SMED30017519

Overview
NameSMED30017519
Smed IDSMED30017519
Length (bp)1579
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017519 (SMED30017519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017519 (SMED30017519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30017519h1SMcG0006771 dd_Smed_v4_8451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017519h1SMcG0006771 dd_Smed_v4_8451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017519h1SMcG0006771 dd_Smed_v4_8451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017519h1SMcG0006770 dd_Smed_v4_8451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017519h1SMcG0006770 dd_Smed_v4_8451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017519h1SMcG0006770 dd_Smed_v4_8451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30017519 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005736:29879..36036 -6061
Homology
BLAST of SMED30017519 vs. Planmine SMEST
Match: SMESG000055195.1 (SMESG000055195.1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 352/496 (70.97%), Postives = 392/496 (79.03%), Query Frame = 3
Query:    6 FCSFLMDNFKCYFFILGFVNLISIFSSSYLYAEYNKTFRKMERIVFNISFRDFGVFLLYATDSDGFKLLIEAGNLYKTKEIYFNFNGHLFNKSITNFSNFINHFDVVLTFQSNSLKYDENGVISDIFYMKPFFPDAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGFKGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTKVNFLDCSFPSVNTKRMCYKDLIRTDNQSVIYKKFPDSNESTSFKIIWKQERFEKFCLTEIEMXXXXXXXXXXXXXXXRDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPSTPHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNEYTEAEPS 1493
            F SF M+  KCY FI    N ISIFSSSYLYAEY KTFR M+R   NISFR F  FLLYA D+DG ++L+E  N Y  K+I  NFNG L   S+   ++ + HF  ++ F++N L +D+ G I DIF MK  FPD+F NYPVP +++ + NK YFWIGN+G Y G  G  YE      FGC++ LY+D   ++ I  ++ FS++C +   E +CVKDNCS+     NFLDCSF  +NT RMCYKDLIR DNQSV+YKKFPDSNESTSFKIIWKQERFE+FCL EI+M               +DGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPS PHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNE TEAEPS
Sbjct:    3 FVSFAMEYLKCYLFISHLSNFISIFSSSYLYAEYGKTFRNMKRFSINISFRGFDGFLLYAIDTDGNRMLVEMENFYGRKQISLNFNGILHKISVIYHTDSVYHFAQIMRFETNKLLFDQ-GAIYDIFPMKRVFPDSFENYPVPNNYSRIANKTYFWIGNVGPYTGMNGIKYEALRDAIFGCIHFLYIDFKKIQIINNSKNFSKSCTNSYRETICVKDNCSVQNKSENFLDCSFSGLNTNRMCYKDLIRNDNQSVVYKKFPDSNESTSFKIIWKQERFERFCLAEIDM---------------KDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPSIPHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNENTEAEPS 482          
BLAST of SMED30017519 vs. Planmine SMEST
Match: SMESG000055195.1 (SMESG000055195.1)

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 349/491 (71.08%), Postives = 389/491 (79.23%), Query Frame = 3
Query:   21 MDNFKCYFFILGFVNLISIFSSSYLYAEYNKTFRKMERIVFNISFRDFGVFLLYATDSDGFKLLIEAGNLYKTKEIYFNFNGHLFNKSITNFSNFINHFDVVLTFQSNSLKYDENGVISDIFYMKPFFPDAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGFKGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTKVNFLDCSFPSVNTKRMCYKDLIRTDNQSVIYKKFPDSNESTSFKIIWKQERFEKFCLTEIEMXXXXXXXXXXXXXXXRDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPSTPHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNEYTEAEPS 1493
            M+  KCY FI    N ISIFSSSYLYAEY KTFR M+R   NISFR F  FLLYA D+DG ++L+E  N Y  K+I  NFNG L   S+   ++ + HF  ++ F++N L +D+ G I DIF MK  FPD+F NYPVP +++ + NK YFWIGN+G Y G  G  YE      FGC++ LY+D   ++ I  ++ FS++C +   E +CVKDNCS+     NFLDCSF  +NT RMCYKDLIR DNQSV+YKKFPDSNESTSFKIIWKQERFE+FCL EI+M               +DGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPS PHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNE TEAEPS
Sbjct:    1 MEYLKCYLFISHLSNFISIFSSSYLYAEYGKTFRNMKRFSINISFRGFDGFLLYAIDTDGNRMLVEMENFYGRKQISLNFNGILHKISVIYHTDSVYHFAQIMRFETNKLLFDQ-GAIYDIFPMKRVFPDSFENYPVPNNYSRIANKTYFWIGNVGPYTGMNGIKYEALRDAIFGCIHFLYIDFKKIQIINNSKNFSKSCTNSYRETICVKDNCSVQNKSENFLDCSFSGLNTNRMCYKDLIRNDNQSVVYKKFPDSNESTSFKIIWKQERFERFCLAEIDM---------------KDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPSIPHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNENTEAEPS 475          
BLAST of SMED30017519 vs. Planmine SMEST
Match: SMESG000055206.1 (SMESG000055206.1)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 344/455 (75.60%), Postives = 361/455 (79.34%), Query Frame = 3
Query:  126 MERIVFNISFRDFGVFLLYATDSDGFKLLIEAGNLYKTKEIYFNFNGHLFNKSITNFSNFINHFDVVLTFQSNSLKYDENGVISDIFYMKPFFPDAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGFKGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTKVNFLDCSFPSVNTKRMCYKDLIRTDNQSVIYKKFPDSNESTSFKIIWKQERFEKFCLTEIEMXXXXXXXXXXXXXXXRDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSKIPSTPHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPIYSQIATRNEYTEAEP 1490
            MERIVFNISFRDFG FLLYATDSDGFKLLIEAGNLYKTKEIYFNFNGHLFNKSITNFSNFINHFDVVLTFQSNSLKYD+NGVISDIFYMKPFF DAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGF+GRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTK NFLDCSFPSVNTKRMCYKDLIR DNQSV+YKKF DSNESTSFKIIWKQERFE+FCL EI+M               +DGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSC                               Y+FLS  Y   +T L      + F S  +++     SP   NN E+  V+    + P+   I  + E    EP
Sbjct:    1 MERIVFNISFRDFGGFLLYATDSDGFKLLIEAGNLYKTKEIYFNFNGHLFNKSITNFSNFINHFDVVLTFQSNSLKYDKNGVISDIFYMKPFFSDAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGFEGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTKENFLDCSFPSVNTKRMCYKDLIRNDNQSVVYKKFLDSNESTSFKIIWKQERFERFCLAEIDM---------------KDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSC------------------------------FYYFLSFGYSFFITLLCGASFLIYFKSKFRRQNPTFESPYNGNNYESVEVQNMA-FRPL--PIPEKEEKNLTEP 407          
BLAST of SMED30017519 vs. Planmine SMEST
Match: SMESG000055117.1 (SMESG000055117.1)

HSP 1 Score: 175.637 bits (444), Expect = 6.895e-49
Identity = 134/490 (27.35%), Postives = 229/490 (46.73%), Query Frame = 3
Query:   27 NFKCYFFILGFVNLISIFSSSYLYAEYNKTFRKMERIVFNISFRDFGVFLLYATDSDGFKLLIEAGNLYKTK-EIYFNFNGHLFNKSITNFS-NFINHFDVVLTFQSNSL--KYDENGVISDIFYMKPFFPDAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGFKGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTKVNFLDCSFPSVNTKRMCYKDLIRTDNQSVIYKKFPDSNESTSFKIIWKQERFEKFCLTEIEMXXXXXXXXXXXXXXXRDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFK---LICPSKIPSTPH-----KIYFFLSLIYDAMMTFLFAVLCTL-----RFCSNSKQKVVKITSPIEINNNETTYVEETGDYEPI 1445
            NF+ Y  +L     I++   S+LY E +  F     + F ++ +DF   LLYA D++G  L I+  +L+  K E  +NFNG  F K   + + + +    ++L F+ N+L  KY+    +SDIF       D F  +P+P  + ++KNK + WIGN+          Y+ +     GCL+  Y++   ++F +  + FS  C+   DE++C  ++C   K   N LDCSF S+N    C+KDL   +NQ  +Y+    + E +SFK+IW+      FCL  + +                D S   FY+   N +           +  +++L       I++++   +++++ +KI+NG  + +F+D     +K I +G S     C  F G I   YD +QF+   L   +K  S+ +      I   LS     ++  L   +CT+     +F S   +   +  +  E+ N  TTY  E+  YE I
Sbjct:    2 NFQVYLIMLMLNFQINLSRESHLYQEIDGEFGNKISLSFGVTLKDFNGVLLYAIDTNGNWLSIKTRDLFYLKNEFVYNFNGQKFIKPSDSVNVHSVLQMHILLKFKENNLYFKYEPEYSLSDIFNKSHLHEDYFDKFPMPHRYLSVKNKTFIWIGNVPSG-------YKTYVKSNIGCLDYFYINSLRVKFDQIGKEFSPFCIEEKDENICYNNSCYSNKFFENILDCSFFSLNVNSHCHKDLSDHENQRNLYENLTSNVEESSFKLIWRFNYTNNFCLLNVILS---------------DNSTIRFYMDNENTVRMRLTGRNSKTISLQRTL---RAGSINIIIIKCEDTELYVKITNGSSVTSFRDYISSTVKLIYLGVSTGMTDCTDFNGHIDLLYDATQFQRRALPIINKCTSSNYLKENTWIILLLSSGVINLVLILAVSVCTIKWKVRKFSSLKSRNSYETVNHSELPNVVTTYQLESVGYETI 466          
BLAST of SMED30017519 vs. Planmine SMEST
Match: SMESG000056437.1 (SMESG000056437.1)

HSP 1 Score: 170.629 bits (431), Expect = 6.458e-47
Identity = 122/471 (25.90%), Postives = 219/471 (46.50%), Query Frame = 3
Query:   18 LMDNFKCYFFILGFVNLISIFSSSYLYAEYNKTFRKMERIVFNISFRDFG-VFLLYATDSDGFKLLIEAGNLYKTK-EIYFNFNGHLFNKSIT--NFSNFINHFDVVLTFQSNSLKYDE----NGVISDIFYMKPFFPDAFRNYPVPKDFTNLKNKVYFWIGNIGRYVGFKGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTCLHLVDEHLCVKDNCSLIKTKVNFLDCSFPSVNTKRMCYKDLIRTDNQSVIYKKFPDSNESTSFKIIWKQERFEKFCLTEIEMXXXXXXXXXXXXXXXRDGSYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQVLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDISQFKLICPSK--------IPSTPHKIYFFLSLIYDAMMTFLFAV-LCTLRFCSNSKQKVVKIT 1379
            +M +FK    +  F+N I +FSS YLY + ++ F    +   ++ FRD     LLYA D +  + LIE+   Y+ + +I FNFNG +FN + T   FS   + F + L F+ ++L   +    +  + ++F      PD F  YP+  D  +      FW+GN+G  +G    +++P      GC+ +  ++   ++F    +     C     E +C+K  C   + +   LDCS   +NTK  CY+D +    Q++ Y       E    K++WKQE  + +CL EIE                +  S  + Y    NE+      NR S   T+++L  +  + IHVL+  F     ++KISNG  + TF + +   I +I + Y  +   C  F+G++ F+Y+   F  +   +        I  +   +   ++++   ++  +  + +C L+   NS++K+  +T
Sbjct:    1 MMLSFKRCLLLSFFINYIQLFSSGYLYGKLDENFENGMQFYIDLDFRDVSHGILLYAIDRNRNRFLIESAEKYRGRRKIVFNFNGQIFNSTNTYWRFSG-TSTFTIFLQFKYDNLYIMDYSYRHATLLNVFNRNKTNPDTFVGYPISDDHNSTTRTTDFWLGNVGPSIGKDKTVFQPSKVQMVGCVYNFRINYKEIKFTTYGDDLLPFCRKQFSETICIKGKCKKEQRRSYILDCSLSEMNTKEYCYEDFLTYMGQTLSYLTVGLGEEPRIMKMVWKQEFSKDYCLLEIE---------------TKKESSILVYANRLNEIVLNIRSNR-SVEWTRRTLCKMQPNLIHVLLIEFVYPNFVLKISNGSNVLTFIEHYPDYIIKIDVAYKSHRNLCSTFEGQLAFQYEPGLFLQLNKQETTAVNVFHIIHSWRSVLCLITILSLGLVILVIGICICHLKKVENSRKKLTIVT 454          
The following BLAST results are available for this feature:
BLAST of SMED30017519 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017519 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055195.10.000e+070.97SMESG000055195.1[more]
SMESG000055195.10.000e+071.08SMESG000055195.1[more]
SMESG000055206.10.000e+075.60SMESG000055206.1[more]
SMESG000055117.16.895e-4927.35SMESG000055117.1[more]
SMESG000056437.16.458e-4725.90SMESG000056437.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017519 ID=SMED30017519|Name=SMED30017519|organism=Schmidtea mediterranea sexual|type=transcript|length=1579bp
TTTAATTTTGCTCTTTTCTCATGGACAATTTTAAATGCTATTTTTTCATT
TTAGGTTTCGTCAACTTGATTTCCATATTTTCTTCTTCTTATTTGTATGC
GGAATACAACAAAACATTTCGAAAAATGGAGAGGATAGTCTTTAATATTT
CATTTAGGGACTTTGGAGTATTTTTACTATATGCAACTGATTCGGATGGT
TTCAAGCTTTTGATTGAGGCGGGAAACCTTTACAAAACGAAAGAAATTTA
TTTCAATTTCAATGGACACTTATTCAATAAATCCATAACCAATTTTTCTA
ATTTTATCAACCATTTTGATGTGGTTTTGACATTTCAGTCAAATAGTCTG
AAATATGATGAAAACGGGGTAATATCAGACATCTTTTATATGAAACCATT
TTTCCCAGATGCATTTAGAAATTATCCGGTACCGAAAGATTTTACAAATT
TAAAAAACAAAGTCTATTTTTGGATTGGCAATATTGGGAGGTATGTTGGT
TTCAAAGGGAGGATTTATGAACCTTTCACAACACCAACATTCGGTTGTTT
AAATTCATTGTATGTTGATGATTATTCCCTTGAATTTATAAAAGAAGCAG
AATATTTTTCAAGGACTTGTTTACATCTTGTTGATGAGCATTTATGCGTT
AAGGATAATTGTTCATTAATAAAAACAAAAGTAAACTTTCTTGACTGCTC
ATTCCCTTCTGTAAATACAAAAAGAATGTGCTATAAAGACCTAATTCGTA
CTGACAATCAGAGCGTAATCTATAAGAAATTTCCTGATTCAAATGAGTCA
ACTTCATTTAAAATTATTTGGAAACAAGAAAGGTTCGAAAAATTTTGCTT
GACAGAAATTGAGATGAAGTTTGATAAGAACAATATTAATTTCAAATTAA
TAATAATAATTAGAGATGGCTCTTATTTTATATTTTATATCACTGAAAAC
AACGAGCTGTCAAAGTGCTTCATTGAAAACCGATTTTCACCGGTTTGCAC
CAAAAAATCCTTATTCAATGTCACAACGGATGAGATTCACGTTTTAATGT
TCACATTTGACAATTCACAGGTCCTCATCAAGATTTCTAATGGAAAATAT
ATCCAAACATTTAAGGATGAGTTTCAAAGGAAGATAAAGCAAATAAAAAT
TGGTTATTCGGAAAATACAAAAAGTTGTGTAAGATTTCAAGGAGAAATTA
CTTTTCGATACGACATTTCTCAGTTTAAATTGATATGTCCGTCAAAGATT
CCATCAACTCCCCACAAGATTTATTTTTTTTTATCTTTGATTTATGACGC
TATGATGACTTTTTTGTTTGCCGTTCTTTGCACTCTGCGATTCTGTTCTA
ATTCTAAACAAAAAGTGGTGAAAATAACGTCACCCATCGAAATAAACAAT
AATGAAACTACATATGTTGAGGAAACTGGCGATTATGAACCCATCTACAG
CCAAATTGCCACCAGGAATGAATATACTGAGGCAGAACCTTCAGTTTATG
ATTATGTGACACTATAATGATATACATATATAAACTTTTACAATTGATGA
TTTAAAATATTTTGTTTATTCAATGTCAT
back to top

protein sequence of SMED30017519-orf-1

>SMED30017519-orf-1 ID=SMED30017519-orf-1|Name=SMED30017519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MDNFKCYFFILGFVNLISIFSSSYLYAEYNKTFRKMERIVFNISFRDFGV
FLLYATDSDGFKLLIEAGNLYKTKEIYFNFNGHLFNKSITNFSNFINHFD
VVLTFQSNSLKYDENGVISDIFYMKPFFPDAFRNYPVPKDFTNLKNKVYF
WIGNIGRYVGFKGRIYEPFTTPTFGCLNSLYVDDYSLEFIKEAEYFSRTC
LHLVDEHLCVKDNCSLIKTKVNFLDCSFPSVNTKRMCYKDLIRTDNQSVI
YKKFPDSNESTSFKIIWKQERFEKFCLTEIEMKFDKNNINFKLIIIIRDG
SYFIFYITENNELSKCFIENRFSPVCTKKSLFNVTTDEIHVLMFTFDNSQ
VLIKISNGKYIQTFKDEFQRKIKQIKIGYSENTKSCVRFQGEITFRYDIS
QFKLICPSKIPSTPHKIYFFLSLIYDAMMTFLFAVLCTLRFCSNSKQKVV
KITSPIEINNNETTYVEETGDYEPIYSQIATRNEYTEAEPSVYDYVTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 7..29