRGGRGEV--QPGLGASWSHIPRSRILLERTDRAPSGCSSTLRSATLIKSSRQPCLIKEELDLQW 313          
BLAST of RAD51 paralog B vs. Ensembl Medaka
Match: rad51c (RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-204])

HSP 1 Score: 86.2705 bits (212), Expect = 1.431e-18
Identity = 66/248 (26.61%), Postives = 116/248 (46.77%), Query Frame = 3
Query:  249 LNKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLT----LPLDSDTNN---------MLSKLYFFEPTDKDDFYAIFINLREYLQAFKP--KLLIIDCMAYYIRT-ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITG--VNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNG 923
            L+  L GGLP G +TE+ G PG GK+  C+       +      + ++ + ++DT G+F + R+  I    +     L +D +  +         +LS ++     D  +  A  + L ++L+  KP  +LL+ID +A+  R  + DL +RTR+   +   +   A   N+ V++TNQ+T    +S  +L   ALG  W H   TRI L  +   ++         A +VKS    +  + ++I   G
Sbjct:   57 LDHALKGGLPVGKVTEICGAPGVGKTHLCLQLSVDIQIPRSFGGL-EAQVIFMDTEGSFVLQRVVDIAAAVVRHFSLLAVDGEQKDTMQTFNMESILSNIFLVRCHDYVELQAELLLLPDFLRD-KPRVRLLVIDSVAFPFRQHLDDLSQRTRLLQGLAQQVISMATRHNIAVVITNQMTTRLQDSQSHL-VPALGEIWGHASTTRIILQWEGSQQV---------AAIVKSPCCIDTAIQYQITSEG 292          
BLAST of RAD51 paralog B vs. Ensembl Medaka
Match: rad51 (RAD51 recombinase [Source:NCBI gene;Acc:101162334])

HSP 1 Score: 67.781 bits (164), Expect = 4.222e-12
Identity = 54/212 (25.47%), Postives = 91/212 (42.92%), Query Frame = 3
Query:  225 KVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSS----IFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAAL----------GNSWSHYINTRIYL 806
            ++ T    L+K+L GG+ +G+ITE+ G   +GK+Q C T        I+Q        YIDT G F   RL  + ++   +  D     +L  + +    + D    +       +   +  LLI+D      RT      +L  R     + + +L + A EF + V++TNQ+        ++ AA+          GN  +H   TR+YL
Sbjct:  158 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGLVGSD-----VLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQGHLGRFLRMLLRLADEFGVAVVITNQVVA-----QVDGAAMFSADPKKPIGGNILAHASTTRLYL 359          
BLAST of RAD51 paralog B vs. Ensembl Medaka
Match: xrcc3 (X-ray repair complementing defective repair in Chinese hamster cells 3 [Source:ZFIN;Acc:ZDB-GENE-050320-116])

HSP 1 Score: 60.4622 bits (145), Expect = 6.750e-10
Identity = 53/209 (25.36%), Postives = 93/209 (44.50%), Query Frame = 3
Query:  249 LNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSI----FYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNM----LSKLYFFEPTDKDDFYAIFINLRE--YLQAFKPKLLIIDCMAYYIRT---ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLEN----------AALGNSWSHYINTRIYL 806
            L+ +L GGLP G ITEL G  G+GK+Q  +    +    +    +     YI T  +F + RL Q++ +   L  +  ++ +     S   + E     D   + ++ R    L A   +L+++D +A   R+     D +ER +      S+L + + EF   VL  NQ   VN +  +E            ALG +W++ +  R+ +
Sbjct:   55 LDGLLRGGLPVGGITELSGQSGAGKTQLALQISLSVQYPVEHGGLGGGALYICTEDSFPIRRLQQMISEQANLRSEVPSSLIRGLRFSDHVYIEHAADLDSLQVCLSRRAPVLLAAGLVRLIVVDSVAALFRSEFQAEDWMERNKQLLTFSSMLHQLSQEFTTPVLCINQ---VNEDAMIEKNKQPLSSSVTPALGLAWANQVLVRLMI 260          
BLAST of RAD51 paralog B vs. Ensembl Medaka
Match: dmc1 (DNA meiotic recombinase 1 [Source:NCBI gene;Acc:100192343])

HSP 1 Score: 58.9214 bits (141), Expect = 2.736e-9
Identity = 60/234 (25.64%), Postives = 101/234 (43.16%), Query Frame = 3
Query:  150 EYSKKRSRQNNMRH*MFYLYEQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQF----CMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAI--FINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQIT---GVNSNFYLE--NAALGNSWSHYINTRIYL 806
            EYS KR +       +F++         T     +K+L GG+ S  ITE  G   +GK+Q     C+T      N  +   + +IDT   F  +RL  I  +      + D   +L  + +      +    +  F+  + + +    KLLIID +    R       +L ER +  ++++S L+K + E+N+ V +TNQ+T   G    F  +      G+  +H   TRI L
Sbjct:   92 EYSSKRKQ-------VFHIS--------TGSQEFDKLLGGGVESMAITEAFGEFRTGKTQLSHTLCVTAQLPGENGYSGGKVIFIDTENTFRPDRLRDIADR-----FNVDHGAVLDNVLYARAYTSEHQMELLDFVAAKFHEEGGVFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGAGMTFQADPKKPIGGHILAHASTTRISL 305          
BLAST of RAD51 paralog B vs. Planmine SMEST
Match: SMESG000021450.1 (SMESG000021450.1)

HSP 1 Score: 499.204 bits (1284), Expect = 7.226e-179
Identity = 243/244 (99.59%), Postives = 244/244 (100.00%), Query Frame = 3
Query:  204 LYEQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI 935
            LYEQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFI+RQARMVKSSFAFNFVVPFKIDVNGVYEI
Sbjct:   44 LYEQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIKRQARMVKSSFAFNFVVPFKIDVNGVYEI 287          

HSP 2 Score: 84.3445 bits (207), Expect = 3.982e-18
Identity = 39/40 (97.50%), Postives = 40/40 (100.00%), Query Frame = 1
Query:   82 MNILSYTTEYLIKKWNLTKNNVLNIQRREADKIICDIECS 201
            MNILSYTTEYLIKKWNLTK+NVLNIQRREADKIICDIECS
Sbjct:    1 MNILSYTTEYLIKKWNLTKDNVLNIQRREADKIICDIECS 40          
BLAST of RAD51 paralog B vs. Planmine SMEST
Match: SMESG000021450.1 (SMESG000021450.1)

HSP 1 Score: 163.696 bits (413), Expect = 3.464e-49
Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 3
Query:  702 VLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI 935
            VLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFI+RQARMVKSSFAFNFVVPFKIDVNGVYEI
Sbjct:   75 VLLTNQITGVNSNFYLENAALGNSWSHYINTRIYLDIDCPDRLFSEKFIKRQARMVKSSFAFNFVVPFKIDVNGVYEI 152          

HSP 2 Score: 83.5741 bits (205), Expect = 3.272e-30
Identity = 39/40 (97.50%), Postives = 40/40 (100.00%), Query Frame = 1
Query:   82 MNILSYTTEYLIKKWNLTKNNVLNIQRREADKIICDIECS 201
            MNILSYTTEYLIKKWNLTK+NVLNIQRREADKIICDIECS
Sbjct:    1 MNILSYTTEYLIKKWNLTKDNVLNIQRREADKIICDIECS 40          

HSP 3 Score: 67.3958 bits (163), Expect = 3.272e-30
Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 3
Query:  204 LYEQMNQKVITPLYSLNKILNGGLPSGTITELV 302
            LYEQMNQKVITPLYSLNKILNGGLPSGTITE++
Sbjct:   44 LYEQMNQKVITPLYSLNKILNGGLPSGTITEVL 76          
BLAST of RAD51 paralog B vs. Planmine SMEST
Match: SMESG000035891.1 (SMESG000035891.1)

HSP 1 Score: 91.2781 bits (225), Expect = 6.849e-21
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = 3
Query:  252 NKILNGGLPSGTITELVGPPGSGKSQFCMTF-----VANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLT--------LPLDS---------DTNNMLSKLYFFEPTDKDDFYAIFINLREY-LQAFKPKLLIIDCMAYYIRTIS-DLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENA-----ALGNSWSHYINTRIYLD 809
            +++L GG P G +TE+ G  G GK+Q C        +   L  IN  +I YIDT G+FS  RL  I +  +T        + L +         D   ML  +++F  TD+     +   L  + L   K +L++ID +A++ R  S D+ +R R+ + +   L   A +F ++VLLTNQ+T      ++E A     ALG SW H  + RI L 
Sbjct:    6 DEMLGGGFPCGKLTEICGYAGIGKTQLCFQACISVQIPECLGGINGEAI-YIDTEGSFSTERLILIARYTITHCQKISKLMKLSNEELRQVENLDELKMLKSIFYFRCTDQSQLLCLTYRLHNFCLSHPKVRLIVIDSIAFHFRYDSIDIPQRNRILTVLGQNLSNIANQFGISVLLTNQMT----TKFIEGAGYAAPALGESWGHICHIRIQLQ 215          
BLAST of RAD51 paralog B vs. Planmine SMEST
Match: SMESG000035891.1 (SMESG000035891.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.641e-12
Identity = 55/175 (31.43%), Postives = 85/175 (48.57%), Query Frame = 3
Query:  357 LNNINQSSIFYIDTNGNFSMNRLFQILKKNLT--------LPLDS---------DTNNMLSKLYFFEPTDKDDFYAIFINLREY-LQAFKPKLLIIDCMAYYIRTIS-DLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENA-----ALGNSWSHYINTRIYLD 809
            L  IN  +I YIDT G+FS  RL  I +  +T        + L +         D   ML  +++F  TD+     +   L  + L   K +L++ID +A++ R  S D+ +R R+ + +   L   A +F ++VLLTNQ+T      ++E A     ALG SW H  + RI L 
Sbjct:   12 LGGINGEAI-YIDTEGSFSTERLILIARYTITHCQKISKLMKLSNEELRQVENLDELKMLKSIFYFRCTDQSQLLCLTYRLHNFCLSHPKVRLIVIDSIAFHFRYDSIDIPQRNRILTVLGQNLSNIANQFGISVLLTNQMT----TKFIEGAGYAAPALGESWGHICHIRIQLQ 181          
BLAST of RAD51 paralog B vs. Planmine SMEST
Match: SMESG000056159.1 (SMESG000056159.1)

HSP 1 Score: 60.8474 bits (146), Expect = 5.181e-10
Identity = 45/198 (22.73%), Postives = 83/198 (41.92%), Query Frame = 3
Query:  252 NKILNGGLPSGTITELVGPPGSGKSQFCMTFVANHLNNIN----QSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKLYFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRT----ISDLVERTRMSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYL-----ENAALGNSWSHYINTRIYL 806
            +K+L GG+ +G+ITE+ G   +GK+Q C +        ++    +    YIDT G F   RL  + ++            +L  + +    + D    + +     +   +  LL++D      RT      +L  R    ++ +  L + A EF + V++TNQ+        +     +    GN  +H   TR+YL
Sbjct:  108 DKLLQGGVETGSITEIFGEFRTGKTQICHSLAVTCQLPVDLGGGEGKCLYIDTEGTFRPERLLAVAER-----YGLSGTEVLENVAYARAYNTDHQNELLVQAAAMMSESRYALLVVDSATALYRTDYSGRGELSARQMHLARFLRALLRLADEFGVAVVITNQVVAQVDGASMFTADPKKPIGGNIMAHASTTRLYL 300          
The following BLAST results are available for this feature:
BLAST of RAD51 paralog B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAD51B4.718e-2531.75RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822][more]
RAD51B7.275e-2531.75RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822][more]
RAD51B9.008e-2531.75RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822][more]
RAD51B1.806e-2431.75RAD51 paralog B [Source:HGNC Symbol;Acc:HGNC:9822][more]
RAD51C3.543e-1928.06RAD51 paralog C [Source:HGNC Symbol;Acc:HGNC:9820][more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rad-511.491e-1425.96DNA repair protein RAD51 homolog [Source:UniProtK... [more]
rad-511.553e-1425.96DNA repair protein RAD51 homolog [Source:UniProtK... [more]
rad-512.059e-1425.96DNA repair protein RAD51 homolog [Source:UniProtK... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spn-D7.798e-1626.79gene:FBgn0003482 transcript:FBtr0085116[more]
spn-A2.191e-1227.78gene:FBgn0003479 transcript:FBtr0085590[more]
spn-A4.453e-1227.78gene:FBgn0003479 transcript:FBtr0085589[more]
spn-B1.694e-1126.18gene:FBgn0003480 transcript:FBtr0082933[more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad51b1.265e-2428.74RAD51 paralog B [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
rad51d8.123e-2234.18RAD51 paralog D [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
rad51c4.027e-1928.57RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-2... [more]
rad51c4.027e-1928.57RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-2... [more]
rad515.335e-1225.47RAD51 recombinase [Source:ZFIN;Acc:ZDB-GENE-040426... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcts11.205e-2029.97malignant T-cell amplified sequence 1 [Source:Xenb... [more]
tln21.403e-1527.83talin 2 [Source:Xenbase;Acc:XB-GENE-481871][more]
rad512.790e-1124.53RAD51 recombinase [Source:NCBI gene;Acc:549147][more]
rad518.758e-1024.71RAD51 recombinase [Source:NCBI gene;Acc:549147][more]
mcu4.076e-626.53mitochondrial calcium uniporter [Source:Xenbase;Ac... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rad51b4.329e-2430.43RAD51 paralog B [Source:MGI Symbol;Acc:MGI:1099436... [more]
Rad51b4.329e-2430.43RAD51 paralog B [Source:MGI Symbol;Acc:MGI:1099436... [more]
Rad51d6.018e-2028.11RAD51 paralog D [Source:MGI Symbol;Acc:MGI:1261809... [more]
Rad51c3.880e-1928.57RAD51 paralog C [Source:MGI Symbol;Acc:MGI:2150020... [more]
Rad51c4.391e-1928.57RAD51 paralog C [Source:MGI Symbol;Acc:MGI:2150020... [more]
back to top
BLAST of RAD51 paralog B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15315|RA51B_HUMAN4.326e-2431.75DNA repair protein RAD51 homolog 2 OS=Homo sapiens... [more]
sp|O35719|RA51B_MOUSE3.028e-2330.43DNA repair protein RAD51 homolog 2 OS=Mus musculus... [more]
sp|O55230|RA51D_MOUSE4.209e-1928.11DNA repair protein RAD51 homolog 4 OS=Mus musculus... [more]
sp|O43502|RA51C_HUMAN1.702e-1828.06DNA repair protein RAD51 homolog 3 OS=Homo sapiens... [more]
sp|Q924H5|RA51C_MOUSE2.714e-1828.57DNA repair protein RAD51 homolog 3 OS=Mus musculus... [more]
back to top
BLAST of RAD51 paralog B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I0MPX06.546e-2532.57RAD51 paralog B OS=Columba livia OX=8932 GN=RAD51B... [more]
A0A1V4KF767.683e-2532.57DNA repair RAD51-like protein 2 isoform B OS=Patag... [more]
A0A1V4KF681.133e-2432.57DNA repair RAD51-like protein 2 isoform A OS=Patag... [more]
A0A1B0A5501.971e-2430.47RECA_2 domain-containing protein OS=Glossina palli... [more]
A0A1S3F6C62.501e-2432.60DNA repair protein RAD51 homolog 2 OS=Dipodomys or... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad51d2.717e-2129.57RAD51 paralog D [Source:NCBI gene;Acc:103022755][more]
rad51d2.383e-1827.89RAD51 paralog D [Source:NCBI gene;Acc:103022755][more]
rad51c1.683e-1727.39RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-2... [more]
rad51c3.837e-1727.68RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-2... [more]
rad519.918e-1225.00RAD51 recombinase [Source:NCBI gene;Acc:103041530][more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad51b2.391e-1831.18RAD51 paralog B [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
ENSPMAT00000002572.11.365e-1124.06pep scaffold:Pmarinus_7.0:GL481125:3469:15813:1 ge... [more]
ENSPMAT00000002568.11.218e-924.17pep scaffold:Pmarinus_7.0:GL481125:3469:15813:1 ge... [more]
dmc14.610e-927.18DNA meiotic recombinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
xrcc34.826e-924.52X-ray repair complementing defective repair in Chi... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DMC18.942e-1026.00Meiosis-specific recombinase required for double-s... [more]
RAD513.713e-726.03Strand exchange protein; forms a helical filament ... [more]
RAD557.483e-729.20Protein that stimulates strand exchange; stimulate... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO402477.097e-1531.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RAD51 paralog B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad51d1.577e-1931.03RAD51 paralog D [Source:NCBI gene;Acc:101156999][more]
rad51c1.431e-1826.61RAD51 paralog C [Source:ZFIN;Acc:ZDB-GENE-041010-2... [more]
rad514.222e-1225.47RAD51 recombinase [Source:NCBI gene;Acc:101162334][more]
xrcc36.750e-1025.36X-ray repair complementing defective repair in Chi... [more]
dmc12.736e-925.64DNA meiotic recombinase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of RAD51 paralog B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021450.17.226e-17999.59SMESG000021450.1[more]
SMESG000021450.13.464e-4998.72SMESG000021450.1[more]
SMESG000035891.16.849e-2131.63SMESG000035891.1[more]
SMESG000035891.12.641e-1231.43SMESG000035891.1[more]
SMESG000056159.15.181e-1022.73SMESG000056159.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017521 ID=SMED30017521|Name=RAD51 paralog B|organism=Schmidtea mediterranea sexual|type=transcript|length=1184bp
CATTTTCTCAATAAGTTGTTTGAATATTTAAAATTTAATTTCTTACAAAT
AAAATATTTTATTAAACAACTATATCAATATATGAATATTTTAAGTTATA
CTACCGAGTATTTAATAAAGAAATGGAATTTAACTAAAAACAATGTTCTG
AATATTCAAAGAAGAGAAGCAGACAAAATAATATGCGACATTGAATGTTC
TATTTATATGAACAAATGAATCAGAAAGTTATTACTCCATTGTATTCACT
AAATAAAATTTTAAATGGTGGATTACCAAGTGGAACTATAACCGAACTAG
TCGGTCCACCAGGCAGTGGTAAATCTCAATTTTGCATGACATTTGTCGCC
AATCATTTAAACAATATCAATCAGTCTAGTATTTTTTACATTGATACAAA
TGGCAATTTTTCAATGAATCGTTTATTTCAAATTTTGAAAAAGAATCTGA
CCCTTCCATTGGATAGCGATACAAATAATATGCTCTCTAAATTGTATTTT
TTTGAACCTACTGATAAGGACGATTTTTATGCAATATTTATTAATTTAAG
AGAATATTTACAAGCATTTAAACCAAAATTACTGATAATTGATTGTATGG
CTTATTACATTCGAACTATCAGTGACTTAGTTGAGCGTACTCGAATGTCA
TCTAAAATCATATCTATTTTAAAGAAGACGGCGATAGAATTTAATATGAC
AGTATTATTAACTAATCAAATAACCGGTGTCAATTCAAATTTTTATTTGG
AAAATGCTGCTCTAGGTAATTCTTGGTCACATTATATTAATACTCGAATC
TATCTTGACATTGATTGTCCTGATCGTCTTTTTTCAGAAAAATTTATAGA
AAGACAGGCCAGAATGGTTAAATCTTCGTTTGCATTCAACTTTGTGGTGC
CGTTTAAAATCGATGTAAATGGTGTATATGAAATATAAATTACAAATTTT
ATTAGTTTTCTCTTGTTAATTTTTAATTATTGTTTTTAAATTACACAACA
GTGGTCTATACAAGGTTACACGTGACACTGAAAGGGTTCCTTCAAAAGCC
TATTCTTGTCGTTTTGTTTTACAATGAAATTCTTAAGGATAAGTCGGATA
GTTTTGCATAATTTTAAAATAAAAATTAGTAATTAAATATTTATATTTTA
AGAAATATATATAATTAGCGATATCTAAAGGGCA
back to top

protein sequence of SMED30017521-orf-1

>SMED30017521-orf-1 ID=SMED30017521-orf-1|Name=SMED30017521-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MFYLYEQMNQKVITPLYSLNKILNGGLPSGTITELVGPPGSGKSQFCMTF
VANHLNNINQSSIFYIDTNGNFSMNRLFQILKKNLTLPLDSDTNNMLSKL
YFFEPTDKDDFYAIFINLREYLQAFKPKLLIIDCMAYYIRTISDLVERTR
MSSKIISILKKTAIEFNMTVLLTNQITGVNSNFYLENAALGNSWSHYINT
RIYLDIDCPDRLFSEKFIERQARMVKSSFAFNFVVPFKIDVNGVYEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR013632DNA_recomb/repair_Rad51_C
IPR020588RecA_ATP-bd
Vocabulary: molecular function
TermDefinition
GO:0008094DNA-dependent ATPase activity
GO:0003677DNA binding
GO:0005524ATP binding
GO:0000150recombinase activity
GO:0000166nucleotide binding
GO:0003690double-stranded DNA binding
GO:0003697single-stranded DNA binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0000707meiotic DNA recombinase assembly
GO:0000724double-strand break repair via homologous recombination
GO:0000731DNA synthesis involved in DNA repair
GO:0000732strand displacement
GO:0006310DNA recombination
GO:0006312mitotic recombination
GO:0006974cellular response to DNA damage stimulus
GO:0007131reciprocal meiotic recombination
GO:0007596blood coagulation
GO:0010212response to ionizing radiation
GO:0010971positive regulation of G2/M transition of mitotic cell cycle
GO:0042148strand invasion
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005657replication fork
GO:0033063Rad51B-Rad51C-Rad51D-XRCC2 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013632DNA recombination and repair protein Rad51-like, C-terminalPFAMPF08423Rad51coord: 14..245
e-value: 5.4E-24
score: 84.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 5..247
e-value: 3.8E-51
score: 176.0
NoneNo IPR availablePANTHERPTHR46239FAMILY NOT NAMEDcoord: 6..245
IPR020588DNA recombination and repair protein RecA-like, ATP-binding domainPROSITEPS50162RECA_2coord: 8..176
score: 31.036
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 11..240