Collagen alpha-2(IV) chain

Overview
NameCollagen alpha-2(IV) chain
Smed IDSMED30017516
Length (bp)5531
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen alpha-2(IV) chain (SMED30017516) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen alpha-2(IV) chain (SMED30017516) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen alpha-2(IV) chain (SMED30017516) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen alpha-2(IV) chain (SMED30017516) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017516

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017516SMESG000021729.1 Contig51093newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017516SMESG000021729.1 Contig51093uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017516SMESG000021729.1 Contig51405newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017516SMESG000021729.1 Contig51405uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30017516SMESG000021729.1 dd_Smed_v6_2197_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30017516SMESG000021729.1 dd_Smed_v6_2197_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30017516SMESG000021729.1 dd_Smed_v6_2197_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30017516SMESG000021729.1 dd_Smed_v4_2197_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Human
Match: COL4A2 (collagen type IV alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2203])

HSP 1 Score: 299.286 bits (765), Expect = 3.156e-81
Identity = 359/1111 (32.31%), Postives = 472/1111 (42.48%), Query Frame = 1
Query: 2443 FDGVPGIPGKRGQSGLDGEKGD---------------IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI---KGIKGDSGEPG---VQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGD---RGETGKPG-----------PIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNM-GVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGP---KGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-------------------------------------------PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGE---MGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEP---AV----------RGPKGVKGE------------QGLSGYSGQE--------QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV-DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            F G PG  G RG  G  G  G                 G +G+ G++    + G +GD G  G PG+  KG  G RG  G  G +G+PG+ G  G  G  G  G  G +GP G  G  G  G+ GP+G   I   +G+ GD G+PG     G  G  G SGD+G+    GE G  G  G KG  G+ G  G+ GD+G  GM G  G  G KG  G  G KG  G  G    +G  G+PG              P    G K I G KG++G MG+KG  G KG QG  G+       G  G  G++ GV G++G  G  G PG  G  G  G TG    IG +G+ G+ G  G  G+ G  G                        D G+IG    +                     G  G+ GE+G +GI  LKG  G                            +G EGDIG  G  GV G  GP   KG  G  G  GP G+ G  G  G  G  G+DG  G  G  G  GL G                                           P   G  G +G+ GAPG+ G  G  GL+G PG        G PG+  +G  G  G KG  G  G  G +   G  G++G  GA G  G  G  G                        ++GP+G  G+ G+ G +G +GE   MG+TG  GA                 +     KG +G+ G PG  G VG+ G  G P   AV          RGP G  GE            +G  G +G +         G  GD+G IG QG        G +G  G  G  G  G  G+++   +L  +H Q  +E P+CP+G NK++ GYS +   G  + +  +LG   SCL  F+ MPF  C+    C    R D+SYWL++ AP+    +    ++ YISRC  CE+PA   A HSQ  ++S   CP  W  LW GYSF+MHT  G+ GGGQSL SPGSCL  FR +P +ECN G   C+++ +  S++L  + +  F+        A+  K+  +   +SRC+VCMK
Sbjct:  730 FPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEV-LGAQPGPRGDAGVPGQPGL--KGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATG------------------------DFGDIGDTINL--------------------PGRPGLKGERGTTGIPGLKGFFG---------------------------EKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGD--KGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAG------------------------DSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGA-----------------VGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGP------IGQEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQE-PMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQ--DVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQ----GSPSADTLKAGLIRTHISRCQVCMK 1710          

HSP 2 Score: 189.119 bits (479), Expect = 2.706e-47
Identity = 309/865 (35.72%), Postives = 387/865 (44.74%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERG-PSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREET--------FPSIKGEKGDNGPDG------KEGPKGIKGSPGLNGKPGISGDMGKM-GVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNC--TINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPG---------------------------ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKG-------EQGMMGVKGNNGPKGDQGEKGLETKGQRGE-KGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKG 3387
            PG  GA G  G +G  G+ G  G PGP   PG  G +G +G+ G+ G  G  G  G+ G  G  G RG  GEV         +G   GP+G   D G  G  G+ G  G+ G  GF+G  G  G         +PG +G  G  G +G+ G +GP G  GF                     G  G EG  G  GI G +G+ G+RG P      G VG KG  G++G +G  G+ G  G  G KG+ G                 G  G KG  G  G DG  G+ G +GRPG  G+ G  G +G  G +GL G+ G KG++GD                IKGEKGD GP G       +G +G+ G PGL+G PG+ G  G + GVKGD G PG+ GL G  G  G  GI   P   G RG +G  G   + GE G  GD G+   TIN   P      G+RG TG PGL+G  G+ G +GD G  G  G                       GV G PG +GQ+G  G  G  G+QG   ++G  G  G KGD G  G PG+ G  G  G RG  G  G +G PG                           + G +G  G+ G+QG  G  GP G  G++G    PG      I G  GD G PG+ GLKG+ G  G  G  +  G  G+ G+ G  G  G KG  G +G +G  G+ G  GE G +G+QG  G  G  G +GDRG  G  G  G  GA G  G  GI G       + G +G +G  GP G  GE G +        +G  G  G  G  G    PG RG +G  G  G IGQ+G  G  G  G  G  G
Sbjct:  707 PGFAGADGGPGPRGLPGDAGREGFPGP---PGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEV---------LGAQPGPRG---DAGVPGQPGLKGLPGDRGPPGFRGSQGMPG---------MPGLKGQPGLPGPSGQPGLYGPPGLHGF--------------------PGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGIDGMP---------------GTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINL--PGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITG---------------------VTGVQGPPGLKGQTGFPGLTGPPGSQG---ELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGF---PGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPG 1483          

HSP 3 Score: 155.606 bits (392), Expect = 4.978e-37
Identity = 280/855 (32.75%), Postives = 356/855 (41.64%), Query Frame = 1
Query: 1507 GDSGDEGLQGEKGISGSKGVKGERGPSG-RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNF-GPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGD-----------RGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAKGELG---EPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNG-PTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGEL------------GPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEM 3954
            G  GD G+ G+ G+   KG+ G+RGP G R + G+ G  G KG+ GL G  G+ G  GP G+ G  G                    G++G  GL G  G  G+ GDRG PG+ GA G  G  G  GDR   GD G  G      E+  P   G KG +G  G  G KG +GSPG++G  G+ G  G+ G  G                           +GE G  G  G+K + GE G KG  G+       P+    M D    GE G +GP+G   +KG  GAKG                          G+PGIPG  G  GL G  G I  +G+KGDIG  G  G  G  G  G PGI G  G  GSRG++G  G  GL    G+IG  G+ G+ GD  N  G  G KG +G TG PG  G    KG +GD G PG+ G+ G  G  G KG+    G  G  G  G  G  G+ G +G +G  G  G+ G  G  G +G  GL G KG  G  G             GE G PG    +   GP G+ G KG+QG  G +G  G  G QG  G+       G  G+KG  G+ G  G +G  G      + GSKGD G  G     G KG +G +G  G  G  G+ G                                                   + GP+G  G  G  G +G +  +G  GP GD G P     +         + +  + G  G  G +G  G  GE+            G  G  GPQG  G     G +G+ GP G  G  G +G  G  G+ GL G    GRS + G +
Sbjct:  782 GPRGDAGVPGQPGL---KGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAP------------------GQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDR---GDAGFTG------EQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGS--------------------------KGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKD--IKGEKGDEGPMG---LKGYLGAKG------------------------IQGMPGIPGLSGIPGLPGRPGHI--KGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL---YGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEA--NTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPG---------------------------------------------------EKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPG--MPGRSVSIGYL 1491          

HSP 4 Score: 131.339 bits (329), Expect = 1.130e-29
Identity = 230/665 (34.59%), Postives = 290/665 (43.61%), Query Frame = 1
Query: 2278 TEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGE-----------------QGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGE-------PGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQG---------------DQGPKGNTGSKGE------------TGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
             + G RGD G PG  G  G  G +G  G +GS                         G+PG+PG +GQ GL G  G     G+ G  G  G  GA G  G +G PGI    G+ G+ G  G+ G  G  G+ G++GD G+ G +GEQG  G+    GFKGI G  G PG  GD+   G+ G  G PG++G  GF G  G+ G       FG  G  G  GE G KG                  + I G+KG+ G +G  G  G KG QG+ G  G  G+    G  G+PG I      G KG  G+ G  G+ G  G  GP G  G  G   ++G +G  G  G+ G +GA G+ G+       PG  G KG+ G TGI    G  GE G+ G+ G  G  G+ G +G  G  G  G  GL G  G +G++G IG  G  G  G  G           G  G  G+ G +GL G+   KG  G  G +                        G  G  G+KG++G  GE GP G+ G QG               D+G  G  G KG              G KGD G  G  G  G KG  G SGP  QGR    G  G PG+ G +GEQG  G  G  G +GD+G      +GP GD G  G
Sbjct:  779 AQPGPRGDAGVPGQPGLKGLPGDRGPPGFRGSQ------------------------GMPGMPGLKGQPGLPGPSG---QPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGS---PGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGF------FGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGI---PGLPGRPGHI-----KGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPG---------APGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGP--QGRP---GVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGP-----KGPKGDPGFPG 1380          

HSP 5 Score: 105.531 bits (262), Expect = 8.995e-22
Identity = 247/698 (35.39%), Postives = 301/698 (43.12%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPG---CNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPG----DFFQAKKGEKGF--------AXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGK-----TP-----PDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNR----GTPGPKGQ------PGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGY---------QGNLGEKGFKXXXXXXXXXXXXX------------XSCLPGKRGDIGDKGENGESGAHGPRGDFGF----------NXXXXXXXXXXXXXKTVKG------------IKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAG-------RDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVK 2079
            G+PGP G       PG  GP G  G  G  G  G +G  G  G++GLPGDRG+ GD G PG  G  G   L GDRGD G  G     G+ G KG DG+ G  GL GD+G  G  G+ G PG      F   KGE GF           E                     G K I+G+ GD+GP+G+ G  G   KGI  +G  G PG  G  G   +   +KG       P     P   G +G  G  G  G  G +G  G PG  G  G+ G  GD G++G+     G PG KG+      PG KG  G +G++G IGF G+ G  G+QG  G  G  G  G  G  G  G+ +G I  P G  GD G  G  G+PG+          G  G KGF G PG +                    + LPG  G  G KG+ G  G  GP G  G           N               +KG            + G  GD G  G  G  G+KG  G+ GP GRP   GL G KGP+GE+G  G  G  G VG +G KG  G              G  G  G  G  G+AG       + G  G +G RG PG  G +G +G  G+ G RG PG  G +G  G S    F   +G  G  GP G+EG  G  GSPGL G PG S  +G + VK
Sbjct:  824 GLPGPSG------QPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKG---LSGDRGDAGFTGEQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGA--KGI--QGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGE-LGRIGLPGG-KGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDP------------GFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSVSIGYLLVK 1494          

HSP 6 Score: 100.523 bits (249), Expect = 2.977e-20
Identity = 212/589 (35.99%), Postives = 262/589 (44.48%), Query Frame = 1
Query: 2476 GQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAI---------GNPGIGIKGNEGSRGEEG---ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL------------------ETKGQRGEKGNMGVIGNVGAKGELGEPG----------------MRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEK------GLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGE-----TGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKI------GRMGDKGKPG 4047
            G+ G  G  G IG +G KG +G  G  G+ G  G           G PG  +    G RG+ G   + G++GLP   GD G  G  G QG  G  G KG  G+ G +G+PG  G   + G  G  G+ G  GL G  G  G           G+RGD G  G  G  G +G++GD+G++G  G  G  G  G +G++G  G  G+ GDRG  G  G  G  G  G  G  G KGE G  G+ G  G  G+ G KG                   + KG++G++G MG+ G +GAKG  G PG                ++G KGD G  GI G  G  G  G  G  G  G  G +GD G  G  G  G  G  G+ GDIG+             G+ G +G  G  G  GL G  GEK      G  GIT + G  GP G  G TG  GL G  G +G  G  G  G +GD G  G  G+ G  G +G  G  G  G KG  GS G       G  G  GE GD G         L GP   G  G +G+ GAPG+ G  G  GL+G PG        G  GDKG PG
Sbjct:  726 GREGFPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQPGPRGDAGVPGQPGLKGLP---GDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLP---------GDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDT--------INLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEA-----NTLPGPV--GVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPG 1287          

HSP 7 Score: 79.7221 bits (195), Expect = 4.975e-14
Identity = 182/556 (32.73%), Postives = 234/556 (42.09%), Query Frame = 1
Query: 1816 RGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGL---QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVG-------DKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGN-----------VGVIGDRGETGKPGPIGPDGATGPKGING-------IKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAK---GELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKG 3387
            +G RG+PG    +G +G  G  G +G PG +G KG KG+         +G  G  GP G  G +G+ G PG +G PG  G  G  G  G +G                        QG+ G QG  G +   G  G +G  G     +  P    +   RG+ GEPGL   QGP G+ G  G Q              P  P  +      GF GV G  G  GQ G +G   D  +  +            KG+ G+ G PGI     +G  G  G  G+RG PG++G+ G+ G+ G +G  G  GP G +G KG  G PGP G           KG +GD G PG QG  G  GE GD G     G     GD      RG+ GE G  G  G+ G+    G       +                    G+ G +G  G PG  G  GA GPKG  G        +G++ + G+ G  GPKG  G  G    KG RG+ G  G+ G  G K   G +G PG +G+KGD+    I  KGE G  G  G  G KG
Sbjct:   57 KGGRGQPG---PVGPQGYNGPPGLQGFPGLQGRKGDKGE---------RGAPGVTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDG--------------------CNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERDR-YRGEPGEPGLVGFQGPPGRPGHVG-QMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKGEKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGFPGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSLAKGARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQ----RRGLPGEMGPKGFIGDPGIPALYGGPPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAKGRAGFPGLPGSPGARGPKGWKGDAGECRCTEGDEAIKGLPGLPGPKGFAGINGEPGRKGDRGDPGQHGLPGFPGLKGVPGNIGAPGPKGAKGDS--RTITTKGERGQPGVPGVPGMKG 572          

HSP 8 Score: 57.7658 bits (138), Expect = 2.699e-7
Identity = 107/324 (33.02%), Postives = 130/324 (40.12%), Query Frame = 1
Query: 2638 ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQG------------------------INGDKGESGMIGRTGENGEKGDQG-----------------------LNGPKGNVGVIGDRGETGKPGP-----------IGPDGAT-------------GPKGINGI--KGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKG 3387
            E G RG PG  G  G  G  G QG  G    +G KG KG  G PG  G K   G +G SG PG  G+ G  G+ G +G     G  G +GD GP+G  G +G  G                          G+ GE G++G  G  G  G  G                        N   G  GV G++G+ G+PGP           I P G T             G  GI GI  KGE+G+MG  G  G  G  GEKG    KG RG  G  G  G  G KGE G+PG  G    +    +  KG  G  G  G++G+ G
Sbjct:   56 EKGGRGQPGPVGPQGYNGPPGLQGFPGL---QGRKGDKGERGAPGVTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERDRYRGEPGEPGLVGFQGPPGRPGHVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKGEKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGFPGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSL-AKGARGDPGFPGAQGEPG 375          

HSP 9 Score: 54.299 bits (129), Expect = 3.318e-6
Identity = 117/370 (31.62%), Postives = 151/370 (40.81%), Query Frame = 1
Query: 2827 VQGLKGFTGESGDK---GECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSN--------------------GEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETG 3843
            + G+K F    G +   G C    E G RG  GP G +G  G  G+   +G  G+ GR G+ GE+G  G+ GPKG+VG    RG +G PG  G  G  G  G  G  G  G  G +G++GP+G  G +G          KGQ+GE   +        +GE GEPG+ G +G  G  G +GQ G  G+                     G +G KG+KG                           D+G+ G  G    T              D  KG  G  GE G+ GI+LKGE G +G  G                      +G  G  GEKG+ G KG  G  G  GP G +GPKG  G  G  G
Sbjct:   32 LAGVKKFDVPCGGRDCSGGCQCYPEKGGRGQPGPVGPQGYNGPPGL---QGFPGLQGRKGDKGERGAPGVTGPKGDVGA---RGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERDRYRGEPGEPGLVGFQGPPGRPGHVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKGEKG---------------------------DVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGFPG---------------------LRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPG 347          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Human
Match: COL24A1 (collagen type XXIV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:20821])

HSP 1 Score: 233.802 bits (595), Expect = 5.685e-61
Identity = 374/1133 (33.01%), Postives = 478/1133 (42.19%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKG---------YTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQA-KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPG-----DQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGK--CIGN-----------IQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSK---------------GVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKG------DIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-------GIKGNEGSRGEEGETGM----------------------------------------------RGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGK---PGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGET 3324
            GIPGP G+ G  G PGP GPKG           G  G+ G  GL+G  G  G  GL G  G                  L G  G+ G+PG  G  G  G  G  G  G  G+ G KG +G+IG PG+  Q   +GE+G  G  G                 G +G +G  GD GD+GP G+ G PG       P     +G  G  GPIG AG    + +   K                              GL G  GD+G++G  G +G  G PG KG  G  G  G+RG  G  G  G  G +G  G  G +G  G  G  G+ G  G    +GN            QG +GP G  G+ G +G PG +G  GE G +G               L G+ GD G+ G+ GE+G  G  G+ G  G  G+           KG +G  G  G QGEKG+ G                 G  G RGP G       GPKG +G +G  GL G+ G  G KG KG                     +QG++G  GL G+ GNPG RG +G+PG       +G  G  GDRGLPG+ G++G +GD          GE G  GP G EG  G++G PG  G  G +G +G  G  G  G PG                      GE GLQG+ G+K + G +G  G                E G++G+ G PG+ GP+G+ G  G  G                            +G+ GIPG+RG+ G  G+KG      ++G++G  G IG  G  GA+G  GA+G+ G+       GI G  G +G+ G +G+                                               G+PG+ G  G QG  GE GD G  G KG +G +GN GK   PGP G   I G++G  G  G+QG  G  G SG+ G+    G+ G  G  G  G  G+ G  G  G KG SG+ G  G  G KG+QGL G  G  G  G RG  G  GP G  G  G  G  G++G  G  G  G  GP+GD G  G+   KG  G +GN G +G  G  G  G  G RG KG  GET
Sbjct:  516 GIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPG------------------LPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGK---------------KGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNK------------------------------GLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEG---------------LKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGE-----------KGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGS-----QGPKGQRGSRGPDGLLGEQGIQGAKGEKG---------------------DQGKRGPHGLIGKTGNPGERGFQGKPG------LQGLPGSTGDRGLPGEPGLRGLQGDV------GPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPG--------------------APGEEGLQGKDGLKGVPGGRGLPG----------------EDGEKGEMGLPGIIGPLGRSGQTGLPGP---------------------------EGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGET 1458          

HSP 2 Score: 216.468 bits (550), Expect = 1.081e-55
Identity = 386/1059 (36.45%), Postives = 493/1059 (46.55%), Query Frame = 1
Query: 1018 GNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREE------------TFPSIKGEKGDNGPDGKEGPKGIKGS------PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-------LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGV------KGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
            G RG PGP G PG  G  G +G  G  GF                  +   GE G+ G SG     + GP G  GDKG KG+ G+PG  G  G                     +PG  G+IG  G  G  G  GP G+ G               +   G  G++G  G +GE+GI G +G KG +G  G P  G  G +GP G  G  GL G  G  G  G++G +G    +            G  G  G  GL+G  G PGI+GD+G  G  G +G  G  GD G  GLPG  G++G  G S +                   G+ G  G +G EGPKG+ G+      PGL G  G  G +G  G  G  G P                       G++G  GE G    +G KGE GD GN            ++G+ G  G PG  G  G +G KG++G+ G  G  G+KG  G PG  GV G  G  G+PG  G RG  G  G KG  G++G  G +G++G  GAKG+ G  G  G    IG  GN G RG +G+ G++GLPG TGD G  GE G             +G++G+ G PG +G   ++G  G  GE G+QG  G  G+ G  G   G GE G RG+ G  GE G++G+ G+ G  G  G+    GE+GEKG+ GL    G +G +G  G+TG PGP G  G  G +G  G KG++G +G  G  G +G  G+ G    G +G +G  G +G++G  G  GEPG+ G +G  G     Q G SG  G  G KG  G              GP G +G  G  GD GE G  G  G  G +G  G RG TG+ GP G  G  GE+GL G          KG  GP G  G  G  GL G KG +G  G  G  GN G IG  G +G+       G  G  G  GP G +G  G  GS G  GPKG+ G  G  G  G +G++G  G   QG  G+ G  G PG+ G++G  G +G PG  G  GD G    GI GP G IG++G
Sbjct:  513 GPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPG---------------QPVPGEKGDQGLSG-----LMGPPGMQGDKGLKGHPGLPGLPGEQG---------------------IPGFAGNIGSPGYPGRQGLAGPEGNPG-----------PKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFP--GDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPI------------GPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKP-----------------------GQKGYAGEPGP---EGLKGEVGDQGNIG----------KIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPG------------LRGLQGDVGPPGEMG---MEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGL---PGEDGEKGEMGL---PGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIG--KSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQG-----QPGPSGLPGPKGEKGYPG--------EDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQG--DQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGI--VGISGPKGPIGHRG 1429          

HSP 3 Score: 201.06 bits (510), Expect = 6.302e-51
Identity = 355/1013 (35.04%), Postives = 464/1013 (45.80%), Query Frame = 1
Query:  736 GDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEK------------GISGSKGVKGERGPSGRP-------------------TTGLVGPKGPKGEKGLSG---------LDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGL---AGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKG---------DSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPI---------GKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNF------GPKGFKGIKGNTGKPGPVG-------------DKTIKGI------------KGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGIN---------------GIKGEQGMMGVKGNNGPKGDQ---GEKGLE-TKGQRGEKGNMGVIGNVGAKGELGE------------PGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            G +GP G+ G  G+        G  G PGP G  G         G+  P ++GD G  G  G  G  G KG+ G PGL G  G++G  G  GN+G+ G PG +G  G +G  G +G+ G I                     GS GE G+ G  G+     +G  G  G KG KG QG PG  G+ G  G  G PG  G  G  G   L   RG +G  G  G +G  GP G  G               K + GIKGD G++G  GE             G+ G  G++G+ GPSG+                      G+ G  GP+G KGL G         L G  G+ GP G  G LG   K          G KG  GE G +GL    G  GN G  G+ G  G  G +G  GS G+ G+RG PG  G +G KG                  + G  G  GP G +GPKG +GS G +G  G  G  G  G KGD+G           G  G  G    P  GERG QG+ G++ + G  G++G  G   +  ++       GD G  GE G++GP          G+ G KGD G  GS G +G+ G  G+PG  G +G +G DG+ G+PG RG  G DGEKG++G  G+ G +G  G++G  G  G +G PG     G KG++G  G  GE G RG PG  G  G +G  G +G +G+       G  G  G +G+ G+PGP G             D T+ G             +G+ GEPG +G KG  G  G +G    +G  GE GD   +GE+G+KGE+G  G+KG+ G  G +G+ G  G QGL GPKG  G  G  G +G PG IGP G  G  GI                G+KG  G+ G  G  GPKG+Q   G+ G++  +G RG +G+ G  G+ G KG+ GE            PG +G +GD G  GI G KG  G  G  G  G++G+
Sbjct:  510 GKRGPRGIPGPHGN-------PGLPGLPGPKGPKGDPG---FSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFI---------------------GSPGEAGQLGPEGE-----RGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL---RGSVGPVGPIGPAGIPGPMGLSG--------------NKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGK---------PGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGK---------RGPHGLIGKTGNP--GERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQ-------GDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGD---QGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGI 1439          

HSP 4 Score: 186.037 bits (471), Expect = 2.410e-46
Identity = 298/831 (35.86%), Postives = 386/831 (46.45%), Query Frame = 1
Query:  988 RGQKGDTGNV---------------GNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREE------------TFPSIKGEKGDNGPDGKEGPKGIKGS------PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGE 3363
            RG KGDTG                 G RG PGP G PG  G  G +G  G  GF                  +   GE G+ G SG     + GP G  GDKG KG+ G+PG  G  G                     +PG  G+IG  G  G  G  GP G+ G               +   G  G++G  G +GE+GI G +G KG +G  G P  G  G +GP G  G  GL G  G  G  G++G +G    +            G  G  G  GL+G  G PGI+GD+G  G  G +G  G  GD G  GLPG  G++G  G S +                   G+ G  G +G EGPKG+ G+      PGL G  G  G +G  G  G  G P                       G++G  GE G    +G KGE GD GN            ++G+ G  G PG  G  G +G KG++G+ G  G  G+KG  G PG  GV G  G  G+PG  G RG  G  G KG  G++G  G +G++G  GAKG+ G  G  G    IG  GN G RG +G+ G++GLPG TGD G  GE             G +G++G+ G PG +G   ++G  G  GE G+QG  G  G+ G  G   G GE G RG+ G  GE G++G+ G+ G  G  G+    GE+GEKG+ GL    G +G +G  G+TG PGP G  G  G +G  G KG++G +G  G  G +G  G+ G    KG RG +G +G +G +G  GE G PG RG +G  G +G+ G KGE G  GE
Sbjct:  488 RGPKGDTGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPG---------------QPVPGEKGDQGLSG-----LMGPPGMQGDKGLKGHPGLPGLPGEQG---------------------IPGFAGNIGSPGYPGRQGLAGPEGNPG-----------PKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFP--GDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPI------------GPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKP-----------------------GQKGYAGEPG---PEGLKGEVGDQGNI----------GKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEP------------GLRGLQGDVGPPGEMG---MEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGL---PGEDGEKGEMGL---PGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGE 1195          

HSP 5 Score: 150.214 bits (378), Expect = 1.840e-35
Identity = 288/812 (35.47%), Postives = 378/812 (46.55%), Query Frame = 1
Query: 1957 IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGK---RGQSGLDGEKGDI------------GNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGM------RGLPGITGDIGNQGESGEQGDI---------------------GNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKP------------GPIGPDGATGPKGINGIKGEQGMM---GVKGNNGPKGDQGEKGLE----------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-------ITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSG-------------------NRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGR 4092
            I G  G+ G  G  GPKG KG PG +    + G+ G  G+ G  G PG                    +QG++GL+G  G+  + GE+G  G +GN             +G  G  G  GL GP G  G KG QG  GS G +G+ G  G+ G  G++G KGF G  G PG    RG +GLDG  G +            G+ G  G IG  G  G  G +G  G PGI G KG +G+ GE GE G        GLPG  G  G  G SG+ GD                      G  GP+G KG+ GN G     G   +KG +G+ G  G  G  G  G+ G KG     G  G +G+VG +G  G  GE G  G  GE GM G  GE GE+G  G  GP+G  GV+G  G  G P            G  GP G+ GPKG  G +G  G++   G++G  G KGDQG++G             +G +G+ G  G+ G+ G +G  GEPG+RG +GD G  G +G +G  G+ GE G +G+ G                         KGD+G  GS G  G+ G  G+ G  G  G  G  GL G+ G +GL G       + L G  GP+G +G TG  G  G  G  G +G PG++G++G IG  G  G +G  G  G  GP+G +G +G  G  G  GP G+ G  G +G+ G  G  GL GP  ++G  G                   ++GE G PG  G KG  G+ GL G  G+ G  G+PG+    G++G  G  GNKG+
Sbjct:  517 IPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPG--------------------MQGDKGLKGHPGLPGLPGEQGIPGFAGN-------------IGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGP---PGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPG------------------------AKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGK 1268          

HSP 6 Score: 135.191 bits (339), Expect = 8.116e-31
Identity = 306/846 (36.17%), Postives = 385/846 (45.51%), Query Frame = 1
Query:  223 QNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGAR------------------GLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQA----KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ----PKGIAQKGEKGFPGPIGDAGTDCKL--FVLKGKT-PPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQ---GEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGK---DGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGS------PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGE 2631
            Q T   +G PG  GD G +G PGP G +G +G  G+ G                    G+ G +G  G  GL G+RG  G  G+ G  G+ G IG FG+ G  G PG  G  GE G +GL G++G  G+ G  G+ G +G PG+        +KGE+G  G  G  GEKG  G+ G  G+ G  G  G+ G VG +GP G  G  G +    P G+   GE+G  G  G+ G   K     L GKT  P +RG  G+ G  G  G TG +G+ GEPGL G  GD G  G+ G  G  GT G  G  G  GAKG  G+ G +G              G+ G RG  G  GE G  GK  +  + G +G  G+ G+KG  G+PG  G LG  G  G+PGP G +G  G    PGK+GD G  G  GE G+ GP G  G               K  +G +G  G  GL    GE GI G +G +G+ GPSG P        GPKGEKG  G D                 +  L   G  GE G  G+QGE+G+   +G  G  G PG+RG  G+ G  G  G +G  G  G+RG  G+KG KGA G S +   P ++G  G  G  G  G  GI G+      PG  G PGI G  G+ G+ G  G PG                    V+G  GL G  GI+   G KGE+G  G   I           G RG  G  G QGP G  G+KG  G  G                          G+ G  G  G  G +G+ G +G  G KG IG +G +G  G  G IG  G  G +G +G RGE
Sbjct:  719 QGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLL--GEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVG------------GTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIG-----------KSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLP--------GPKGEKGYPGED-----------------STVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPG--------------------VKGSSGLPGSPGIQ---GPKGEQGLPGQPGIQ----------GKRGHRGAQGDQGPCGDPGLKGQPGEYG------------------------VQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          

HSP 7 Score: 58.151 bits (139), Expect = 1.833e-7
Identity = 59/150 (39.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query: 3718 NEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGN------------------VGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGI------KGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGR 4092
            ++G+ GE G +G KG +G  G  G  G QGP G  G +GE G KG+ G +G+KG                   +GPKG +G  G    G SGN G++G PGK G+       G  GL G PG  G  G  G PG+ GI+GP G+ G  G+
Sbjct: 1214 DQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHG--ADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQ 1361          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 219.935 bits (559), Expect = 8.855e-57
Identity = 134/381 (35.17%), Postives = 198/381 (51.97%), Query Frame = 1
Query: 4276 GPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQG--------MVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            GP+GD G+ G  G+ G  G  GS+G+ G  G                  E  +   G +G PG  G  G  GD   P  +GP G++G +GL G  G++           +GD G  G QG  G  G  G QGP G  G  G+      ++   +   +H Q+ E+ P CPIG ++++ GYS +   G  + +  +LG   SCL  F+ MPF  C+ +  C    R D+SYWL++ AP+    +    + +YISRC  CE+P++  A HSQ  +++   CP  W  LW GYSF+MHT  G  GGGQSL SPGSCL  FR +P +EC+     C+++ +  S++L  V+   +   G+   +E  K+  ++  +SRC+VCMK 
Sbjct: 1279 GPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTA-------------EAVQVPPGPLGLPGIDGIPGLTGD---PGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQ------SMRVGYTLVKHSQS-EQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQ--DITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQF--GELPVSETLKAGQLHTRVSRCQVCMKS 1632          

HSP 2 Score: 171.4 bits (433), Expect = 5.965e-42
Identity = 307/866 (35.45%), Postives = 380/866 (43.88%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDT------GNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDK--GENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDI----GNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEG---------------SRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKG--FKGIKGNTGKPGPVGDKTIKGI-------------KGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGI------------KGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGAT----GPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKG 3387
            GL G  G  G KG T      G+ G  G PG  G PG KG++G+ G+ G  G                  + GSKGE G  G        +  P+ P G  G +G +G+PG+ G  G+ G  GM G  G         LPG +G  GD    ENG  G  G +G  G                  KG  GDSG  GL+G  G  G  G KGERG  G P  G VG  G  G  G  G+ GK+G  G  G  G+ G   K            KG +G+KG  G   + G PG++G    PGN G +G +GS G  G  GLP   G KG KG      FP I G  G        G +G+KG PG  GK G SG  G  G KGD GNPG  G+                ++G++G QG  G     G +G+KG++G      +          +G +G+PG   P G +G++G  G KGS GI+G  G PG+ G++G        G PG+PG  G  GL G+ G      G+ G KG  G+ G  G KG  G IGN  IG  GN+G               + G  G  GMRG PG+ G  G+QG  G  G  G  GPKG    G+ G  G PGP G+K   GI             KGD G PG+QG  G  G  G        G+ G+ G  G  GERG                QG  GD G  G+ G  G  G++G  G +G  G +G+ G  G  G PG      A     GP G+ GI G  G+ G  G  GP G QG KGL      G  G  G  G  G  G LG+PG+ G +G  G      +G  G  G FG  G  G
Sbjct:  639 GLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPG------------------SSGSKGEPGSPG-------LVHLPELP-GFPGPRGEKGLPGFPGLPGKDGLPGMIGSPG---------LPGSKGATGDIFGAENGAPGEQGLQGLTGH-----------------KGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTP--GQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGK------------KGTRGKKGPPGSIVKKGLPGLKG---LPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPG------IPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLW-----LKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPG---PPGFMGIRGLPGLKGSSGITGFPGMPGESGSQG------IRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGN--IGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLP-----GIPGKDGPSGLPGPPGALGDPGLPGLQGPPGF-----EGAPGQQGPFGMPGMPG 1403          

HSP 3 Score: 166.392 bits (420), Expect = 2.273e-40
Identity = 399/1272 (31.37%), Postives = 517/1272 (40.64%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNM------GELGARGLVGDSGSNGQD---GLPGDRGESXXXXXXXXXXXXXXXXL---FGDRGDVGLPGCNGT------------NGEKGNDGLA--------GKMGLSGDKGVKGDKGYIGEPGDF---------------------------FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPG-------DQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGD-----------------TGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDK--GENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSG------------------------DEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKG------LSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDR--------GRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGV---------------KGDEGNPXXXXXXXXXXXXXXXXXDAKP---------VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFV--KPLNATEMGDRGDTGEPGL---------QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGES---GEQGDIGNFGP------------------KGFKGIKGNTGKPGPVGDK-------------------TIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMI----------GRTGENGEKGDQGLNGPKGNVGVIGDRGETGK---PGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE---------------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI 3330
            K C       +C+C    G +G  G IG  GP GP+G+TG+       GE G  GL+G  G  G     G+PG  G +G  G PG  G  G  GL    G +G VG PG +G              G KG+  LA        G  GL G  G+ G +G  G PG                             FQ +KG KG                     M   +G KG +G+ G +G  G+SG PG        +     +KG  G PGP G  G++        + PP Q+G                 G  G PGL+G  G  GQKGD                 +GN G+ G PG  G  G +G +G+RG  GV G                                   +  + G  GP G  G KG+QG PG    +G  G  G  G  GP G  G      +   + +K  G  G  G  GP+G+ G                 +KGIKGDSG                          GL G KG  G +G  G +GP+G P   G +GP GPKG+KG      + G+ G  G  G +G +G++G   K      +            G  G  G  G PG+ G++           G  G  G  G  GD G  GLPG +G+ G+KG +     P   G  G  G  G  GPKG +G PG  G+PG SG  G+ G                +G++G PG  GL G+ G  G  G    P            E G  GE+G++ + G KG  GDSG   +  V  KP      G+RG  G PG           GP G  G  G  GA G  GISG  G+ G  G KG  G+    G+PG+ G  G  GL G KG  G+ G+ G     G  G KG  G +G PGI G+ G  G+R      G++G+PG TG +G  G +   GE+GD GN GP                  KG +G  G+ G PGP GDK                    IKG+ G  G PG  G++G  G  G  G     G  GE G  G +G  G+ G  G+ G KG++G            G+ GE+G KG +G +G  GN+G  G++GE GK    G +G  GA G  G+ G++GE G+ G  G+ G  G  G  GL                  G +GEKG  G+   +GA    G+PG+RG KGD G  G+
Sbjct:   28 KPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKG--DVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGV------QGPPGQQGKK---------------GTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGL--------------------------------PALSGVPGALGPQGFPGLKGDQGNPGRT-TIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLG-----------------LKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGK----DGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTR------GLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGI--GIGAP---GKPGLRGQKGDRGFPGL 1211          

HSP 4 Score: 162.54 bits (410), Expect = 3.029e-39
Identity = 351/972 (36.11%), Postives = 441/972 (45.37%), Query Frame = 1
Query: 1156 NRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGN------QGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVK------GERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-------IGIKGNEGSRGEEGETGMRGLPGITGDIGN-------------------QGESGEQGDIGNFGPKGFKGIKGN---TGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG----RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQG--MMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNGPTXXXXXXXXXXXXXXXX----XXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG 3915
            +RGS G  G AG  G     + GP GP G KG KG       QG+PG +G+ G +GF+G+ G  G  G  G   L       G +G  GE G  G  G+ G  G  G  G+        +G+ GD G +GL G++G+ GSKG+       G  GPSG P T   G  GPKG +GL G  G+ G  G KG                          G  G   L    G PG RG++G PG  G  G++G  G IG  GLPG KG  G       + F +  G  G+ G  G  G KG  G  GL G  G+ G  G +G KG+ G+PG  G  G+ G  G+ G     ++G+ GL G  G   I G  G+KG  G               G     G PGL+G  G  G+ G +G+ GS G++G     G  G KG  G  GF G+PG+PG  G  GL G  G  G  G  G  G  G  G +G+ G +G P        + +KG++GS+G  G  G    PG  GD G                    +G SG+ G  G  G +G  G+KG+   TG PG  G+   +GI+G  G PG  GL G  G++G   E SG    +G+ GE G  G KG  G+ G  G  G+KGE G +G +G      D GL G  G  GV G RGE G PG  G  GA GP G  G+ G +G  + GV G  G  G +GEKG    G     G  G  G  G KG+ G PG++G  G  G  GI     S   G+ G  G+ G++GE+G  GP GP GP G    +G+ GD G                    G  G  GPKG  GI G  GL G + LKG SG  GD G T             G      +PG  G+ G  G  G +G KG  G  G  GP G  GP G  G  G  G +G  G +G  G  GP G  G+ G
Sbjct:  516 DRGSGGAQGPAGAPG-----LVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGL-PGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGT--PGFPGPKGSRGLPGTPGQPGSSGSKG------------------------EPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATG-------DIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYG--IKGKSGLPGAPGFPGISGHPGKKGTRGK----------KGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNG---FPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSG------DVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIG----IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISL--PSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPG------------------FPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG 1403          

HSP 5 Score: 150.984 bits (380), Expect = 1.027e-35
Identity = 375/1118 (33.54%), Postives = 466/1118 (41.68%), Query Frame = 1
Query: 1225 PQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT----------VKG--IKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTA-CKLCXXXXXXXXXXXXNQGEKGKDGLAGRD-GNPGIRGDRGRPGNDGAIGREGSYGDIG-DRGLPGD-----------------KGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLN---GKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKP--------------------IDGEKGEKGDSGN--------CTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKG------DQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDI--------GDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIG------NFGPKGFKGIKGNTG---------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIG---------RTGENGEKGDQGLNGPKG---------NVGVIGDRGETGK------PGP-------------------------------IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMG----VIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITL-----------KGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGD---FGEDGDKGNVGPKGNKGLSG-----PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG 4047
            P+G  G KG+ G +G PG  G  G  G                  LPG RG +G +G  G  G  G +G  GF G  G +G  G +G            + G  I G+ GD G+ G  G+ G +G++G RGPSG P    L G  G  G +G  GL G  G  G    +  +G A                    E   + L  ++ G PG+RG++G  GN G  G +G  G    D G+P                    G+KGA+GD          G  G  GP G  GPKG KG P L+   G PG  GD G  G +G  G PG  G+ G  G  G  G   +   GE+GL G  G K                     + G+KG+ G  G          T+  + P      G  G  G PG  GP G  G+ G        G+KG  G  G    P  PG  G +G KG  G PG+PGK G  G+ G  G  G++G  GDI        G++G  G  G  G +G+ G+ G+KG  G  G  G  G RG PG  G +G  G  G  G  G        G  GF GI G+ G          PG +  K + G+KG  G PG+ GLKG  G  G  G  +  G  GE+G VG  G  GI G  GI G +G  G+ G         R G  GEKGD+G  GP G         N+ + GD+G  G       PGP                                GP G  G +G+ G+KG  G+ G  G  G  G QG +G        G  G KG+ G    + G+ G KG+ GE G +G+KG +G  G IG  G  G +G+ G  G  G+ G  G  G  G +G  GL G  G +G IG +GS G IG  G              GP GL G  GEKG  GI +           KG+ G  G  GP G  G PG        G PG  G  G  GE+G  G  G  GP G    QGD G  G  G  G  GPKGD    G  G  G +G KG+ GL G     P  +      G +G PG  GI G  G  G  G +G  G KG PG
Sbjct:  253 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPG-LPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPG----RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIP---GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGV-------PGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPG 1355          

HSP 6 Score: 137.887 bits (346), Expect = 1.141e-31
Identity = 322/913 (35.27%), Postives = 405/913 (44.36%), Query Frame = 1
Query: 1525 GLQGEKGISGSKGVKGERGPSGRPTTGLV----GPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGA--KGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGL---QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPG--------------PVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGD------QGLNGPKGNVGVIGDRGETGK---PGPIGPDGATGPKGI--------NGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPK---GNVGPQGDQGPKGNTGSKGETGPKGDFGE-------------------DGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIE 4059
            G QGEKG+ G   V         P+TG +     PKG KG KG  G  G  G  GP G  GL  T  K  +KG+ G  G+ G +G  G +G+ G  G  G +G  G PG +G  G EG  GDIG  G      I GA   G+  +   P + G KGD G  G  GP G+ G P L+G PG  G  G  G+KGD+GNPG                        R   G  G+   DG  G  G  G  +  F      TE     ++G PGL   QGP G +G+KG +G  G     G     G PG  G  G  G  G+PG+ G RG  G  G +G  G  G+ G +G  G  G KG+   +      I+G  G RG+ G  G RG+ G  G  G  G  G  G  G+ G +GF G KG  G PG                G    +G+ GD G+ G+ G +G  G  G    C   G +G  G  G  G  G KG +G+ G  G+ G  G  GE G  G        G  GP+G  G+ G  G  GK   PG IG  G  G KG         NG  GEQG+ G+ G+ G  GD G  GL  KG  G+ G +G  G  G+ G  G+ G  G+ G +G  GI G+ G  G+ G  G  G  G +G +G  GP G     GL G+KG  G+ G +G +G  G  G  G     G  G+ G  G  G  G  GL GI     LKG  G  G  GP+G                  R G  G+ G++GN G  G   P+    N+  +GD+G +G+ GS G  GP+GD GE                    G  G  GP G  G+ G P  +G SG  G  G PG+ G +G +G  GLPG  G  G KG  G  +E
Sbjct:  221 GFQGEKGVKGD--VGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEK-GEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPG------------------------RTTIGAAGLPGRDGLPGPPGPPGPPSPEF-----ETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEP-ILST----IQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGG-QGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGL--KGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSG------------------RAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE 1075          

HSP 7 Score: 136.732 bits (343), Expect = 2.261e-31
Identity = 338/1016 (33.27%), Postives = 428/1016 (42.13%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPG-----------------CNGTNGEKGNDGLAGK--------------MGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGE-KGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNV--GNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----------TTGLVGPKGP------KGEKGLSGLDGKNGKVGPKGMKG-LLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGK---PGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVK-------PLNATEMGDRGDTGEPGL-QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGR---------SGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFG-------PKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGV 3054
            G+ G +GD G  G  GP G  G  G +G  G +G  G+   +   G+PGDRG+SG                 G RG +G PG                   G  GEKG  GL G+               GL G +G+ GDKG  G PG   Q   G KG        G  G  GF G  G  G +G +G+ G  G  G  G  GEPG    G+    E  GFPGP G+ G       L GK                           G PG+ G+ G  G KG TG++     G PG +G  G  G KG  G  G+ G KGV G+ G+ G +G+ G+ G+ G+VG+ G  G          GP+G KG  G  G PG+ G  G  G KG  G  GP G I    LPG +G  G+ G  G  G+ G  G  G    +G +G+ G  G     GI G  G  G +G KGI GS G  G  G +G P            G+  P+ P      KG+KG  G  G NG  GP+G KG                   IKG  G+ G  G  G  G PG++G  G  G  G  G  GS G  G  GLPG  G+ G KGD+ +     I G  G  G  G+ G KG KG  GL G    PG  G+ GK+GV GD G PG                 A    G  G++GE G+    G +G  G  G+  +   K       P  A   G +G+ G PG+  G  GK G++G +G +G  G+ G                    G+PG PG    S + G+ GD G  G+ G+ G  G          S  +GDTG  G PGI      G +G +G+ G+ G  G+ G++G +G SG QGD G          P G  G+ G  G PG  GD   +G  G  G  G+ G+ G  G SG  G     G+ G  G  GP G  G  G+QG  G  G  G   R G    K  Q    P   +G+
Sbjct:  509 GLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQ---------------GFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQ--QGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGS--PGLVHLPELPGFPGPRGEKGLP-GFPGLPGKD--------------------------GLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGS--------SGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTV--EISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPG-----------------APGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPA------------------GLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGI-----PGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGM 1428          

HSP 8 Score: 58.5362 bits (140), Expect = 1.686e-7
Identity = 114/398 (28.64%), Postives = 145/398 (36.43%), Query Frame = 1
Query: 2569 DTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPK---------GFKGI------------------------KGNTGKPGP-----------------------VGDKTIKGIKGDSGEPGVQGLK--------------------------------------GFTGESGDKGEC-----------SGRGEF--------GERGDVGPKGERGIKGEQGI-----------------------NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGP---IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKG 3342
            + GA G PG IGI+G  G +G  G TG+ GL         +GE G  G +G +GPK         GF GI                        +G  G PGP                       +   + KG+KGD G PG+ G+                                       GF GE G KG+            +G  EF        G +G+ GPKG  GI G  G                         G  G  G+ G  G+ G+KG  G  G  G  G+ G +G+ G PGP   I  DGA        I G  G  GV G  G KGD+G +GL  +G  G  G   + G  GA G  G PG++G +G+ G T IG  G
Sbjct:   44 EKGARGRPGPIGIQGPTGPQGFTGSTGLSGL---------KGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAV-------ISGNPGDPGVPGLPGLKGDEGIQGL--RGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAG 423          

HSP 9 Score: 56.225 bits (134), Expect = 8.211e-7
Identity = 118/314 (37.58%), Postives = 143/314 (45.54%), Query Frame = 1
Query: 3724 GDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKG--------------EQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQG 4611
            G  G  G  G  G  GPKG+ G  G  G  G++GSKGE G  G        G  GP+G KGL G P   G+ G  G +G+PG  G KG              EQGL+GL G  G +GD G PG  G+ G  G +G KG  G  G  G+ G+ G  G SG  G KG  G  G  G  G +G+ G KG +G  G  G   + G  G  GL G  G+ G KG  GS G+ G                         G +GE G  G +G  G  G  G P  RG KG+ G  G  G SG+    G  GD+G+ GP G
Sbjct:  660 GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPA--------------------LSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVG 953          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Human
Match: COL4A5 (collagen type IV alpha 5 chain [Source:HGNC Symbol;Acc:HGNC:2207])

HSP 1 Score: 215.698 bits (548), Expect = 1.728e-55
Identity = 96/237 (40.51%), Postives = 143/237 (60.34%), Query Frame = 1
Query: 4696 ALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEV--QNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            ++   FL TRH Q  +  P CP G+ +++EG+S +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+   M  +  Q+++ +ISRC  CE+PA   A HSQT  +    CP+ W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  VD    F  P+ + +KA D +++     +SRC+VCMK+
Sbjct: 1457 SVAHGFLITRHSQTTDA-PQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPH--CPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTR-----ISRCQVCMKR 1684          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Human
Match: COL4A5 (collagen type IV alpha 5 chain [Source:HGNC Symbol;Acc:HGNC:2207])

HSP 1 Score: 215.698 bits (548), Expect = 1.940e-55
Identity = 96/237 (40.51%), Postives = 143/237 (60.34%), Query Frame = 1
Query: 4696 ALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEV--QNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            ++   FL TRH Q  +  P CP G+ +++EG+S +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+   M  +  Q+++ +ISRC  CE+PA   A HSQT  +    CP+ W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  VD    F  P+ + +KA D +++     +SRC+VCMK+
Sbjct: 1463 SVAHGFLITRHSQTTDA-PQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPH--CPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTR-----ISRCQVCMKR 1690          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 222.246 bits (565), Expect = 8.152e-58
Identity = 96/230 (41.74%), Postives = 135/230 (58.70%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV--DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            F+  +H Q   E P CP G  K+++GYS +   GN + +  +LG   SCL  F+ MPF  C  +  C    R D+SYWL++   +    +  + +E YISRC  CE+PA   A HSQT  + +  CP  W+ LW GYSF MHT  G  GGGQSLSSPGSCL  FR +P +ECN     C+++ +  S++L  +  DSEF+VP+ + +     KS N+   +SRC+VC+K 
Sbjct: 1533 FVLVKHSQT-TEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPN--CPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTL-----KSGNLRTRVSRCQVCVKS 1754          

HSP 2 Score: 164.851 bits (416), Expect = 2.388e-40
Identity = 404/1162 (34.77%), Postives = 490/1162 (42.17%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGV--KGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGV------------------KGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXX-----------XXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG------------DIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-----------------------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGP---------IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL------------------------------------ETKGQRGEKGNMGVIGNVGAKGELGEPGM-RGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+PGPKG+ G  G PG    +   G  G+ G  GL G  G  G++GLPG RG  GD                   G  G PG  G  G  G DG  G  GL G  G KGD+G  G         KGEKG  G  G  G              GD+G  G+ G VGD G  G+ G  G         G+ GFPG  G  G   +L +  G  PP   G  GE G  GQ G  GL G +G  G  GA G  G+KGD G  G  G PG  G PG  G KG  G  G  G  G  G KG  G  G  G  G +G  GE     +      G  G  G  G KG  G PG  G +G+ GF G               LPG +GD G  G  G  G  G  GD GF G  G  G        + G KGD G+ GL G  G  G  GV   G+ G  G P        G KG+ GL GL G  G  G +G  G  G                      KG DGL G  G PG  G++G  G  G  GREGS G  G  GLPG   + G KG+      P + G KGD G  G+ G  G+ G+PG    PG+ G+ G  GV                  KG+ G PGM G  G  G  G  G+  +   G  G+ G KG +  +G  GEKG++G    +  K       GD G  G+PGL+GP G  G+ G  G KG  G+ G                   G +G  G+ G DG+PG PG +G+SG  G+ G  G  G+ G  G KG  G  G  G  G PG+ G  G  G RG++G+ G+ G+PG  G  G  G+ GE G            + G  G  GF G+KG+ G PG  G   I G+KGDSG PG  G +G  G SG+KG                           +G+ G  G  G KGE G+ G  G  G KGESGM G  G  G+ G  G+ G +G  G+ G  G  G+PG           G  G  G  GI G+KGE G+ G  G  G  G  G  G+                                    +   + GEKG  G+ G  G +GE G PG+      D      GQ+G  G  G  G  G+KGM
Sbjct:  441 GLPGPKGEPGYRGTPG----QSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSL----------------NGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG--GTCSACAPGTKGEKGLPGYSGQPGP------------QGDRGLPGMPGPVGDAGDDGLPGPAGRP-GSPGPPGQDGFPGLPGQKGEPTQLTLRPG--PPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPG---------------LPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPG--------IPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFP--------GLKGDAGLPGLPGTPGLEGQRGFPGAPGL---------------------KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPG---VPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGR--DGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQK-------GDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGM 1497          

HSP 3 Score: 138.658 bits (348), Expect = 2.663e-32
Identity = 358/1029 (34.79%), Postives = 454/1029 (44.12%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGL---------------------AGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXX----------------XXXXXXXKTVKGIKGDSGDEGLQG---------EKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPS------IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNP----XXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI--NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM 3153
            G PGP+GD G  G PGP+G  G  G  G  G  G  G  G +G  GLPG +GE                 L    G  G PG  G NG  G  G+                      G  GL G  G  G  G  G PG+  +A  G+ G  G  G+ G+ G  G  G  G+ G  G+      V +  P G  G PG        KGE G+PG  G+ G      +      P  +GDSG  G  G  G  G+ G  G  G+ G  G  G KGD GN G  G  G KG+PG  G  G  GS G  G KG  G  G+ G  G +G RG  G  G  GG G  +  + G  G  G+KGD G  G+PG +G+ G  G  G+PG  G  G+ G   LPG  G  GD G  G+SGA G  G  G+ G  G+                     +  K   G+ G  G  G++G           G+SG  G+KG+RG +G P   G  GP    G+KG +GL G+ G  GP+G  GL G                    G KG+ GL G  G PG  G++G PG  G  GR+G+ G  G  GLPG  G+KG  G   ++  P       + G+KGD G   + G  G+ G+PGL+G+PG+ G  G  G  G  G P           +             + GE+G  G  G   + G  G  G  G   I  +K       GD G  G+PG +G  G  G KG  G  G  G  G+                  DG PG+PG++G+SGL G  G     G+KG+ G  G  GAKGD GA G PG   +G +G  G  G  G  G+PG+ G++G  G  G+ G        G  G+KG  G PG        G KG++G PG  G+ G+ GE GD G     G  G  G  GP G  G  G Q +   G+KG  G+ G  G  GEKG  GL+GP GN G  G  G+ G  G  G  G +G KG+ G+ G  G+
Sbjct:  553 GQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ--------------LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV-NPAPPGQPGLPGLP----GTKGEGGYPGRPGEVGQPGFPGL------PGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDG--LPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP------------------GFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLG---QSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLK-------GDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-DGFPGLPGQKGESGLSGLPG---APGLKGESGMPGFPGAKGDLGANGIPGK--RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGF------PGIPGLKGEGGLPG------FPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGL 1506          

HSP 4 Score: 136.732 bits (343), Expect = 1.081e-31
Identity = 319/910 (35.05%), Postives = 389/910 (42.75%), Query Frame = 1
Query: 1561 GVKGERGPSGRPTTGLVGPKGPKGEKG-----LSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPG--IRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMG--------DRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGR--SGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGP---VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVG---------------AKGELGEPGMRGSKG------------DNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKG------------EQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGR 4092
            G  G  GPSG P  GL GPKG  G +G     + GL GK+GK G  G  G                         KG++GL G  G PG  + G  G PG  GA G  G  G  G  GLPG  G KG +G +     P  KGEKG  G  G+ GP+G +G PG+   PG  GD G  G+ G  G PG  G  G+ G  G  G   +P Q    L    G     G KGE G  G   ++ +   +             ++GD G PGL G  G+ G+ G  G KG  G                       G PG PG +G  GL G  G  G QGM G+   + +      G  G  G PG  G  G  G  GE G+ G  GLPG+ GD G  G  G  G  G  G KGF G+ G  G PGP   VG+  + G+ G  GEPGV G+ G  G  G  G     G  G  G  G +G+RG  G  G+ G  G  G+ G+ G  GEKGD GL G      V G  G  G PG  G  G  G KG +G+ G  G+ G+KG+ G  G  G  GL    G  G KGN G+ G  G                KGE G PGM G+ G             +G +G+ G KG+ G NG  G K                                 GE G   + G+ G  G  G+ G  G  GP GL G+ G KG +G+   G+ G  G+ G     G+PG  G +G  G PG+ G  G  G KG  G  G+ G  G  G  G  G KG+ G  G+ G  G  G DG  G  G +G+KG  G    G  G+RG  G PG+ G  G            E+G  G PG  G  G  G PG     GI G  GD G  G+
Sbjct:  429 GAPGVSGPSGIP--GLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPG------------------------RKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGM---PGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ----LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQ-------------------PGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG------VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEK---------------------------------GEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKG---LPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG--LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQ 1241          

HSP 5 Score: 103.605 bits (257), Expect = 1.136e-21
Identity = 311/926 (33.59%), Postives = 386/926 (41.68%), Query Frame = 1
Query:  325 GELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGC---------------NGTNGEKG-----NDGLAGKMGLSGDKGVKGDKGYIGEPGDF----FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGI---RGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTG---NVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKG------------ENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG------RPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKG------------DNGPDGKEGPKGIKGSPG------LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERG------LQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQG------AKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI---------PGKRGQSGLDGEKGDIGNQGMK-----------------------------------GDIGDKGRSGAKGDTGAIGNPGI-------------------GIKGNEGSRGEEGETGMRGLPGITG 2673
            G+ G  GL G  G +G  GLPG++GE+G                +G  G  G PG                 G  GE       N    G+ GL G  G KG+ GY G PG+     F    G KG +G  G  G  G  G  G +G  G  G  GI   +GDVG+ G  G++G+ G+   G+  Q G  GFPG  GDAG             P   G  G +G+ G  G  GLKG  G PGL G  G  G+KGD G     G  G+PG  GQ G  G  G++G DG+ G  GV                G KG++G  G SG       G  G  G  G KGN GIPG        GFKG  G  G  G  G    PG  G  G  G             +G SG  G +GD GFNG  G++G+ G   +   KG  G  G  GL+G +G SG  GV G +G +G P  G  G  G KG  G+ G  G+ G  G  G  GL G              G+KG  G  G+DGL GRDG PG+ G +G      +PG  GA G +G  G  G RG  G  G+ G  GD   + +P  KGE G            + G  G  G  G+KGSPG      L G PG+ GD G  G  G EG PG+ G KG  G  G  G   + + G  G      LQG+ G   + G+KGE G SG      +K       G+ G  G PG +G +G  G+ G +G        G DG  G  G  G+ G  G+ G  GF G+PG+         PG +G++G  G  G  G  G K                                   G+ G  G  GA G  G  G PG+                   G  G  G  GE+G  G+ G PG+ G
Sbjct:  656 GDAGLPGLSGKPGQDGLPGLPGNKGEAG----------------YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGL------------PGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGV---------------TGLKGDLGAPGQSG-----APGLPGAPGYPGMKGNAGIPGV------PGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFP------------GMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLK-------GESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDG 1508          

HSP 6 Score: 74.7146 bits (182), Expect = 6.726e-13
Identity = 232/655 (35.42%), Postives = 276/655 (42.14%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD-------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGN---RGTPGPKGQPGSKGAKG---------IRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAG-----GSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSC--------------------LPGKRGD---------IGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTA-----------------CKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDR---GLPGDKGIKGAKGDSREETFPSIKGE 1968
            G+PG KG+ G  G PG  G KG  G  G+ GA GL G  G  G  G  G  G  G  G  G+ G PG  G  G+ G  G+PG  G  G  G  GL G+ GLSG  G+KGD+G+ G PG+     KGE G A                    DG +GD G+ G  G +GP G SG PG              QP    Q GEKG PG  G AG             P   G  G  G  G KG++G  G  G PG DG  G  GQKGD G  G     G PG  GQPG  G +G         I G  G+ G+ G +G+ G  G+ G  G  G KG  G  G     GS    G    P  P G KGD G  G PG +G  G  G KGM G  G  G  G S                     LPG++G+          G KGE+G  G  G +GD G NG              + G +G+ G  G+ G  G  G  G+KGE G +G P   G  G  G KGE GL G  G  G+ G  G  G+ G A                                 N  E G+ GL G  G PG+RG++G PG DG  G +G  G  G R   G PG  G+ G KG      FP + G+
Sbjct:  905 GVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE-----KGEAGPAA------------------RDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQP---GQPGEKGLPGIPGKAGRQGA---------PGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIP-GLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--------------IPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQ 1509          

HSP 7 Score: 57.7658 bits (138), Expect = 1.132e-7
Identity = 72/168 (42.86%), Postives = 89/168 (52.98%), Query Frame = 1
Query: 2584 GNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPG 3087
            G P IG  G  G +G+ G  GM GLPG +G  G  GE G++GD GN GP+G  G  G+ G PG +G    KG  GD G  G  G  G    +  KG        G +GD+G KGE+G  GE G  G  G  G+ G+ G  G KG++GL+GP G  G  G  G  G PG
Sbjct:  156 GEPAIGYAGAPGEKGDGGMPGMPGLPGPSGRDGYPGEKGDRGDTGNAGPRGPPGEAGSPGNPG-IGSIGPKGDPGDIGAMGPAGPPGPIASTMSKGTI-----IGPKGDLGEKGEKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPG 317          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 222.246 bits (565), Expect = 8.152e-58
Identity = 96/230 (41.74%), Postives = 135/230 (58.70%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV--DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            F+  +H Q   E P CP G  K+++GYS +   GN + +  +LG   SCL  F+ MPF  C  +  C    R D+SYWL++   +    +  + +E YISRC  CE+PA   A HSQT  + +  CP  W+ LW GYSF MHT  G  GGGQSLSSPGSCL  FR +P +ECN     C+++ +  S++L  +  DSEF+VP+ + +     KS N+   +SRC+VC+K 
Sbjct: 1533 FVLVKHSQT-TEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPN--CPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTL-----KSGNLRTRVSRCQVCVKS 1754          

HSP 2 Score: 164.851 bits (416), Expect = 2.388e-40
Identity = 404/1162 (34.77%), Postives = 490/1162 (42.17%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGV--KGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGV------------------KGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXX-----------XXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG------------DIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-----------------------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGP---------IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL------------------------------------ETKGQRGEKGNMGVIGNVGAKGELGEPGM-RGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+PGPKG+ G  G PG    +   G  G+ G  GL G  G  G++GLPG RG  GD                   G  G PG  G  G  G DG  G  GL G  G KGD+G  G         KGEKG  G  G  G              GD+G  G+ G VGD G  G+ G  G         G+ GFPG  G  G   +L +  G  PP   G  GE G  GQ G  GL G +G  G  GA G  G+KGD G  G  G PG  G PG  G KG  G  G  G  G  G KG  G  G  G  G +G  GE     +      G  G  G  G KG  G PG  G +G+ GF G               LPG +GD G  G  G  G  G  GD GF G  G  G        + G KGD G+ GL G  G  G  GV   G+ G  G P        G KG+ GL GL G  G  G +G  G  G                      KG DGL G  G PG  G++G  G  G  GREGS G  G  GLPG   + G KG+      P + G KGD G  G+ G  G+ G+PG    PG+ G+ G  GV                  KG+ G PGM G  G  G  G  G+  +   G  G+ G KG +  +G  GEKG++G    +  K       GD G  G+PGL+GP G  G+ G  G KG  G+ G                   G +G  G+ G DG+PG PG +G+SG  G+ G  G  G+ G  G KG  G  G  G  G PG+ G  G  G RG++G+ G+ G+PG  G  G  G+ GE G            + G  G  GF G+KG+ G PG  G   I G+KGDSG PG  G +G  G SG+KG                           +G+ G  G  G KGE G+ G  G  G KGESGM G  G  G+ G  G+ G +G  G+ G  G  G+PG           G  G  G  GI G+KGE G+ G  G  G  G  G  G+                                    +   + GEKG  G+ G  G +GE G PG+      D      GQ+G  G  G  G  G+KGM
Sbjct:  441 GLPGPKGEPGYRGTPG----QSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSL----------------NGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG--GTCSACAPGTKGEKGLPGYSGQPGP------------QGDRGLPGMPGPVGDAGDDGLPGPAGRP-GSPGPPGQDGFPGLPGQKGEPTQLTLRPG--PPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPG---------------LPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPG--------IPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFP--------GLKGDAGLPGLPGTPGLEGQRGFPGAPGL---------------------KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPG---VPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGR--DGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQK-------GDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGM 1497          

HSP 3 Score: 138.658 bits (348), Expect = 2.663e-32
Identity = 358/1029 (34.79%), Postives = 454/1029 (44.12%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGL---------------------AGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXX----------------XXXXXXXKTVKGIKGDSGDEGLQG---------EKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPS------IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNP----XXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI--NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM 3153
            G PGP+GD G  G PGP+G  G  G  G  G  G  G  G +G  GLPG +GE                 L    G  G PG  G NG  G  G+                      G  GL G  G  G  G  G PG+  +A  G+ G  G  G+ G+ G  G  G  G+ G  G+      V +  P G  G PG        KGE G+PG  G+ G      +      P  +GDSG  G  G  G  G+ G  G  G+ G  G  G KGD GN G  G  G KG+PG  G  G  GS G  G KG  G  G+ G  G +G RG  G  G  GG G  +  + G  G  G+KGD G  G+PG +G+ G  G  G+PG  G  G+ G   LPG  G  GD G  G+SGA G  G  G+ G  G+                     +  K   G+ G  G  G++G           G+SG  G+KG+RG +G P   G  GP    G+KG +GL G+ G  GP+G  GL G                    G KG+ GL G  G PG  G++G PG  G  GR+G+ G  G  GLPG  G+KG  G   ++  P       + G+KGD G   + G  G+ G+PGL+G+PG+ G  G  G  G  G P           +             + GE+G  G  G   + G  G  G  G   I  +K       GD G  G+PG +G  G  G KG  G  G  G  G+                  DG PG+PG++G+SGL G  G     G+KG+ G  G  GAKGD GA G PG   +G +G  G  G  G  G+PG+ G++G  G  G+ G        G  G+KG  G PG        G KG++G PG  G+ G+ GE GD G     G  G  G  GP G  G  G Q +   G+KG  G+ G  G  GEKG  GL+GP GN G  G  G+ G  G  G  G +G KG+ G+ G  G+
Sbjct:  553 GQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ--------------LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV-NPAPPGQPGLPGLP----GTKGEGGYPGRPGEVGQPGFPGL------PGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDG--LPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP------------------GFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLG---QSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLK-------GDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-DGFPGLPGQKGESGLSGLPG---APGLKGESGMPGFPGAKGDLGANGIPGK--RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGF------PGIPGLKGEGGLPG------FPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGL 1506          

HSP 4 Score: 136.732 bits (343), Expect = 1.081e-31
Identity = 319/910 (35.05%), Postives = 389/910 (42.75%), Query Frame = 1
Query: 1561 GVKGERGPSGRPTTGLVGPKGPKGEKG-----LSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPG--IRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMG--------DRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGR--SGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGP---VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVG---------------AKGELGEPGMRGSKG------------DNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKG------------EQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGR 4092
            G  G  GPSG P  GL GPKG  G +G     + GL GK+GK G  G  G                         KG++GL G  G PG  + G  G PG  GA G  G  G  G  GLPG  G KG +G +     P  KGEKG  G  G+ GP+G +G PG+   PG  GD G  G+ G  G PG  G  G+ G  G  G   +P Q    L    G     G KGE G  G   ++ +   +             ++GD G PGL G  G+ G+ G  G KG  G                       G PG PG +G  GL G  G  G QGM G+   + +      G  G  G PG  G  G  G  GE G+ G  GLPG+ GD G  G  G  G  G  G KGF G+ G  G PGP   VG+  + G+ G  GEPGV G+ G  G  G  G     G  G  G  G +G+RG  G  G+ G  G  G+ G+ G  GEKGD GL G      V G  G  G PG  G  G  G KG +G+ G  G+ G+KG+ G  G  G  GL    G  G KGN G+ G  G                KGE G PGM G+ G             +G +G+ G KG+ G NG  G K                                 GE G   + G+ G  G  G+ G  G  GP GL G+ G KG +G+   G+ G  G+ G     G+PG  G +G  G PG+ G  G  G KG  G  G+ G  G  G  G  G KG+ G  G+ G  G  G DG  G  G +G+KG  G    G  G+RG  G PG+ G  G            E+G  G PG  G  G  G PG     GI G  GD G  G+
Sbjct:  429 GAPGVSGPSGIP--GLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPG------------------------RKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGM---PGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ----LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQ-------------------PGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG------VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEK---------------------------------GEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKG---LPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG--LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQ 1241          

HSP 5 Score: 103.605 bits (257), Expect = 1.136e-21
Identity = 311/926 (33.59%), Postives = 386/926 (41.68%), Query Frame = 1
Query:  325 GELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGC---------------NGTNGEKG-----NDGLAGKMGLSGDKGVKGDKGYIGEPGDF----FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGI---RGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTG---NVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKG------------ENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG------RPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKG------------DNGPDGKEGPKGIKGSPG------LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERG------LQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQG------AKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI---------PGKRGQSGLDGEKGDIGNQGMK-----------------------------------GDIGDKGRSGAKGDTGAIGNPGI-------------------GIKGNEGSRGEEGETGMRGLPGITG 2673
            G+ G  GL G  G +G  GLPG++GE+G                +G  G  G PG                 G  GE       N    G+ GL G  G KG+ GY G PG+     F    G KG +G  G  G  G  G  G +G  G  G  GI   +GDVG+ G  G++G+ G+   G+  Q G  GFPG  GDAG             P   G  G +G+ G  G  GLKG  G PGL G  G  G+KGD G     G  G+PG  GQ G  G  G++G DG+ G  GV                G KG++G  G SG       G  G  G  G KGN GIPG        GFKG  G  G  G  G    PG  G  G  G             +G SG  G +GD GFNG  G++G+ G   +   KG  G  G  GL+G +G SG  GV G +G +G P  G  G  G KG  G+ G  G+ G  G  G  GL G              G+KG  G  G+DGL GRDG PG+ G +G      +PG  GA G +G  G  G RG  G  G+ G  GD   + +P  KGE G            + G  G  G  G+KGSPG      L G PG+ GD G  G  G EG PG+ G KG  G  G  G   + + G  G      LQG+ G   + G+KGE G SG      +K       G+ G  G PG +G +G  G+ G +G        G DG  G  G  G+ G  G+ G  GF G+PG+         PG +G++G  G  G  G  G K                                   G+ G  G  GA G  G  G PG+                   G  G  G  GE+G  G+ G PG+ G
Sbjct:  656 GDAGLPGLSGKPGQDGLPGLPGNKGEAG----------------YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGL------------PGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGV---------------TGLKGDLGAPGQSG-----APGLPGAPGYPGMKGNAGIPGV------PGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFP------------GMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLK-------GESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDG 1508          

HSP 6 Score: 74.7146 bits (182), Expect = 6.726e-13
Identity = 232/655 (35.42%), Postives = 276/655 (42.14%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD-------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGN---RGTPGPKGQPGSKGAKG---------IRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAG-----GSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSC--------------------LPGKRGD---------IGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTA-----------------CKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDR---GLPGDKGIKGAKGDSREETFPSIKGE 1968
            G+PG KG+ G  G PG  G KG  G  G+ GA GL G  G  G  G  G  G  G  G  G+ G PG  G  G+ G  G+PG  G  G  G  GL G+ GLSG  G+KGD+G+ G PG+     KGE G A                    DG +GD G+ G  G +GP G SG PG              QP    Q GEKG PG  G AG             P   G  G  G  G KG++G  G  G PG DG  G  GQKGD G  G     G PG  GQPG  G +G         I G  G+ G+ G +G+ G  G+ G  G  G KG  G  G     GS    G    P  P G KGD G  G PG +G  G  G KGM G  G  G  G S                     LPG++G+          G KGE+G  G  G +GD G NG              + G +G+ G  G+ G  G  G  G+KGE G +G P   G  G  G KGE GL G  G  G+ G  G  G+ G A                                 N  E G+ GL G  G PG+RG++G PG DG  G +G  G  G R   G PG  G+ G KG      FP + G+
Sbjct:  905 GVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE-----KGEAGPAA------------------RDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQP---GQPGEKGLPGIPGKAGRQGA---------PGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIP-GLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--------------IPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQ 1509          

HSP 7 Score: 57.7658 bits (138), Expect = 1.132e-7
Identity = 72/168 (42.86%), Postives = 89/168 (52.98%), Query Frame = 1
Query: 2584 GNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPG 3087
            G P IG  G  G +G+ G  GM GLPG +G  G  GE G++GD GN GP+G  G  G+ G PG +G    KG  GD G  G  G  G    +  KG        G +GD+G KGE+G  GE G  G  G  G+ G+ G  G KG++GL+GP G  G  G  G  G PG
Sbjct:  156 GEPAIGYAGAPGEKGDGGMPGMPGLPGPSGRDGYPGEKGDRGDTGNAGPRGPPGEAGSPGNPG-IGSIGPKGDPGDIGAMGPAGPPGPIASTMSKGTI-----IGPKGDLGEKGEKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPG 317          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 221.861 bits (564), Expect = 8.718e-58
Identity = 96/230 (41.74%), Postives = 135/230 (58.70%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV--DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            F+  +H Q   E P CP G  K+++GYS +   GN + +  +LG   SCL  F+ MPF  C  +  C    R D+SYWL++   +    +  + +E YISRC  CE+PA   A HSQT  + +  CP  W+ LW GYSF MHT  G  GGGQSLSSPGSCL  FR +P +ECN     C+++ +  S++L  +  DSEF+VP+ + +     KS N+   +SRC+VC+K 
Sbjct: 1532 FVLVKHSQT-TEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPN--CPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTL-----KSGNLRTRVSRCQVCVKS 1753          

HSP 2 Score: 163.696 bits (413), Expect = 6.530e-40
Identity = 404/1162 (34.77%), Postives = 490/1162 (42.17%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGV--KGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGV------------------KGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXX-----------XXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG------------DIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-----------------------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGP---------IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL------------------------------------ETKGQRGEKGNMGVIGNVGAKGELGEPGM-RGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+PGPKG+ G  G PG    +   G  G+ G  GL G  G  G++GLPG RG  GD                   G  G PG  G  G  G DG  G  GL G  G KGD+G  G         KGEKG  G  G  G              GD+G  G+ G VGD G  G+ G  G         G+ GFPG  G  G   +L +  G  PP   G  GE G  GQ G  GL G +G  G  GA G  G+KGD G  G  G PG  G PG  G KG  G  G  G  G  G KG  G  G  G  G +G  GE     +      G  G  G  G KG  G PG  G +G+ GF G               LPG +GD G  G  G  G  G  GD GF G  G  G        + G KGD G+ GL G  G  G  GV   G+ G  G P        G KG+ GL GL G  G  G +G  G  G                      KG DGL G  G PG  G++G  G  G  GREGS G  G  GLPG   + G KG+      P + G KGD G  G+ G  G+ G+PG    PG+ G+ G  GV                  KG+ G PGM G  G  G  G  G+  +   G  G+ G KG +  +G  GEKG++G    +  K       GD G  G+PGL+GP G  G+ G  G KG  G+ G                   G +G  G+ G DG+PG PG +G+SG  G+ G  G  G+ G  G KG  G  G  G  G PG+ G  G  G RG++G+ G+ G+PG  G  G  G+ GE G            + G  G  GF G+KG+ G PG  G   I G+KGDSG PG  G +G  G SG+KG                           +G+ G  G  G KGE G+ G  G  G KGESGM G  G  G+ G  G+ G +G  G+ G  G  G+PG           G  G  G  GI G+KGE G+ G  G  G  G  G  G+                                    +   + GEKG  G+ G  G +GE G PG+      D      GQ+G  G  G  G  G+KGM
Sbjct:  440 GLPGPKGEPGYRGTPG----QSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSL----------------NGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG--GTCSACAPGTKGEKGLPGYSGQPGP------------QGDRGLPGMPGPVGDAGDDGLPGPAGRP-GSPGPPGQDGFPGLPGQKGEPTQLTLRPG--PPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPG---------------LPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPG--------IPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFP--------GLKGDAGLPGLPGTPGLEGQRGFPGAPGL---------------------KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPG---VPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGR--DGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQK-------GDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGM 1496          

HSP 3 Score: 142.895 bits (359), Expect = 1.180e-33
Identity = 342/951 (35.96%), Postives = 420/951 (44.16%), Query Frame = 1
Query: 1375 GDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGK---NGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGD---------------KGIKGAKGDSREETF----PSIKGEKGDNGPDGKEG---------------------PKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA--KGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGD---KGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG 4047
            G  G  G +G  G  GP+G+ G+ G  G         +++ G+ G  G  GL G  G  G  G+ G RGP G    GL G  G +G  G +G DG+   NG  G  G KG  G  C  C              G KG+ GL G  G PG +GDRG PG  G +G      D GD GLPG                 G+ G KG+  + T     P   G KG+NG  G+ G                      KG  G PGL+GKPG  G  G  G KG+ G            +            G +G+ GE   +                +N   P      G  G  GE G  G  G+VG  G  G  G  G SG  G PG PG+ GV G KGF GVPG+PG      + G KGD+GN G+ G  G KG  G    G  G+ G PG+    G+ G  G+ G EG+ G  G PG+ G  G  G SG+ G  G  G  G  G+ G  G PG  G   + G+ G  GE G+ GL G TG  GD    G+    G  G  G  G KG  GI G  G  GD G  G+ G  G  GE G  G+ G  G  G  G  G  G+ G  G  G  G +G NG+ GE+G  G    +G KGD G  G    G RG +G  G+ G  G KGE G PG  G  G  GE G+       G++G  GS G+ G  G  GM+GE G  G  G  G  GL GV G+KGD+G+ G  G  G  G  G+ G  G  G  G  GL GI G++G+ G    KGE+G                         PG+ G  G  GEKG  G  G  G KG+ G  G  G  G  G KG++G  G  G++G  G  G KG  GL G   Q      G +G PG  G++G+ G  GLPG+ G  G  G PG
Sbjct:  428 GAPGVSGPSGIPGLPGPKGEPGYRGTPG---------QSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACA------------PGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVG------DAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE--------------NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPG------IPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPG--QPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENG------------------------YPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPG 1304          

HSP 4 Score: 137.502 bits (345), Expect = 5.739e-32
Identity = 358/1029 (34.79%), Postives = 454/1029 (44.12%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGL---------------------AGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXX----------------XXXXXXXKTVKGIKGDSGDEGLQG---------EKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPS------IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNP----XXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI--NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM 3153
            G PGP+GD G  G PGP+G  G  G  G  G  G  G  G +G  GLPG +GE                 L    G  G PG  G NG  G  G+                      G  GL G  G  G  G  G PG+  +A  G+ G  G  G+ G+ G  G  G  G+ G  G+      V +  P G  G PG        KGE G+PG  G+ G      +      P  +GDSG  G  G  G  G+ G  G  G+ G  G  G KGD GN G  G  G KG+PG  G  G  GS G  G KG  G  G+ G  G +G RG  G  G  GG G  +  + G  G  G+KGD G  G+PG +G+ G  G  G+PG  G  G+ G   LPG  G  GD G  G+SGA G  G  G+ G  G+                     +  K   G+ G  G  G++G           G+SG  G+KG+RG +G P   G  GP    G+KG +GL G+ G  GP+G  GL G                    G KG+ GL G  G PG  G++G PG  G  GR+G+ G  G  GLPG  G+KG  G   ++  P       + G+KGD G   + G  G+ G+PGL+G+PG+ G  G  G  G  G P           +             + GE+G  G  G   + G  G  G  G   I  +K       GD G  G+PG +G  G  G KG  G  G  G  G+                  DG PG+PG++G+SGL G  G     G+KG+ G  G  GAKGD GA G PG   +G +G  G  G  G  G+PG+ G++G  G  G+ G        G  G+KG  G PG        G KG++G PG  G+ G+ GE GD G     G  G  G  GP G  G  G Q +   G+KG  G+ G  G  GEKG  GL+GP GN G  G  G+ G  G  G  G +G KG+ G+ G  G+
Sbjct:  552 GQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ--------------LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV-NPAPPGQPGLPGLP----GTKGEGGYPGRPGEVGQPGFPGL------PGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDG--LPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP------------------GFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLG---QSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLK-------GDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-DGFPGLPGQKGESGLSGLPG---APGLKGESGMPGFPGAKGDLGANGIPGK--RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGF------PGIPGLKGEGGLPG------FPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGL 1505          

HSP 5 Score: 135.191 bits (339), Expect = 2.736e-31
Identity = 319/910 (35.05%), Postives = 389/910 (42.75%), Query Frame = 1
Query: 1561 GVKGERGPSGRPTTGLVGPKGPKGEKG-----LSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPG--IRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMG--------DRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGR--SGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGP---VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVG---------------AKGELGEPGMRGSKG------------DNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKG------------EQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGR 4092
            G  G  GPSG P  GL GPKG  G +G     + GL GK+GK G  G  G                         KG++GL G  G PG  + G  G PG  GA G  G  G  G  GLPG  G KG +G +     P  KGEKG  G  G+ GP+G +G PG+   PG  GD G  G+ G  G PG  G  G+ G  G  G   +P Q    L    G     G KGE G  G   ++ +   +             ++GD G PGL G  G+ G+ G  G KG  G                       G PG PG +G  GL G  G  G QGM G+   + +      G  G  G PG  G  G  G  GE G+ G  GLPG+ GD G  G  G  G  G  G KGF G+ G  G PGP   VG+  + G+ G  GEPGV G+ G  G  G  G     G  G  G  G +G+RG  G  G+ G  G  G+ G+ G  GEKGD GL G      V G  G  G PG  G  G  G KG +G+ G  G+ G+KG+ G  G  G  GL    G  G KGN G+ G  G                KGE G PGM G+ G             +G +G+ G KG+ G NG  G KG                                 E G   + G+ G  G  G+ G  G  GP GL G+ G KG +G+   G+ G  G+ G     G+PG  G +G  G PG+ G  G  G KG  G  G+ G  G  G  G  G KG+ G  G+ G  G  G DG  G  G +G+KG  G    G  G+RG  G PG+ G  G            E+G  G PG  G  G  G PG     GI G  GD G  G+
Sbjct:  428 GAPGVSGPSGIP--GLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPG------------------------RKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGM---PGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ----LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQ-------------------PGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG------VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG---------------------------------EAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKG---LPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG--LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQ 1240          

HSP 6 Score: 102.834 bits (255), Expect = 2.191e-21
Identity = 311/926 (33.59%), Postives = 386/926 (41.68%), Query Frame = 1
Query:  325 GELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGC---------------NGTNGEKG-----NDGLAGKMGLSGDKGVKGDKGYIGEPGDF----FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGI---RGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTG---NVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKG------------ENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG------RPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKG------------DNGPDGKEGPKGIKGSPG------LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERG------LQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQG------AKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI---------PGKRGQSGLDGEKGDIGNQGMK-----------------------------------GDIGDKGRSGAKGDTGAIGNPGI-------------------GIKGNEGSRGEEGETGMRGLPGITG 2673
            G+ G  GL G  G +G  GLPG++GE+G                +G  G  G PG                 G  GE       N    G+ GL G  G KG+ GY G PG+     F    G KG +G  G  G  G  G  G +G  G  G  GI   +GDVG+ G  G++G+ G+   G+  Q G  GFPG  GDAG             P   G  G +G+ G  G  GLKG  G PGL G  G  G+KGD G     G  G+PG  GQ G  G  G++G DG+ G  GV                G KG++G  G SG       G  G  G  G KGN GIPG        GFKG  G  G  G  G    PG  G  G  G             +G SG  G +GD GFNG  G++G+ G   +   KG  G  G  GL+G +G SG  GV G +G +G P  G  G  G KG  G+ G  G+ G  G  G  GL G              G+KG  G  G+DGL GRDG PG+ G +G      +PG  GA G +G  G  G RG  G  G+ G  GD   + +P  KGE G            + G  G  G  G+KGSPG      L G PG+ GD G  G  G EG PG+ G KG  G  G  G   + + G  G      LQG+ G   + G+KGE G SG      +K       G+ G  G PG +G +G  G+ G +G        G DG  G  G  G+ G  G+ G  GF G+PG+         PG +G++G  G  G  G  G K                                   G+ G  G  GA G  G  G PG+                   G  G  G  GE+G  G+ G PG+ G
Sbjct:  655 GDAGLPGLSGKPGQDGLPGLPGNKGEAG----------------YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGL------------PGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGV---------------TGLKGDLGAPGQSG-----APGLPGAPGYPGMKGNAGIPGV------PGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFP------------GMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLK-------GESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDG 1507          

HSP 7 Score: 74.3294 bits (181), Expect = 9.825e-13
Identity = 232/655 (35.42%), Postives = 276/655 (42.14%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD-------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGN---RGTPGPKGQPGSKGAKG---------IRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAG-----GSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSC--------------------LPGKRGD---------IGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTA-----------------CKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDR---GLPGDKGIKGAKGDSREETFPSIKGE 1968
            G+PG KG+ G  G PG  G KG  G  G+ GA GL G  G  G  G  G  G  G  G  G+ G PG  G  G+ G  G+PG  G  G  G  GL G+ GLSG  G+KGD+G+ G PG+     KGE G A                    DG +GD G+ G  G +GP G SG PG              QP    Q GEKG PG  G AG             P   G  G  G  G KG++G  G  G PG DG  G  GQKGD G  G     G PG  GQPG  G +G         I G  G+ G+ G +G+ G  G+ G  G  G KG  G  G     GS    G    P  P G KGD G  G PG +G  G  G KGM G  G  G  G S                     LPG++G+          G KGE+G  G  G +GD G NG              + G +G+ G  G+ G  G  G  G+KGE G +G P   G  G  G KGE GL G  G  G+ G  G  G+ G A                                 N  E G+ GL G  G PG+RG++G PG DG  G +G  G  G R   G PG  G+ G KG      FP + G+
Sbjct:  904 GVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE-----KGEAGPAA------------------RDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQP---GQPGEKGLPGIPGKAGRQGA---------PGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIP-GLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--------------IPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQ 1508          

HSP 8 Score: 67.0106 bits (162), Expect = 1.402e-10
Identity = 129/362 (35.64%), Postives = 162/362 (44.75%), Query Frame = 1
Query: 2461 IPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGN---FGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGER------GIKGEQGINGDKGESGMIGR----------------TGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGP------------------------KGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGD--NGETGI-GQKGESGSNGEFGSKGQKGM 3390
            +PG  G+ G  GEKGD      +GD G+ G  G  G+ G+ GNPGIG              G +G PG  G +G  G  G +   G+    GP+G  G KG+ G+PG  G +   G  G SG+PG+ G+KG  G SG  G    RG+ G  G+ GP G +      G+ G  G+ G KGE+G  GR                T  +G  G  GL G  GN G  G  G  G PGP GP G TG                          G  G+ G  G+ G+ G  G  G +G  G    G  G+ G  G+ G  G KGE G PG+RG  GD  NG  G  GQ+G  G NG  G  G  G+
Sbjct:  180 LPGPSGRDGYPGEKGD------RGDTGNAGPRGPPGEAGSPGNPGIG------------SIGPKGDPGDLGSVGPPGPPGPREFTGSGSIVGPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGP---RGKEGRPGNAGPPGFKGDRGLDGLGGIPGLPGQKGEAGYPGRDGPKGNSGPPGPPGGGTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNTGGPGLPGYPGNEGLPGPKGDKGDGGIPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGL 520          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 221.861 bits (564), Expect = 8.718e-58
Identity = 96/230 (41.74%), Postives = 135/230 (58.70%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV--DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            F+  +H Q   E P CP G  K+++GYS +   GN + +  +LG   SCL  F+ MPF  C  +  C    R D+SYWL++   +    +  + +E YISRC  CE+PA   A HSQT  + +  CP  W+ LW GYSF MHT  G  GGGQSLSSPGSCL  FR +P +ECN     C+++ +  S++L  +  DSEF+VP+ + +     KS N+   +SRC+VC+K 
Sbjct: 1532 FVLVKHSQT-TEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPN--CPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTL-----KSGNLRTRVSRCQVCVKS 1753          

HSP 2 Score: 163.696 bits (413), Expect = 6.530e-40
Identity = 404/1162 (34.77%), Postives = 490/1162 (42.17%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGV--KGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGV------------------KGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXX-----------XXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG------------DIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-----------------------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGP---------IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL------------------------------------ETKGQRGEKGNMGVIGNVGAKGELGEPGM-RGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+PGPKG+ G  G PG    +   G  G+ G  GL G  G  G++GLPG RG  GD                   G  G PG  G  G  G DG  G  GL G  G KGD+G  G         KGEKG  G  G  G              GD+G  G+ G VGD G  G+ G  G         G+ GFPG  G  G   +L +  G  PP   G  GE G  GQ G  GL G +G  G  GA G  G+KGD G  G  G PG  G PG  G KG  G  G  G  G  G KG  G  G  G  G +G  GE     +      G  G  G  G KG  G PG  G +G+ GF G               LPG +GD G  G  G  G  G  GD GF G  G  G        + G KGD G+ GL G  G  G  GV   G+ G  G P        G KG+ GL GL G  G  G +G  G  G                      KG DGL G  G PG  G++G  G  G  GREGS G  G  GLPG   + G KG+      P + G KGD G  G+ G  G+ G+PG    PG+ G+ G  GV                  KG+ G PGM G  G  G  G  G+  +   G  G+ G KG +  +G  GEKG++G    +  K       GD G  G+PGL+GP G  G+ G  G KG  G+ G                   G +G  G+ G DG+PG PG +G+SG  G+ G  G  G+ G  G KG  G  G  G  G PG+ G  G  G RG++G+ G+ G+PG  G  G  G+ GE G            + G  G  GF G+KG+ G PG  G   I G+KGDSG PG  G +G  G SG+KG                           +G+ G  G  G KGE G+ G  G  G KGESGM G  G  G+ G  G+ G +G  G+ G  G  G+PG           G  G  G  GI G+KGE G+ G  G  G  G  G  G+                                    +   + GEKG  G+ G  G +GE G PG+      D      GQ+G  G  G  G  G+KGM
Sbjct:  440 GLPGPKGEPGYRGTPG----QSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSL----------------NGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG--GTCSACAPGTKGEKGLPGYSGQPGP------------QGDRGLPGMPGPVGDAGDDGLPGPAGRP-GSPGPPGQDGFPGLPGQKGEPTQLTLRPG--PPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPG---------------LPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPG--------IPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFP--------GLKGDAGLPGLPGTPGLEGQRGFPGAPGL---------------------KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPG---VPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGR--DGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQK-------GDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGM 1496          

HSP 3 Score: 142.895 bits (359), Expect = 1.180e-33
Identity = 342/951 (35.96%), Postives = 420/951 (44.16%), Query Frame = 1
Query: 1375 GDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGK---NGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGD---------------KGIKGAKGDSREETF----PSIKGEKGDNGPDGKEG---------------------PKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA--KGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGD---KGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG 4047
            G  G  G +G  G  GP+G+ G+ G  G         +++ G+ G  G  GL G  G  G  G+ G RGP G    GL G  G +G  G +G DG+   NG  G  G KG  G  C  C              G KG+ GL G  G PG +GDRG PG  G +G      D GD GLPG                 G+ G KG+  + T     P   G KG+NG  G+ G                      KG  G PGL+GKPG  G  G  G KG+ G            +            G +G+ GE   +                +N   P      G  G  GE G  G  G+VG  G  G  G  G SG  G PG PG+ GV G KGF GVPG+PG      + G KGD+GN G+ G  G KG  G    G  G+ G PG+    G+ G  G+ G EG+ G  G PG+ G  G  G SG+ G  G  G  G  G+ G  G PG  G   + G+ G  GE G+ GL G TG  GD    G+    G  G  G  G KG  GI G  G  GD G  G+ G  G  GE G  G+ G  G  G  G  G  G+ G  G  G  G +G NG+ GE+G  G    +G KGD G  G    G RG +G  G+ G  G KGE G PG  G  G  GE G+       G++G  GS G+ G  G  GM+GE G  G  G  G  GL GV G+KGD+G+ G  G  G  G  G+ G  G  G  G  GL GI G++G+ G    KGE+G                         PG+ G  G  GEKG  G  G  G KG+ G  G  G  G  G KG++G  G  G++G  G  G KG  GL G   Q      G +G PG  G++G+ G  GLPG+ G  G  G PG
Sbjct:  428 GAPGVSGPSGIPGLPGPKGEPGYRGTPG---------QSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACA------------PGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVG------DAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE--------------NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPG------IPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPG--QPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENG------------------------YPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPG 1304          

HSP 4 Score: 137.502 bits (345), Expect = 5.739e-32
Identity = 358/1029 (34.79%), Postives = 454/1029 (44.12%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGL---------------------AGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXX----------------XXXXXXXKTVKGIKGDSGDEGLQG---------EKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPS------IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNP----XXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI--NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM 3153
            G PGP+GD G  G PGP+G  G  G  G  G  G  G  G +G  GLPG +GE                 L    G  G PG  G NG  G  G+                      G  GL G  G  G  G  G PG+  +A  G+ G  G  G+ G+ G  G  G  G+ G  G+      V +  P G  G PG        KGE G+PG  G+ G      +      P  +GDSG  G  G  G  G+ G  G  G+ G  G  G KGD GN G  G  G KG+PG  G  G  GS G  G KG  G  G+ G  G +G RG  G  G  GG G  +  + G  G  G+KGD G  G+PG +G+ G  G  G+PG  G  G+ G   LPG  G  GD G  G+SGA G  G  G+ G  G+                     +  K   G+ G  G  G++G           G+SG  G+KG+RG +G P   G  GP    G+KG +GL G+ G  GP+G  GL G                    G KG+ GL G  G PG  G++G PG  G  GR+G+ G  G  GLPG  G+KG  G   ++  P       + G+KGD G   + G  G+ G+PGL+G+PG+ G  G  G  G  G P           +             + GE+G  G  G   + G  G  G  G   I  +K       GD G  G+PG +G  G  G KG  G  G  G  G+                  DG PG+PG++G+SGL G  G     G+KG+ G  G  GAKGD GA G PG   +G +G  G  G  G  G+PG+ G++G  G  G+ G        G  G+KG  G PG        G KG++G PG  G+ G+ GE GD G     G  G  G  GP G  G  G Q +   G+KG  G+ G  G  GEKG  GL+GP GN G  G  G+ G  G  G  G +G KG+ G+ G  G+
Sbjct:  552 GQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ--------------LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV-NPAPPGQPGLPGLP----GTKGEGGYPGRPGEVGQPGFPGL------PGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDG--LPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP------------------GFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLG---QSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLK-------GDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-DGFPGLPGQKGESGLSGLPG---APGLKGESGMPGFPGAKGDLGANGIPGK--RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGF------PGIPGLKGEGGLPG------FPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGL 1505          

HSP 5 Score: 135.191 bits (339), Expect = 2.736e-31
Identity = 319/910 (35.05%), Postives = 389/910 (42.75%), Query Frame = 1
Query: 1561 GVKGERGPSGRPTTGLVGPKGPKGEKG-----LSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPG--IRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMG--------DRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGR--SGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGP---VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVG---------------AKGELGEPGMRGSKG------------DNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKG------------EQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGR 4092
            G  G  GPSG P  GL GPKG  G +G     + GL GK+GK G  G  G                         KG++GL G  G PG  + G  G PG  GA G  G  G  G  GLPG  G KG +G +     P  KGEKG  G  G+ GP+G +G PG+   PG  GD G  G+ G  G PG  G  G+ G  G  G   +P Q    L    G     G KGE G  G   ++ +   +             ++GD G PGL G  G+ G+ G  G KG  G                       G PG PG +G  GL G  G  G QGM G+   + +      G  G  G PG  G  G  G  GE G+ G  GLPG+ GD G  G  G  G  G  G KGF G+ G  G PGP   VG+  + G+ G  GEPGV G+ G  G  G  G     G  G  G  G +G+RG  G  G+ G  G  G+ G+ G  GEKGD GL G      V G  G  G PG  G  G  G KG +G+ G  G+ G+KG+ G  G  G  GL    G  G KGN G+ G  G                KGE G PGM G+ G             +G +G+ G KG+ G NG  G KG                                 E G   + G+ G  G  G+ G  G  GP GL G+ G KG +G+   G+ G  G+ G     G+PG  G +G  G PG+ G  G  G KG  G  G+ G  G  G  G  G KG+ G  G+ G  G  G DG  G  G +G+KG  G    G  G+RG  G PG+ G  G            E+G  G PG  G  G  G PG     GI G  GD G  G+
Sbjct:  428 GAPGVSGPSGIP--GLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPG------------------------RKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGM---PGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQ----LTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQ-------------------PGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG------VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG---------------------------------EAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKG---LPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG--LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQ 1240          

HSP 6 Score: 102.834 bits (255), Expect = 2.191e-21
Identity = 311/926 (33.59%), Postives = 386/926 (41.68%), Query Frame = 1
Query:  325 GELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGC---------------NGTNGEKG-----NDGLAGKMGLSGDKGVKGDKGYIGEPGDF----FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGI---RGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTG---NVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKG------------ENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG------RPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKG------------DNGPDGKEGPKGIKGSPG------LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERG------LQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQG------AKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI---------PGKRGQSGLDGEKGDIGNQGMK-----------------------------------GDIGDKGRSGAKGDTGAIGNPGI-------------------GIKGNEGSRGEEGETGMRGLPGITG 2673
            G+ G  GL G  G +G  GLPG++GE+G                +G  G  G PG                 G  GE       N    G+ GL G  G KG+ GY G PG+     F    G KG +G  G  G  G  G  G +G  G  G  GI   +GDVG+ G  G++G+ G+   G+  Q G  GFPG  GDAG             P   G  G +G+ G  G  GLKG  G PGL G  G  G+KGD G     G  G+PG  GQ G  G  G++G DG+ G  GV                G KG++G  G SG       G  G  G  G KGN GIPG        GFKG  G  G  G  G    PG  G  G  G             +G SG  G +GD GFNG  G++G+ G   +   KG  G  G  GL+G +G SG  GV G +G +G P  G  G  G KG  G+ G  G+ G  G  G  GL G              G+KG  G  G+DGL GRDG PG+ G +G      +PG  GA G +G  G  G RG  G  G+ G  GD   + +P  KGE G            + G  G  G  G+KGSPG      L G PG+ GD G  G  G EG PG+ G KG  G  G  G   + + G  G      LQG+ G   + G+KGE G SG      +K       G+ G  G PG +G +G  G+ G +G        G DG  G  G  G+ G  G+ G  GF G+PG+         PG +G++G  G  G  G  G K                                   G+ G  G  GA G  G  G PG+                   G  G  G  GE+G  G+ G PG+ G
Sbjct:  655 GDAGLPGLSGKPGQDGLPGLPGNKGEAG----------------YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGL------------PGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGV---------------TGLKGDLGAPGQSG-----APGLPGAPGYPGMKGNAGIPGV------PGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFP------------GMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLK-------GESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDG 1507          

HSP 7 Score: 74.3294 bits (181), Expect = 9.825e-13
Identity = 232/655 (35.42%), Postives = 276/655 (42.14%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD-------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGN---RGTPGPKGQPGSKGAKG---------IRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAG-----GSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSC--------------------LPGKRGD---------IGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTA-----------------CKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDR---GLPGDKGIKGAKGDSREETFPSIKGE 1968
            G+PG KG+ G  G PG  G KG  G  G+ GA GL G  G  G  G  G  G  G  G  G+ G PG  G  G+ G  G+PG  G  G  G  GL G+ GLSG  G+KGD+G+ G PG+     KGE G A                    DG +GD G+ G  G +GP G SG PG              QP    Q GEKG PG  G AG             P   G  G  G  G KG++G  G  G PG DG  G  GQKGD G  G     G PG  GQPG  G +G         I G  G+ G+ G +G+ G  G+ G  G  G KG  G  G     GS    G    P  P G KGD G  G PG +G  G  G KGM G  G  G  G S                     LPG++G+          G KGE+G  G  G +GD G NG              + G +G+ G  G+ G  G  G  G+KGE G +G P   G  G  G KGE GL G  G  G+ G  G  G+ G A                                 N  E G+ GL G  G PG+RG++G PG DG  G +G  G  G R   G PG  G+ G KG      FP + G+
Sbjct:  904 GVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE-----KGEAGPAA------------------RDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQP---GQPGEKGLPGIPGKAGRQGA---------PGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIP-GLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--------------IPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQ 1508          

HSP 8 Score: 67.0106 bits (162), Expect = 1.402e-10
Identity = 129/362 (35.64%), Postives = 162/362 (44.75%), Query Frame = 1
Query: 2461 IPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGN---FGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGER------GIKGEQGINGDKGESGMIGR----------------TGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGP------------------------KGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGD--NGETGI-GQKGESGSNGEFGSKGQKGM 3390
            +PG  G+ G  GEKGD      +GD G+ G  G  G+ G+ GNPGIG              G +G PG  G +G  G  G +   G+    GP+G  G KG+ G+PG  G +   G  G SG+PG+ G+KG  G SG  G    RG+ G  G+ GP G +      G+ G  G+ G KGE+G  GR                T  +G  G  GL G  GN G  G  G  G PGP GP G TG                          G  G+ G  G+ G+ G  G  G +G  G    G  G+ G  G+ G  G KGE G PG+RG  GD  NG  G  GQ+G  G NG  G  G  G+
Sbjct:  180 LPGPSGRDGYPGEKGD------RGDTGNAGPRGPPGEAGSPGNPGIG------------SIGPKGDPGDLGSVGPPGPPGPREFTGSGSIVGPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGP---RGKEGRPGNAGPPGFKGDRGLDGLGGIPGLPGQKGEAGYPGRDGPKGNSGPPGPPGGGTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNTGGPGLPGYPGNEGLPGPKGDKGDGGIPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGL 520          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 211.846 bits (538), Expect = 3.574e-57
Identity = 257/670 (38.36%), Postives = 316/670 (47.16%), Query Frame = 1
Query: 1360 LPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKG------------------ERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGP------KGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMR 3297
             PG +GD GDKG+ G++GA G                         G+KGD G +G  GEKG  G KG  G                  E+G  G P  G  G KG KGEKG +G  G  G  G KG  G  G                   +G+KG DG  G DG PG +GD+G  G  GA G  GS GD GD+G   +KG  GAKGD      P  KG+KG+         KG  G+ G +G PG  GD G  G KG +G PG                  K  +GE+GL G KG K  DG  G KGD G+   +  K  + T  G +GD GE GL GP G  G  G +GA                           +G PG  G +G+ G DG KG  G  G KGD G+KG  G KGD GA G PG   KG++G +G +G  G  G PG  GD G  G  G  G  G  G KG KG+ G  G  G  G     G KGD GE G  G KG  G  G KG+       G++G  GPKG++G  G  G  GDKGE G IG+ G+ G+KG++G +G        G  G  GD+G+ G+ G  G DG  G KG +G  G++G  G KG+ G  G +G+KG   KGQ G+ G  G  G  G KG+ G+PG +
Sbjct:   87 TPGDKGDTGDKGDKGDTGAPG------------------------VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSP--GQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGP------------------KGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKG---EKGSDGAKGDKGANGTPGSKGDKGE---------KGADGAKGADGTPGSKGDKGADGAKGADGTPG-----------------QKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGT-PGSKGDKGEKGLDGPKGDKGADGAKGA---------------------------NGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGA--KGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADG---TPGAKGDKGEKGADGAKGADGTPGSKGDK------GDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKG--DKGQDGQPGQKGQDGQPGQKGQDGQPGQK 641          

HSP 2 Score: 195.667 bits (496), Expect = 8.299e-52
Identity = 217/521 (41.65%), Postives = 270/521 (51.82%), Query Frame = 1
Query: 1882 GDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGS---PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGV---------IGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETK-GQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----------GQKGESGSNGE 3363
            G++G PG KG KG KG+      P  KG+KG+ G DG  GPKG KG+    G +G PG  GD G  G KG +GNPG KG  G+              +GE+G  G KG K  +G  G KGD G    +  K  + T  G +GD G  G +G  G  G KGD+G KG DG  G KG                DG PG  G +G  G DG KG  G  G KGD G+KG  G KGD GA G  G     G KG++G +G +G  G  G PG  GD G +G  G +GD G  G  G KG KG  G  G  G     G KGD G  G +G  G  G+ GDKGE   +G  G +GD G  G  G KG++G  G  G  G  G  G  G+KGD+GL+GPKG+ G           G++G+ G+PG  G  G  G  G  G KG+ G  G KG+ G KG QGEKG + + GQ+G+ G  G  G+ G KG++G+PG +G KGD G+ G           GQKG+ G  G+
Sbjct:  154 GEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGD--------------KGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGT-PGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKG---------------ADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGE---KGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 3 Score: 184.882 bits (468), Expect = 3.632e-48
Identity = 264/635 (41.57%), Postives = 319/635 (50.24%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGN--VGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCL------PGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQ----GERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPG 2826
            PG  G  GD+G KGDTG   VG +G PG +G PG KG  G +G+ G  G KG +G+KG +G  G+ G +GS G+ G+ G  G+   N  G  G  GDKG+KG  G PG +G+ G  G KG  G  G  GD G          PG +GD GDKGE G  GA   +GD G NG                G KGD G++G  G KG  G+ G KG++G  G    G  G  G KG+KG  GLDG      PKG KG  GT                 ++G+KG DG  G DG PG +GD+G  G DG  G +G+ G  G  G PG KG KG KG    +      G KGD G  G +GPKG KG+ G  G  G  G+ G  G KG +G PG KG KG  G KG    D  P Q    GE+GL G KG K  DG  G KGD G    +  K  + T  G +GD G+ GL GP      KGD+GA                           DG PG  G +G      EKGDIG  G KGD G+KG+ G  G  G  G PG  G KG++G +GE+G+ G  G  G  G  G +G+ GE+GDIG  G KG KG KG  G+PG  G     G KG  G+PG
Sbjct:   88 PGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSN--GSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGA---KGDKGANG--------------TPGSKGDKGEKGADGAKGADGTPGSKGDKGADG--AKGADGTPGQKGDKGEKGLDG------PKGDKGADGTPGAKG------------DKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGA---DGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGT-PGSKGDKGDKGLDGP------KGDKGA---------------------------DGTPGSKGDKG------EKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 4 Score: 177.178 bits (448), Expect = 1.316e-45
Identity = 251/590 (42.54%), Postives = 304/590 (51.53%), Query Frame = 1
Query: 2458 GIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEG------------------ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFG---ERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENG---EKGDQGLNGPKGNVGV---IGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNG---PKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGV---KGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGP---------KGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGR 4092
            G+PG  G+ G  G+KGD G++G KGD G  G  G KGD GA G PG   KG +G +G  G                  E G +G PG  GD   +GE GE+G  G+ G KG KG KG  G PGP GDK   G KG  G PG +G KG  G  G  G    +G+ G   E+G  G KG++G  G  G  GDKGE G  G  G +G    KGD+G +G KG  G     GD+GE G  GP G  GA G  G  G KG++G  G KG +G    KGD+GEKGL+  KG +G  G  G  G  GAKG+ GE G  G+KG +G  G  G KGE G +G  G KG  G  G KGD G  G  G  G  G  G KGD G                         DG KG  G  G+KG  G   KG  GP GD G  G  G  GDKG+KG  G  G  G  G  G+KG+KG+   KG+ G  G  G +GD+G KG+ G  G+ G KG+ G+DG  G  G          KG+KG     Q G+ G +G+ G PG+ G KGE+G  G PG+ G  GDKG+ G  G +G DG  G KG+
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPG-VGVKGDPGAQGPPGE--KGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGD---KGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGA------------------------DGAKGADGTPGQKGDKG--EKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQ 634          

HSP 5 Score: 176.792 bits (447), Expect = 1.653e-45
Identity = 250/640 (39.06%), Postives = 320/640 (50.00%), Query Frame = 1
Query: 2161 VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSG---AKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENG------EKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMG 4029
            V G  G  G  G K   G+KG+KGD+G   +                 G+PG QGP G+ G  GD+GA G+ G  G  G+ G  G+ G K      G  G PG++G  G  GEKG  G+ G KGD G+KG  G    KGD GA G      KG +G+ G +G+ G  G  G  G+ G++G++G++G+ G+ G KG KG  G  G  G  G+K   G KG  G PG +G KG  G  G  G    +G+ GE+G  GPKG++G  G  G  GDKG+ G  G  G +G      +KG++GL+GPKG+ G  G +G  G PG          KG  G KG  G  G  G  G KGD+GEKGL+     G KG+ G  G  GAKG+ GE G  G+KG +G  G        G KG  G+ G+ G KG+KG+          GPKG  G  G  G KGD GE G+                     DG KG  G  G KG  G   KG  GP GD G                    G  G++GD GEKG+ G  G+ G KG  G  G  G KG  G  G+ G KGD G+ G+KG  G  G KG  G P Q+G  G +G++G PG+ G KG++G +G PG+ G+ G
Sbjct:   78 VPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGV--------------KGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEK------GEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADG-----AKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGA---------KGDKGEKGTDGAKGADGTPGAKGDKGEKGLD-----GPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGL---------DGPKGDKGADGTPGAKGDKGEKGA---------------------DGAKGADGTPGSKGDKGD--KGLDGPKGDKG------------------ADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDG 627          

HSP 6 Score: 175.637 bits (444), Expect = 3.462e-45
Identity = 266/690 (38.55%), Postives = 330/690 (47.83%), Query Frame = 1
Query: 1858 REGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGR---SGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENG------EKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGP---KGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRG------SKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDG 3870
            ++G  G  G  G PGDKG  G KGD  +   P +                G+KG PG  G PG      + G  GD+G PG KG KG+ G+KG KG   +  +GE+G  G+KG K   GEKGEKG +G+              G +GD GE G  G  G  G KG  GAKG+D                           G PG +G  G DG KG  GN G KGD GDKG     GAKGD GA G PG   KG++G +G +G  G  G PG  GD G  G  G  G  G  G KG KG+ G  G  G  G    KG KGD G  G +G  G  G  GDKGE   +G  G +GD G  G +G  G  G  GDKGE G  G  G +G      +KG++GL+GPKG+ G  G  G  G  G  G DGA G  G  G KG++G  G KG +G    KGD+GEKGL+  G +G+KG  G  G  G KGE G  G +G      SKGD G+ G+ G KG+ G++G  GSKG KG +G                        DIG+ G +G  G+ G  G+          G KG  G  G+KG  G   +GE G  G  G                     ++G +G  G+KG+KG KG++G  G  G +GD+G  G  G KG+ G  G  G+DG
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGV----------------GVKGDPGAQGPPG------EKGKDGDKGAPGAKGSKGDDGKKGDKGSSGE--KGEKGSPGQKGDK---GEKGEKGSNGSP-------------GSKGDKGEKGADGNPGPKGDKGADGAKGAD---------------------------GTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGS--KGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGE---KGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD--GPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKG------------------------DIGQPGQKGDKGEKGQDGQP---------GQKGQDGQPGQKGDKGDKGQGEKGQDGQPG---------------------QKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDG 636          

HSP 7 Score: 145.206 bits (365), Expect = 3.265e-35
Identity = 248/708 (35.03%), Postives = 311/708 (43.93%), Query Frame = 1
Query:  361 GSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPG--------CNGTNGEKGNDGLAG---------------------KMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNR---GTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP---------VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQG 2361
            G+NG+DG PGD+G++GD                GD+GD G PG          G  GEKG DG  G                     + G  G  G KGDKG  GE        KG  G                       G +GDKG +G  G+ GP G  G  G        KG  G PG  GD G+D                                    G PG  G  GD+G+KG  G  G++   GTPG KG  G KGA G +G+DG  G KG +G  G +G  G  G +G KGE G           + GP      KGDKG  G PG +G+ G+KG                    G  G  G KG+ GE G  GP+GD G +G  G  G          G KGD G++G  G KG  G+ G KG++G       GL GPKG KG  G  G  G  G+ G  G KG  GT                 ++G+KG DG  G DG PG +GD+G  G DG  G +G+ G  G +G  G+KG  GAKG    +  P  KG+KGD G DG +G KG  G+PG  G  G  GD+G+ G KGD+G       KG+ G+ G KG D +P          QGE+G  G+ G K  DG+ G+KGD G    +  +P    + GD+G  G+PG +G  G+ G KG  G
Sbjct:   80 GTNGKDGTPGDKGDTGD---------------KGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGE--------KGSNGSP---------------------GSKGDKGEKGADGNPGPKGDKGADG-------AKGADGTPGSKGDKGSDGAKGA------------------------------DGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKG-----------LDGP------KGDKGADGTPGAKGDKGDKGA---------------DGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANG--------TPGAKGDKGEKGTDGAKGADGTPGAKGDKG-----EKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPG---------------SKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKG---ADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGE------KGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGE-KGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDG 636          

HSP 8 Score: 129.798 bits (325), Expect = 2.836e-30
Identity = 231/588 (39.29%), Postives = 275/588 (46.77%), Query Frame = 1
Query:  304 KGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKD---GLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISG 2055
            KG  G+ G+ G +G  G+ GSNG  G  GD+GE          G  G+ G  GD+G  G  G +GT G KG+ G  G  G  G+ G KGD G  GE G      KG+KG  G  GS G+KGEKG  G +G DG  G KG +G  G +G  G  G+ GD       KGEKG  GP GD G D      KG      +GD G  G  G  G  G KG  GE GLDG  GD+G     G  G  GTPG KG  G KG  G +G+DG  G                   +G KGE G           + GP      KGDKG  G PG +G+ GEKG           G  G    PG +GD G  G  G  G  G +GD G               K + G KGD G +G  G KG  G KG  G +G  G P + G  G KG  G KG  G DG  G  G KG KG +G   +              ++GEKG+D   G  G+DG PG +GD+G  G  G  G++G  G  G  G PG KG KG KGD  +   P  KG+KGD G DG+ G KG  G PG  G+ G  G
Sbjct:  153 KGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEK---------GADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKG--SDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGD-------KGEKGLDGPKGDKGADG-TPGAKG-----DKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGA---DGAKGANGTPGAKGDKGEKGTDGAKGADGTPGA------------------KGDKGEKG-----------LDGP------KGDKGADGTPGAKGDKGEKGA---------DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGE--------------KGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKG------------DKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQ---PGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 9 Score: 117.472 bits (293), Expect = 2.029e-26
Identity = 249/637 (39.09%), Postives = 313/637 (49.14%), Query Frame = 1
Query: 2734 GFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKG------NKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-------QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIG 4602
            G  G  G  G PG  GD   KG KGD+G PGV G+KG  G  G  GE    G+ G  G  G KG+ G KG++G +G+KGE G  G+ G+ GEKG++G NG  G+ G  G++G  G PGP       G KG +G KG  G  G KG+ G           + G +G  GN G  G+ G KGE G  G +G KG NG  G       G  GE G+ G KG +G  G  G  G  G  G  G  G+KGD GE                           KGL G  G+KG  G    KG+ G  G +G                KG  G  G++GD GEKG      +KG  G  G  G  G +GD+G KG  G+KG  G  G  G+ G+KG  GPKG+KG  G         ++G  G +G  G PG  G KG  G +G  G  G+ GDKG+   G++GP GD G  G  G +G KGE G           GAKG  G  G+KG+ G+ G  G KG KG  G  G KG+ G +GD+G  G KG +G KG+ G  G  G  G  G +G  G KG      + + G +G+ G+PG  G  G KGD+G+P  +G KG KG+ G  G  GQ+ G  G KG  G
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGV-GVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGP------KGDKGADGAKGADGTPGSKGDKG-----------SDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGS-----KGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGE---------------------------KGLDGPKGDKGADGTPGAKGDKGDKGADG---------------AKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGE--KGLDGPKGDKGADGTPGAKGDKGEKGA---------DGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQD-GQPGQKGQDG 636          

HSP 10 Score: 73.9442 bits (180), Expect = 7.995e-13
Identity = 192/515 (37.28%), Postives = 239/515 (46.41%), Query Frame = 1
Query: 3121 GINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIG----QKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETG---PKGDFGEDGDKG------NVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGAR 4617
            G+ G  G+ G  G KG+ G KGD+G+ G    G +G+ G  G  G  G  G+ G PG +GSKGD+G+ G      +KGE GS G+ G KG+KG +G  G  G  G               D GE G+ G                    GPKG  G  G KG  G    KG+ G  G  G                 G PG +G+ GD GEKG+ G KG+ G  G  G +GD+G KG  G+KG  G    KGD G DG KG        G KG KGL GP      G++G  G PG  G KG++G +G  G  G  G KG    G +G DG  G+KG +G +G  G  G KG+ GE G  GAKG  G  G KG+ GE G                   +GP+GD G +G  G +G KGE G+ G  GA G  G                  KG++G  G  G  G  G KGD GE  + GPKG KG  G  G  G   E+G  G KG+ G  G++
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKG---------------DKGEKGADGNP------------------GPKGDKGADGAKGADGTPGSKGDKGSDGAKG---------------ADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGP-----KGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGD--KGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGL------------------DGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGS-----------------KGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSK 501          

HSP 11 Score: 66.2402 bits (160), Expect = 1.766e-10
Identity = 111/311 (35.69%), Postives = 127/311 (40.84%), Query Frame = 1
Query:  220 TQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXX---------XXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDV------GDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTP--------PDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRG 1083
            T       G PG KGD G  G  GP G KG  G  G  G +G  G  G+ G DG PG +G+ G  G  G  G PG           G  GD+G  G PG  G  GEKG DG  G  G  G KG KGDKG  G  GD     KG  G                       G +GDKG +GD+      GD+G  G  G+PG       QKG+ G PG  GD G   +    +   P        P Q+GD                      G  G +G  GQKGD G+ G  G PG KGQ G  G KG  G
Sbjct:  380 TDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGD-----KGADGTP---------------------GSKGDKGEKGDIGQPGQKGDKGEKGQDGQPG-------QKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDK---------------------GEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDG 636          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 469.159 bits (1206), Expect = 2.273e-136
Identity = 665/1886 (35.26%), Postives = 869/1886 (46.08%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIG----------EPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGF----------PGPIGDAGTDCKLFVLK-GKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQ--------------------GPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTV---KGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGE---KGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXF------DGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFG---PKGFKGIKGNTGK------PGPVGDKTIKGIKGDSGEPGVQGLKGF---TGESGDKGECSGRGEFGERGDVGPKGERG------------------IKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM--MGVKGNNGP---KGDQGEKGLETK----GQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT--LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNT--------------GSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVG------------------IKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALEST--FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVE--KYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            KNC         +C+       + G  G PGP+GP G  G MG  G  G  GD G  G  G  G RG+ G+ G PG+HG  G  G+ G  G+ G PG NG +G  G DG+ G  GLSG  G +G  G +G          E GD+ + +KGE G+                G  G+ G QG  G +G+ GD GP G  G  G+       KGEKG           PG  G+ G     F +K   T    RGD G+KGE G  G+ G  G  G+ GLDG  G++G  G  G+ G +G  GP   PGS G KG RG  G+ G  G               N G KGE G AG +GK                             G  G +G  G  G+PG QG  G+KG              G    PG  G  G KGE G +G +GP+G  G  G  G  G  G +G       GI+G  GD G+ G  G+ GSKG +G +G +G P        G  G  G  G+KG +G  G  G+ G  G+KG +G  C  C+ G  G+KG  G  G  GKDG  G  G  G  G+RG  G +G  G  G  G+ G  GLPG  G  G            +KG+KG  G  G +G +G KG+ GL G PG  G+ G  G KG  G PG  G  G  G  G  GI  + ++GE G  G    KG K   G  GEKG+ G+C ++ +K       G++G+ G+ G+ GP G+          G+KG+ G +G  G+ G +G  G  G KG +G  G       DG+ GIPG+ GQ G  GE G I   G  G  G  G  G KGD G  G   IG  G +GS G  G+ G  GLPG++G  G  GE G+ G IG  G   P G  GI G  G+      PG  G   + G KGD G PG  G KGF   TG  G +G     G  G +GD G  G  G                  IKG+QG+ G  G+ G+ G  GE G +G  GL+GP G  G   ++G+ G+PGP G  G TGP G  G  GE+G+  + V G  GP   KGDQG  G++ +    G++GE+G  GV G  G KG +G PG+ G+ G +G  G       +G  G+ G  GE G  G  G++G                        + G +G +G  G                 GPKG  GI G+ GL      ++G+ G  G+ G TG+ G  G++G  G  G+ G +G+ G  G  G  G+ G  G KG++GP+G+ G  G T              G +G  G  G  GE G  G  G  G  GL GP    G  G RG  G+PG+ G                   KGE+GL G  G+ G  GD+G    G  G  G +G KG  G  G+ G  G  G  GE G  G KG  G  G  G  G+ G  G     G  G+ G  G NGP+G+ G  G +G+ G +GE G                             +KG RG IGE G++G+ G KGD GEP  RG +G  G             ++G KG  G                           P   AL+     L TRH Q+ E  P C  G  +++ GYS +  +GN   +  +LG+  SC+  F+ +P   C ++  C    R D+++WL + A +   M+ V+N+E  +YISRCV CE+PA   A HSQT  + D  CP  W  LW GYSF+MHT  GN GGGQ+L SPGSCL  FR +P +ECN     C+ +    S+++ +++S   FE P+ + IKA + +S      +SRC+VCMK
Sbjct:   71 KNCTAGYAGCVPKCIA------EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGW---------------RGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGP---PGSTGQKGDRGEPGLNGLPG---------------NPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKG------------GAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK---MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG-ISRPGPMGPPGLNGLQGEKGDRGPTGP--IGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKG------------------------ETGPVGLQGFTG---------------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL--QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG-----------------------------EKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIG-------------LIGQKGEPG--------------------------APAPAALDYLTGILITRHSQS-ETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIP--MMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPD--CPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQS-----HVSRCQVCMK 1776          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 469.159 bits (1206), Expect = 2.273e-136
Identity = 665/1886 (35.26%), Postives = 869/1886 (46.08%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIG----------EPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGF----------PGPIGDAGTDCKLFVLK-GKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQ--------------------GPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTV---KGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGE---KGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXF------DGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFG---PKGFKGIKGNTGK------PGPVGDKTIKGIKGDSGEPGVQGLKGF---TGESGDKGECSGRGEFGERGDVGPKGERG------------------IKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM--MGVKGNNGP---KGDQGEKGLETK----GQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT--LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNT--------------GSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVG------------------IKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALEST--FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVE--KYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            KNC         +C+       + G  G PGP+GP G  G MG  G  G  GD G  G  G  G RG+ G+ G PG+HG  G  G+ G  G+ G PG NG +G  G DG+ G  GLSG  G +G  G +G          E GD+ + +KGE G+                G  G+ G QG  G +G+ GD GP G  G  G+       KGEKG           PG  G+ G     F +K   T    RGD G+KGE G  G+ G  G  G+ GLDG  G++G  G  G+ G +G  GP   PGS G KG RG  G+ G  G               N G KGE G AG +GK                             G  G +G  G  G+PG QG  G+KG              G    PG  G  G KGE G +G +GP+G  G  G  G  G  G +G       GI+G  GD G+ G  G+ GSKG +G +G +G P        G  G  G  G+KG +G  G  G+ G  G+KG +G  C  C+ G  G+KG  G  G  GKDG  G  G  G  G+RG  G +G  G  G  G+ G  GLPG  G  G            +KG+KG  G  G +G +G KG+ GL G PG  G+ G  G KG  G PG  G  G  G  G  GI  + ++GE G  G    KG K   G  GEKG+ G+C ++ +K       G++G+ G+ G+ GP G+          G+KG+ G +G  G+ G +G  G  G KG +G  G       DG+ GIPG+ GQ G  GE G I   G  G  G  G  G KGD G  G   IG  G +GS G  G+ G  GLPG++G  G  GE G+ G IG  G   P G  GI G  G+      PG  G   + G KGD G PG  G KGF   TG  G +G     G  G +GD G  G  G                  IKG+QG+ G  G+ G+ G  GE G +G  GL+GP G  G   ++G+ G+PGP G  G TGP G  G  GE+G+  + V G  GP   KGDQG  G++ +    G++GE+G  GV G  G KG +G PG+ G+ G +G  G       +G  G+ G  GE G  G  G++G                        + G +G +G  G                 GPKG  GI G+ GL      ++G+ G  G+ G TG+ G  G++G  G  G+ G +G+ G  G  G  G+ G  G KG++GP+G+ G  G T              G +G  G  G  GE G  G  G  G  GL GP    G  G RG  G+PG+ G                   KGE+GL G  G+ G  GD+G    G  G  G +G KG  G  G+ G  G  G  GE G  G KG  G  G  G  G+ G  G     G  G+ G  G NGP+G+ G  G +G+ G +GE G                             +KG RG IGE G++G+ G KGD GEP  RG +G  G             ++G KG  G                           P   AL+     L TRH Q+ E  P C  G  +++ GYS +  +GN   +  +LG+  SC+  F+ +P   C ++  C    R D+++WL + A +   M+ V+N+E  +YISRCV CE+PA   A HSQT  + D  CP  W  LW GYSF+MHT  GN GGGQ+L SPGSCL  FR +P +ECN     C+ +    S+++ +++S   FE P+ + IKA + +S      +SRC+VCMK
Sbjct:   71 KNCTAGYAGCVPKCIA------EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGW---------------RGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGP---PGSTGQKGDRGEPGLNGLPG---------------NPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKG------------GAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK---MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG-ISRPGPMGPPGLNGLQGEKGDRGPTGP--IGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKG------------------------ETGPVGLQGFTG---------------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL--QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG-----------------------------EKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIG-------------LIGQKGEPG--------------------------APAPAALDYLTGILITRHSQS-ETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIP--MMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPD--CPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQS-----HVSRCQVCMK 1776          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079001)

HSP 1 Score: 469.159 bits (1206), Expect = 2.273e-136
Identity = 665/1886 (35.26%), Postives = 869/1886 (46.08%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIG----------EPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGF----------PGPIGDAGTDCKLFVLK-GKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQ--------------------GPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTV---KGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGE---KGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXF------DGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFG---PKGFKGIKGNTGK------PGPVGDKTIKGIKGDSGEPGVQGLKGF---TGESGDKGECSGRGEFGERGDVGPKGERG------------------IKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM--MGVKGNNGP---KGDQGEKGLETK----GQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT--LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNT--------------GSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVG------------------IKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALEST--FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVE--KYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            KNC         +C+       + G  G PGP+GP G  G MG  G  G  GD G  G  G  G RG+ G+ G PG+HG  G  G+ G  G+ G PG NG +G  G DG+ G  GLSG  G +G  G +G          E GD+ + +KGE G+                G  G+ G QG  G +G+ GD GP G  G  G+       KGEKG           PG  G+ G     F +K   T    RGD G+KGE G  G+ G  G  G+ GLDG  G++G  G  G+ G +G  GP   PGS G KG RG  G+ G  G               N G KGE G AG +GK                             G  G +G  G  G+PG QG  G+KG              G    PG  G  G KGE G +G +GP+G  G  G  G  G  G +G       GI+G  GD G+ G  G+ GSKG +G +G +G P        G  G  G  G+KG +G  G  G+ G  G+KG +G  C  C+ G  G+KG  G  G  GKDG  G  G  G  G+RG  G +G  G  G  G+ G  GLPG  G  G            +KG+KG  G  G +G +G KG+ GL G PG  G+ G  G KG  G PG  G  G  G  G  GI  + ++GE G  G    KG K   G  GEKG+ G+C ++ +K       G++G+ G+ G+ GP G+          G+KG+ G +G  G+ G +G  G  G KG +G  G       DG+ GIPG+ GQ G  GE G I   G  G  G  G  G KGD G  G   IG  G +GS G  G+ G  GLPG++G  G  GE G+ G IG  G   P G  GI G  G+      PG  G   + G KGD G PG  G KGF   TG  G +G     G  G +GD G  G  G                  IKG+QG+ G  G+ G+ G  GE G +G  GL+GP G  G   ++G+ G+PGP G  G TGP G  G  GE+G+  + V G  GP   KGDQG  G++ +    G++GE+G  GV G  G KG +G PG+ G+ G +G  G       +G  G+ G  GE G  G  G++G                        + G +G +G  G                 GPKG  GI G+ GL      ++G+ G  G+ G TG+ G  G++G  G  G+ G +G+ G  G  G  G+ G  G KG++GP+G+ G  G T              G +G  G  G  GE G  G  G  G  GL GP    G  G RG  G+PG+ G                   KGE+GL G  G+ G  GD+G    G  G  G +G KG  G  G+ G  G  G  GE G  G KG  G  G  G  G+ G  G     G  G+ G  G NGP+G+ G  G +G+ G +GE G                             +KG RG IGE G++G+ G KGD GEP  RG +G  G             ++G KG  G                           P   AL+     L TRH Q+ E  P C  G  +++ GYS +  +GN   +  +LG+  SC+  F+ +P   C ++  C    R D+++WL + A +   M+ V+N+E  +YISRCV CE+PA   A HSQT  + D  CP  W  LW GYSF+MHT  GN GGGQ+L SPGSCL  FR +P +ECN     C+ +    S+++ +++S   FE P+ + IKA + +S      +SRC+VCMK
Sbjct:   71 KNCTAGYAGCVPKCIA------EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGW---------------RGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGP---PGSTGQKGDRGEPGLNGLPG---------------NPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKG------------GAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK---MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG-ISRPGPMGPPGLNGLQGEKGDRGPTGP--IGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKG------------------------ETGPVGLQGFTG---------------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL--QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG-----------------------------EKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIG-------------LIGQKGEPG--------------------------APAPAALDYLTGILITRHSQS-ETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIP--MMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPD--CPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQS-----HVSRCQVCMK 1776          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 241.891 bits (616), Expect = 1.037e-63
Identity = 465/1413 (32.91%), Postives = 612/1413 (43.31%), Query Frame = 1
Query:  244 GIPGPKGD--------YGRIGNPGPIGP------------------KGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGD---SGDEGLQGEKGISGSKGVKGERGPSGRPTT------GLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGE---------KGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGD--------EGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG--------------LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGE---SGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGE---------PGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQ--GINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETK-GQRGEKGNMGVIGN------------VGAKGEL-------------GEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVG--------PQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMG---APGKVGIKGEQGLEGLPGKIGRMGDKGKPG-------NGIEGPDGDIGNKGR 4092
            G+PGPKGD        Y  IG PG  G                   KGY G  G+ G +G  G+ G+ G++GLPG RGE G  G  G  G  G+ G FGD+G  G PG  G +G            L G  G +G+ G+ G PG   Q   G  G      +    G  G  G  G  G+QG  G+ G  G +GPIG++G+ GD        G  G  GP G +                +RG++G+ G  G  G  G  G  G PG  G  G+ GQ      VG +G PG  GQPG +G +G RG  G+ G                  ++G  GE       G  I    G QGP G +G  G+ G  G +G  GEKG +G   P          C  G RG  G +G+ G  G+HG RG  G  G            + V+G++G+   +G +GL G  GI G  G  G  GP G+         G +G  G  G +G +G DG+ G+ G  G KG  G   +               +G+ G  G  GRDG PG      R G DGA GR  +   +   G PG  GIKG +GD  +  F  +KGE          G+ G DG  GPKG+KG+ G  G  G+ G++G  G  G+        +G PG  G  G+ G  G  G D +P + G  G +G++G+   +  +GE G  G   I           GD G  G+ GL G  G  GVKG+QG  G+                         G  G+PG +GQ G               +G +   G +G KG++G  G++G  G  G+IG  G  G+ GN G +G  G  G+ GLPG+ G+IG +GE   +G QGDIG  GP G  G KG +G  GP G     G+ G  GE         PG +G+  ++G  GD GE    G  G  G  G KG+RG  G+    ++G  G  G +G  G NG  G  GL G +G+ G+ G +G  G+PG  G  G  G  GING+KG  G  G +G  GP+G+ G  GL+ + GQ G++G  G+IG             VG  G L             G+ G++G +G+ G+ G    IG  G  G  G+ G  GQ G +G                                                    +G KG  G  G +G  GITL  E G  G  G                  L GR G  G  G+KG  G  GE GP G +G        P G QG  G  G+ G  G  G  G  G+ G++G +G +G SG    GR G+ G++G    PG  G KGEQG  GLPGK GR+G  G  G        GI+G DG +G KG+
Sbjct:  209 GLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADG------------LDGSPGERGEDGFTGMPG--VQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGD-------PGLNGSRGPPGRS----------------ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPG------------------DKGLPGE-------GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCP---------VCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGP-----------RGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQ---------------RGDYGDAGYQGRDGEPG------RDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFP-------GDVGAPGQYGLAGRPGPKGVKGEQGPDGAV------------------------GQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDG---------------------------------------------------AEGLKGFQGDQGPRGPPGITLPAEKGDEGVAG------------------LDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQ 1414          

HSP 2 Score: 219.164 bits (557), Expect = 8.481e-57
Identity = 207/634 (32.65%), Postives = 274/634 (43.22%), Query Frame = 1
Query: 3568 LSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNT-----------GSKGETGPKGDFGEDGDKG---NVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN------GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQ--NVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGG-GQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
              G +G++GL G    +G+ GPIG  GP G                   +G  GDIG  G  G  G  G KG  G QG +GP G T           G  G  G  G FG+ G  G     GP G  G  GP  QG  G +G++G PG  G  G  GL G  G++G MG +G+ G       G +G  GDIG +G  G  G KGE G  G  G++GR GA G                                   GP GD G  GI G+ G  G  G  G+  +  +      G          E   G  G IG  G  G VG +GD GE    G  G +G++G  GY G   G  G +G  GPQG                                 F+F RH Q+    P CP  +N ++EGYS             +LG   SC+  F  MP+  C     C      D S WL++  P+   M  +Q  ++ KYISRCV CE+     A HSQ+ ++ D  CP  W E+W GYS+ M T    GG GQ+L SPGSCL  FR  P++EC +G  RCN++    S++L  ++   +F  P+ + +KA+         ++SRC VC ++
Sbjct: 1186 YRGFTGDQGLQGERGEQGDMGPIGFIGPPGA------------------KGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPG---------------------------------PRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLT-GAPGLRGLPGPQGEPAPAPPAPKSRG--------------------FIFARHSQS-VHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPD--CPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIEC-HGHGRCNYYDALASFWLTVIEEQDQFVQPRQQTLKAD------FTSKISRCTVCRRR 1737          

HSP 3 Score: 213.386 bits (542), Expect = 6.228e-55
Identity = 412/1204 (34.22%), Postives = 528/1204 (43.85%), Query Frame = 1
Query:  214 VCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGE------KGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKL-FVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTV------------KGIKGDSGDE--GLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGE----------------KGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGR---PGNDGAIGREGSYGDIGDRGLPGDKGIKGAKG-------DSREETFPSIK----------GEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVK--PLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS--------DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDG------EKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-------IGIKGNEGSRGEEGETGMRGLPG--------------------------------ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGD------KGESGMIGRTGENGEKGDQGLNGPKGNV---GVIGDRGETGKPGPIGPDGATGPKG-----------INGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-------GQKGES------GSNGEFGSKGQKGM 3390
            +C    C C GI G  G  G IG PG  GP G  G  G  G  G  GD G  G+ G  G RG+                   G +G++G PG  G +GE      +G DG  G+ G+ G  G  G  G  G PG   Q     +   G   S G KG +G  G+ G  G  G  G RG  GD G  G++GE          KG+ G PGP GD G   +L + L G  PP  +G+ G+   G  K    LKG  G  GL G  G +G  G+ G VG  G PG +G+ G  G +G  G DG  G  G +G KG  G  G DG  GS GE GE G +G  +  +QG  GP G       + +PG  G+ G+ G  G  GP G  G  G      +RG IG  G++G+ G +G RG  G +                             G+ G+ G    G +GE G++G  G++G RG  G    GL G KG  GE                +GL G DG NG  G  G KGL G  C +C            N G +G  G  G  G PG  G+RG     G  G  G +G+ G  G +GLPG  GI G  G       D +     S++          G +GD G DG++G  G  GS G  G+ G  GD G  G +G +G PG  G  G  G   T             L GE G    DG KGE+GD G+     VK  P       + G+ GE G  GP G  G KG+QGA G                G  G  G  G  G  G  G PG+PG+ G+ GLDG      ++G  G + ++G+IG  GRSG KG  G +G PG        G KG +G +G +G  G  GLPG                                  G++G+ G++G+ G  G+ G  G +G+ GN             G++G  G PG+ GL G  GE G++GE    G  G +GD+GP+G  G  G +G++GD       G +G+ GR GE G  G  G  G KG     G+ GD GE+G  GPIG  GA G KG           ++G+ G +G +G  G NG  G  G KG   +G RG  G  G  G  GAKG  G PG  G  G  G TG        G +GES      G NG+ G +G +G+
Sbjct:   32 ICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGD------------------IGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGE----------KGDPGLPGPKGDTGAVSELPYSLIG--PPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTG--MPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPG------RRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGE--VGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVC------------NAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVY--------LIGEPGY---DGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNA------------GLQGLPGSPGIPGLPGMIGEIGERGEI---GYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG--QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL 1155          

HSP 4 Score: 203.756 bits (517), Expect = 5.099e-52
Identity = 380/1088 (34.93%), Postives = 493/1088 (45.31%), Query Frame = 1
Query:  985 DRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEA-GGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGP---------KGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISG---DMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGE-----------------SGMIGRTGENGEKGDQGLNGPKGNVGV---IGDRGETGKPG------PIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGEL--------------GEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQ-----------GDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKG---EQGLEGLPGKIGRMGDKG 4038
            DRG KGDTG  G  G    KG PG  G KG  G+   + +  +                G+KGE G++  G  K    ++G +G  G +GD+G QG  G QG +G  G                  LPG RG+IG  GE G+ G  G  G FG                          D+G++G  G +G+ G+ G                G +GE G +G+ G  G  GP         K + G +G+   +   G+ G  G+ G  G +G  GLAG+ G+PG+ G RG PG               +RG  GD G  G  G         + G  G +G  G+    G KG PGLNG+PG+ G   D G++G+ GD+G PG                     +G  G  G  G++ + GEKG +GD  +C +    P      G  GDTG PG  G  G +G+ G +G +G  G  G+ G  G PG           G+PG PGK G +G DG+  ++G+   KG+IGD G SG +GDTG  G    G  G++GS+GE GETG RG      D G+ G  G  G+ G  G  G  G    T K   +G+    GIKG+ G+ G  G KG  GE          GE GE G  GPKG +G KGEQG  G +GE                  G  G TG+ G++G  GL G  G  G+   IG +G+ G PG       IGP G +G KG  G  G  G  G+ G  GPKG +GE+G +     G  G  G+ GN G +G+               G     G+KG  GE G +GQ G++G+ G  G  G++G+ G  G  G  G  G  GL G+      IGEIG RG+IG  G  G  G RG  G+ GPKGLSG  G  G  G   L G  G  G+ G  G  G  G     G KG  G  G  G IG  G  G KG+ GP G+  P            G  GP G  G  G  G +GD G  G +G  G  G KGL G P + G +G +G  G PG  G KG   E G+ GL G+ G++GD+G
Sbjct:  189 DRGSKGDTGYAGLTGE---KGDPGLPGPKGDTGAVSELPYSLIGPP-------------GAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNG------------------LPGARGEIGGPGERGKPGKDGEPGRFG--------------------------DKGMKGAPGWTGADGLDGS--------------PGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRS-------------ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPG----FRGLPGDDGYNGLRGLPGEKGLRGD--DCPVCNAGPRGPR--GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPA---------GIPGEPGKVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGE--KGRDGSDGSKGERGETGQRG------DYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPD-----GAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGM------IGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQG 1151          

HSP 5 Score: 199.134 bits (505), Expect = 1.361e-50
Identity = 449/1388 (32.35%), Postives = 572/1388 (41.21%), Query Frame = 1
Query:  241 VGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDG------------------------LPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGK--MGLSGD---------------KGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD------------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGI---SGSKGVKGERGP------SGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGE---RGLQGEKGIKPIDGEKGEKGDSGNCTINFVK--------PLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKG---------------ERGIKGE-QGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGP--KGDQGEKGLETKGQR-------------GEKGNMGVIGNVGAK-----GELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGP-----------QGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIG 4020
            +G PG +G  G+ G PG  G KG  G  G  GA GL G  G  G+DG                        LPG  G  GD G PG  G PG  G  G RG +GL G +G  G  G+ G  G+   G +GD                G+ G  G  GEPG      KGE G                     ++G  G +G RGD G+ G  G  G PG+                   P      G +G PG  G  G DC +     + P  Q GD+                        G  G  G +G  G  G RG  G +G PG  G KG+ G  G+ G                       G+VG AG  GK I      +G  GD GD G++G  G  G  G  G  G                 G+RG+ G +G+ G++G  G  G+ G +G  G  G      K    + G+ G +G++GE+G    +G KGVKGE  P      +G P   G  GPKG KG KG  G  G  G++G +G  G +         G  G  G  G+ G++G  GL GRDG PG+ G  G  G  G  G+E   G+IG    PG  GIKG         FP   G  G  G  G+ GPKG+KG  G +G  G +G  G  G +GD                      AK  +GE    G  G+ G K   G  G +G  GN  +  +         P    E+G+RG+ G  G QG IG  G  G+ G KG  G  G  G PG  G  G KG  G  G PG PG +G +   G KGD G  G+ G IG  G  GAKG  G +G+    + G  G +GE G  G  GLPG  G  G +G+ G  G  G  G  G KG+ G  G+ G      I G+KG +G PG QG KG  GESG  G     G  G+ GD GP+G               E GI G  + +       G  G  G  GE+G+QG  GP G +G  G +GE G  G  G  G  G +G+ G +G+QG  G  G   P  KGD+G  GL+ +  R             GE G  G IG+ G +     G  G+ G  G+ G NG  G IG KGE G  G  G +G+ G                     + G +GDIG+IG                       G  G  G  GE+G  G  L G++G +G  GP                     +G  GD G  G  G+ G +GPKG  G            +G+ G  G  G +G+ G  G  G  G +G VG +G++G  G    G  G +G+ G  G +G+ G  GL GLPG  G
Sbjct:  288 IGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPG---------------------LNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDT------------------------GYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPG---------------------EPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSK---------------GERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVY--LIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPG----PVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGP---PGRSGIKG---------FPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNG------INGLKGATGFPGPQGPKGPQGESGVVGL---DGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGY-------------------AIVGRQGDIGDIGF---------------------QGEPGWDGAKGEQGYPG--LPGKNGRVGAPGP---------------------RGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVG--YTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 6 Score: 172.17 bits (435), Expect = 2.255e-42
Identity = 399/1228 (32.49%), Postives = 525/1228 (42.75%), Query Frame = 1
Query: 1222 GPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMG---KMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPG------------LQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFD-----GVPGIPGKRGQSGLD-----GEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGN---------EGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGP-----------KGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGIN---GIKGEQGMMGVKGNNGPKGDQGEKGL----------ETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGI----TLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGD-----------------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGD------IGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQGAR 4617
            GP G  G +G  G+ G PG  G LGEKG                       G+ G++GE G  G  GP+G+ G+                  GI G SG+ G  G +GI G  G  G +GPSG P   G+ GP G  G++G  G +   G +  KG KG  G   +    G  G  G +G++G+ G  GL G  G+PG+ G +G   + GA+  E  Y  IG  G  G+ G   +     ++T    KG  G  G +G +GP G +G+ G NG PG  G++G   + G  G +G PG  G KG  G  G  G D   + G  G +GE G   + G +G  G  G    +  K L    +G +GD G PG             +GPIG  G  GD G  GS G  G+  +        +            G+PG  G  G+ G +     GE G  G  G++G  GD+G  G  GD G  G  G  I G           G  G++G  G+RGLPG       +G  G+   + N GP+G +G +G+TG PG  G++   G+ G  G  G+QG  G  G  G  G     GE G+ G  GP           KGE G  G+ G  GD G+ G  GR G +G KG++G  G +G+ G  G +G  G+PG  G DGA G         + GE G  G+KG  G  GD G KG+          +  G+ GE G  G  G  GAKGE G  G+RG  GD G  G      +G KG  G  G++G +G  G+ G                                                   +DG  GL G  G KG  G+     ++GE GP G +G     G PGD G  G  GL GR G +G  GE+G  G  G+ G  GN G +GD                 Q P G  G KGE G  G  G++G KG++G  G +GL G    QG  G+ G  G PG +G  GE+G  G  G+ G +G +G  G  G +G  GD G  G  G  G+ G  GE G  G  GR GAK                                          G+    G++G  GE G TG +G  G  G +G  G  G      +   G +GE+G PG        G  G +GD G P  +G  G  G +GL GY G+    G+ G  G  GPQG +
Sbjct:   51 GPIGVPGLEGPAGDIGPPGRAGPLGEKG---------------------DVGEYGEQGEKGHRGDIGPKGEMGY-----------------PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPG-EAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKG---DTGAV-SELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADG--LDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGP-IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE-GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG------EKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPG---------------------------------------------------RDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSG---IKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAK------------------------------------------GVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPK 1129          

HSP 7 Score: 154.451 bits (389), Expect = 5.244e-37
Identity = 291/925 (31.46%), Postives = 385/925 (41.62%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGN--PGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDV--------------GDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLL---------------GTACKL-------CXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG------RPGNDGAIGREGSYGDIGDRG-----LPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGS--PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGE 2856
             +G+ G  GD G  G   PGP+G KGY G  G+ G +G  G  G +G+ GL G                       G +G  G+PG     GE G  G +G  G  GD G  G  G  G PG   +  KGE+G                 G  G  G  G+KG RGD               G Q P G  G+ G+    + Q G+ G  G IG +G    L     +  P   G                      PGL G +G+ G++G+ G  G +G  GP+G  G  G KG+ G DG  G+ G  G              G KGE G  G  G+     +    G  GD G+ G  G  GY G  G KG +G  G + P  D     + G++G++G  G NG  G HG +G  G               + + G +G  G+ G +G  G  G  G+ G +G +G P  G  GPKGP+GE G+ GLDG+NG++G +G +GL+               G   +L         +G  G++G++G +GE+G  G  G  G PG +G+RG      + G DGA G +G  GD G RG     LP +KG +G  G       P   G+KG  GP G+ GP G  G   P + G PG  GD+G  G  G                            G  GL G KG     G +GE+G+SG   +           G +GD G+ G QG  G  G KG+QG                               PG+PGK G+ G  G +G  G+ G  G  G  G  G KG       PG+    +    G+ GE G+ G  G  GD G  G  G QG  G  G +G +G  G TG  GP G +  KG  G +G PG++GL G  GE
Sbjct:  744 AIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGG---------------------IGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGP--KGVKGEQG---------------PDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEV-GSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPG---------------------IPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLP------------GRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDG----VAGRKGEVGSPGPNGLPGRHGLKGQRG--------------DRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFP--GPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGH--------------------------NGRHGLIGPKGELGDMGRQGERGESGYAIV-----------GRQGDIGDIGFQGEPGWDGAKGEQG------------------------------YPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKG------QPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 8 Score: 130.954 bits (328), Expect = 7.340e-30
Identity = 304/854 (35.60%), Postives = 382/854 (44.73%), Query Frame = 1
Query: 1906 KGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQ-----GPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGV------PGIPGKRGQSGLDGE--KGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSR---GEEGETGMRGLPGITGDIGNQGE---SGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDV------------------GPKGERGIKGEQGINGDKG--------------------------ESGMIGRTGENGE--------KGDQGLNGPKGNVGVIGDRGETGKPGPIGPD-------------------GATGPKGINGIKGEQGMMGVKG------NNGPKGDQGEKG-LETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNG---EFGS--KGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGIS------GEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGN-----TGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----QQGRSGN---RGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKG 4089
            KGIKG  G       P ++G  GD GP G+ GP G KG  G  G+ G  G  G +G KG+ G PG+ G                   GE G  G +GI   DG  G +G SG    N V          RG  G+PG Q        G +  KG +G +G  G  G  G PG  G++G KG  G+ G+      PG+PG +G +G   E     IG  G KG+ GD      K D    G  G +G++G+EG +   GE+G  G  GLPG  G+IG  GE    G+ G+ G FG KG KG  G TG  G  G    +G  G +G PGVQG  G  G        S  G  G +GD+                  GP G  G  G+ G+NG +G                          E+G+ GR G +GE        KG+ GLNG  G  G  GDRGE G PG  G                     G  G  G NG++G  G  G++G      N GP+G +G++G     G  G +G +G+ G  G +G  G PG  G KG  G  GI    G+ G +G +G   E GS  KG+ G  G+ G  G  G  G  G  G  G KG+ GE G RG  G  G  G+ GE G  G+DG  G +  +      GE G  GI  KGE G  GD G  G  G P         G PG  G  G  G KG KG +G +G +G +   GD+GP G       G+KG  GP GD+G+ G  G  G  G  GL G      Q+G  G    +GE+G PG+ GIKG  G  G PG+ G  G  G  G  G +GPDG +G  G
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGK-----------------SGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGV----------RGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGI--KGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEI---GDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG 862          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 241.891 bits (616), Expect = 1.037e-63
Identity = 465/1413 (32.91%), Postives = 612/1413 (43.31%), Query Frame = 1
Query:  244 GIPGPKGD--------YGRIGNPGPIGP------------------KGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGD---SGDEGLQGEKGISGSKGVKGERGPSGRPTT------GLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGE---------KGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGD--------EGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG--------------LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGE---SGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGE---------PGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQ--GINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETK-GQRGEKGNMGVIGN------------VGAKGEL-------------GEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVG--------PQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMG---APGKVGIKGEQGLEGLPGKIGRMGDKGKPG-------NGIEGPDGDIGNKGR 4092
            G+PGPKGD        Y  IG PG  G                   KGY G  G+ G +G  G+ G+ G++GLPG RGE G  G  G  G  G+ G FGD+G  G PG  G +G            L G  G +G+ G+ G PG   Q   G  G      +    G  G  G  G  G+QG  G+ G  G +GPIG++G+ GD        G  G  GP G +                +RG++G+ G  G  G  G  G  G PG  G  G+ GQ      VG +G PG  GQPG +G +G RG  G+ G                  ++G  GE       G  I    G QGP G +G  G+ G  G +G  GEKG +G   P          C  G RG  G +G+ G  G+HG RG  G  G            + V+G++G+   +G +GL G  GI G  G  G  GP G+         G +G  G  G +G +G DG+ G+ G  G KG  G   +               +G+ G  G  GRDG PG      R G DGA GR  +   +   G PG  GIKG +GD  +  F  +KGE          G+ G DG  GPKG+KG+ G  G  G+ G++G  G  G+        +G PG  G  G+ G  G  G D +P + G  G +G++G+   +  +GE G  G   I           GD G  G+ GL G  G  GVKG+QG  G+                         G  G+PG +GQ G               +G +   G +G KG++G  G++G  G  G+IG  G  G+ GN G +G  G  G+ GLPG+ G+IG +GE   +G QGDIG  GP G  G KG +G  GP G     G+ G  GE         PG +G+  ++G  GD GE    G  G  G  G KG+RG  G+    ++G  G  G +G  G NG  G  GL G +G+ G+ G +G  G+PG  G  G  G  GING+KG  G  G +G  GP+G+ G  GL+ + GQ G++G  G+IG             VG  G L             G+ G++G +G+ G+ G    IG  G  G  G+ G  GQ G +G                                                    +G KG  G  G +G  GITL  E G  G  G                  L GR G  G  G+KG  G  GE GP G +G        P G QG  G  G+ G  G  G  G  G+ G++G +G +G SG    GR G+ G++G    PG  G KGEQG  GLPGK GR+G  G  G        GI+G DG +G KG+
Sbjct:  209 GLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADG------------LDGSPGERGEDGFTGMPG--VQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGD-------PGLNGSRGPPGRS----------------ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGLEGYRGDRGEVGLPG------------------DKGLPGE-------GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCP---------VCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGP-----------RGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQ---------------RGDYGDAGYQGRDGEPG------RDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFP-------GDVGAPGQYGLAGRPGPKGVKGEQGPDGAV------------------------GQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDG---------------------------------------------------AEGLKGFQGDQGPRGPPGITLPAEKGDEGVAG------------------LDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQ 1414          

HSP 2 Score: 219.164 bits (557), Expect = 8.481e-57
Identity = 207/634 (32.65%), Postives = 274/634 (43.22%), Query Frame = 1
Query: 3568 LSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNT-----------GSKGETGPKGDFGEDGDKG---NVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN------GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQ--NVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGG-GQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
              G +G++GL G    +G+ GPIG  GP G                   +G  GDIG  G  G  G  G KG  G QG +GP G T           G  G  G  G FG+ G  G     GP G  G  GP  QG  G +G++G PG  G  G  GL G  G++G MG +G+ G       G +G  GDIG +G  G  G KGE G  G  G++GR GA G                                   GP GD G  GI G+ G  G  G  G+  +  +      G          E   G  G IG  G  G VG +GD GE    G  G +G++G  GY G   G  G +G  GPQG                                 F+F RH Q+    P CP  +N ++EGYS             +LG   SC+  F  MP+  C     C      D S WL++  P+   M  +Q  ++ KYISRCV CE+     A HSQ+ ++ D  CP  W E+W GYS+ M T    GG GQ+L SPGSCL  FR  P++EC +G  RCN++    S++L  ++   +F  P+ + +KA+         ++SRC VC ++
Sbjct: 1186 YRGFTGDQGLQGERGEQGDMGPIGFIGPPGA------------------KGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPG---------------------------------PRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLT-GAPGLRGLPGPQGEPAPAPPAPKSRG--------------------FIFARHSQS-VHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPD--CPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIEC-HGHGRCNYYDALASFWLTVIEEQDQFVQPRQQTLKAD------FTSKISRCTVCRRR 1737          

HSP 3 Score: 213.386 bits (542), Expect = 6.228e-55
Identity = 412/1204 (34.22%), Postives = 528/1204 (43.85%), Query Frame = 1
Query:  214 VCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGE------KGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKL-FVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTV------------KGIKGDSGDE--GLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGE----------------KGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGR---PGNDGAIGREGSYGDIGDRGLPGDKGIKGAKG-------DSREETFPSIK----------GEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVK--PLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS--------DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDG------EKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-------IGIKGNEGSRGEEGETGMRGLPG--------------------------------ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGD------KGESGMIGRTGENGEKGDQGLNGPKGNV---GVIGDRGETGKPGPIGPDGATGPKG-----------INGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-------GQKGES------GSNGEFGSKGQKGM 3390
            +C    C C GI G  G  G IG PG  GP G  G  G  G  G  GD G  G+ G  G RG+                   G +G++G PG  G +GE      +G DG  G+ G+ G  G  G  G  G PG   Q     +   G   S G KG +G  G+ G  G  G  G RG  GD G  G++GE          KG+ G PGP GD G   +L + L G  PP  +G+ G+   G  K    LKG  G  GL G  G +G  G+ G VG  G PG +G+ G  G +G  G DG  G  G +G KG  G  G DG  GS GE GE G +G  +  +QG  GP G       + +PG  G+ G+ G  G  GP G  G  G      +RG IG  G++G+ G +G RG  G +                             G+ G+ G    G +GE G++G  G++G RG  G    GL G KG  GE                +GL G DG NG  G  G KGL G  C +C            N G +G  G  G  G PG  G+RG     G  G  G +G+ G  G +GLPG  GI G  G       D +     S++          G +GD G DG++G  G  GS G  G+ G  GD G  G +G +G PG  G  G  G   T             L GE G    DG KGE+GD G+     VK  P       + G+ GE G  GP G  G KG+QGA G                G  G  G  G  G  G  G PG+PG+ G+ GLDG      ++G  G + ++G+IG  GRSG KG  G +G PG        G KG +G +G +G  G  GLPG                                  G++G+ G++G+ G  G+ G  G +G+ GN             G++G  G PG+ GL G  GE G++GE    G  G +GD+GP+G  G  G +G++GD       G +G+ GR GE G  G  G  G KG     G+ GD GE+G  GPIG  GA G KG           ++G+ G +G +G  G NG  G  G KG   +G RG  G  G  G  GAKG  G PG  G  G  G TG        G +GES      G NG+ G +G +G+
Sbjct:   32 ICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGD------------------IGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGE----------KGDPGLPGPKGDTGAVSELPYSLIG--PPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTG--MPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPG------RRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGE--VGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVC------------NAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVY--------LIGEPGY---DGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNA------------GLQGLPGSPGIPGLPGMIGEIGERGEI---GYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG--QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL 1155          

HSP 4 Score: 203.756 bits (517), Expect = 5.099e-52
Identity = 380/1088 (34.93%), Postives = 493/1088 (45.31%), Query Frame = 1
Query:  985 DRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEA-GGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGP---------KGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISG---DMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGE-----------------SGMIGRTGENGEKGDQGLNGPKGNVGV---IGDRGETGKPG------PIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGEL--------------GEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQ-----------GDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKG---EQGLEGLPGKIGRMGDKG 4038
            DRG KGDTG  G  G    KG PG  G KG  G+   + +  +                G+KGE G++  G  K    ++G +G  G +GD+G QG  G QG +G  G                  LPG RG+IG  GE G+ G  G  G FG                          D+G++G  G +G+ G+ G                G +GE G +G+ G  G  GP         K + G +G+   +   G+ G  G+ G  G +G  GLAG+ G+PG+ G RG PG               +RG  GD G  G  G         + G  G +G  G+    G KG PGLNG+PG+ G   D G++G+ GD+G PG                     +G  G  G  G++ + GEKG +GD  +C +    P      G  GDTG PG  G  G +G+ G +G +G  G  G+ G  G PG           G+PG PGK G +G DG+  ++G+   KG+IGD G SG +GDTG  G    G  G++GS+GE GETG RG      D G+ G  G  G+ G  G  G  G    T K   +G+    GIKG+ G+ G  G KG  GE          GE GE G  GPKG +G KGEQG  G +GE                  G  G TG+ G++G  GL G  G  G+   IG +G+ G PG       IGP G +G KG  G  G  G  G+ G  GPKG +GE+G +     G  G  G+ GN G +G+               G     G+KG  GE G +GQ G++G+ G  G  G++G+ G  G  G  G  G  GL G+      IGEIG RG+IG  G  G  G RG  G+ GPKGLSG  G  G  G   L G  G  G+ G  G  G  G     G KG  G  G  G IG  G  G KG+ GP G+  P            G  GP G  G  G  G +GD G  G +G  G  G KGL G P + G +G +G  G PG  G KG   E G+ GL G+ G++GD+G
Sbjct:  189 DRGSKGDTGYAGLTGE---KGDPGLPGPKGDTGAVSELPYSLIGPP-------------GAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNG------------------LPGARGEIGGPGERGKPGKDGEPGRFG--------------------------DKGMKGAPGWTGADGLDGS--------------PGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRS-------------ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPG----FRGLPGDDGYNGLRGLPGEKGLRGD--DCPVCNAGPRGPR--GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPA---------GIPGEPGKVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGE--KGRDGSDGSKGERGETGQRG------DYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPD-----GAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGM------IGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQG 1151          

HSP 5 Score: 199.134 bits (505), Expect = 1.361e-50
Identity = 449/1388 (32.35%), Postives = 572/1388 (41.21%), Query Frame = 1
Query:  241 VGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDG------------------------LPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGK--MGLSGD---------------KGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD------------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGI---SGSKGVKGERGP------SGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGE---RGLQGEKGIKPIDGEKGEKGDSGNCTINFVK--------PLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKG---------------ERGIKGE-QGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGP--KGDQGEKGLETKGQR-------------GEKGNMGVIGNVGAK-----GELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGP-----------QGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIG 4020
            +G PG +G  G+ G PG  G KG  G  G  GA GL G  G  G+DG                        LPG  G  GD G PG  G PG  G  G RG +GL G +G  G  G+ G  G+   G +GD                G+ G  G  GEPG      KGE G                     ++G  G +G RGD G+ G  G  G PG+                   P      G +G PG  G  G DC +     + P  Q GD+                        G  G  G +G  G  G RG  G +G PG  G KG+ G  G+ G                       G+VG AG  GK I      +G  GD GD G++G  G  G  G  G  G                 G+RG+ G +G+ G++G  G  G+ G +G  G  G      K    + G+ G +G++GE+G    +G KGVKGE  P      +G P   G  GPKG KG KG  G  G  G++G +G  G +         G  G  G  G+ G++G  GL GRDG PG+ G  G  G  G  G+E   G+IG    PG  GIKG         FP   G  G  G  G+ GPKG+KG  G +G  G +G  G  G +GD                      AK  +GE    G  G+ G K   G  G +G  GN  +  +         P    E+G+RG+ G  G QG IG  G  G+ G KG  G  G  G PG  G  G KG  G  G PG PG +G +   G KGD G  G+ G IG  G  GAKG  G +G+    + G  G +GE G  G  GLPG  G  G +G+ G  G  G  G  G KG+ G  G+ G      I G+KG +G PG QG KG  GESG  G     G  G+ GD GP+G               E GI G  + +       G  G  G  GE+G+QG  GP G +G  G +GE G  G  G  G  G +G+ G +G+QG  G  G   P  KGD+G  GL+ +  R             GE G  G IG+ G +     G  G+ G  G+ G NG  G IG KGE G  G  G +G+ G                     + G +GDIG+IG                       G  G  G  GE+G  G  L G++G +G  GP                     +G  GD G  G  G+ G +GPKG  G            +G+ G  G  G +G+ G  G  G  G +G VG +G++G  G    G  G +G+ G  G +G+ G  GL GLPG  G
Sbjct:  288 IGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPG---------------------LNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDT------------------------GYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPG---------------------EPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSK---------------GERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVY--LIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPG----PVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGP---PGRSGIKG---------FPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNG------INGLKGATGFPGPQGPKGPQGESGVVGL---DGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGY-------------------AIVGRQGDIGDIGF---------------------QGEPGWDGAKGEQGYPG--LPGKNGRVGAPGP---------------------RGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVG--YTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 6 Score: 172.17 bits (435), Expect = 2.255e-42
Identity = 399/1228 (32.49%), Postives = 525/1228 (42.75%), Query Frame = 1
Query: 1222 GPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMG---KMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPG------------LQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFD-----GVPGIPGKRGQSGLD-----GEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGN---------EGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGP-----------KGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGIN---GIKGEQGMMGVKGNNGPKGDQGEKGL----------ETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGI----TLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGD-----------------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGD------IGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQGAR 4617
            GP G  G +G  G+ G PG  G LGEKG                       G+ G++GE G  G  GP+G+ G+                  GI G SG+ G  G +GI G  G  G +GPSG P   G+ GP G  G++G  G +   G +  KG KG  G   +    G  G  G +G++G+ G  GL G  G+PG+ G +G   + GA+  E  Y  IG  G  G+ G   +     ++T    KG  G  G +G +GP G +G+ G NG PG  G++G   + G  G +G PG  G KG  G  G  G D   + G  G +GE G   + G +G  G  G    +  K L    +G +GD G PG             +GPIG  G  GD G  GS G  G+  +        +            G+PG  G  G+ G +     GE G  G  G++G  GD+G  G  GD G  G  G  I G           G  G++G  G+RGLPG       +G  G+   + N GP+G +G +G+TG PG  G++   G+ G  G  G+QG  G  G  G  G     GE G+ G  GP           KGE G  G+ G  GD G+ G  GR G +G KG++G  G +G+ G  G +G  G+PG  G DGA G         + GE G  G+KG  G  GD G KG+          +  G+ GE G  G  G  GAKGE G  G+RG  GD G  G      +G KG  G  G++G +G  G+ G                                                   +DG  GL G  G KG  G+     ++GE GP G +G     G PGD G  G  GL GR G +G  GE+G  G  G+ G  GN G +GD                 Q P G  G KGE G  G  G++G KG++G  G +GL G    QG  G+ G  G PG +G  GE+G  G  G+ G +G +G  G  G +G  GD G  G  G  G+ G  GE G  G  GR GAK                                          G+    G++G  GE G TG +G  G  G +G  G  G      +   G +GE+G PG        G  G +GD G P  +G  G  G +GL GY G+    G+ G  G  GPQG +
Sbjct:   51 GPIGVPGLEGPAGDIGPPGRAGPLGEKG---------------------DVGEYGEQGEKGHRGDIGPKGEMGY-----------------PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPG-EAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKG---DTGAV-SELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADG--LDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGP-IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE-GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG------EKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPG---------------------------------------------------RDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSG---IKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAK------------------------------------------GVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPK 1129          

HSP 7 Score: 154.451 bits (389), Expect = 5.244e-37
Identity = 291/925 (31.46%), Postives = 385/925 (41.62%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGN--PGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDV--------------GDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLL---------------GTACKL-------CXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG------RPGNDGAIGREGSYGDIGDRG-----LPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGS--PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGE 2856
             +G+ G  GD G  G   PGP+G KGY G  G+ G +G  G  G +G+ GL G                       G +G  G+PG     GE G  G +G  G  GD G  G  G  G PG   +  KGE+G                 G  G  G  G+KG RGD               G Q P G  G+ G+    + Q G+ G  G IG +G    L     +  P   G                      PGL G +G+ G++G+ G  G +G  GP+G  G  G KG+ G DG  G+ G  G              G KGE G  G  G+     +    G  GD G+ G  G  GY G  G KG +G  G + P  D     + G++G++G  G NG  G HG +G  G               + + G +G  G+ G +G  G  G  G+ G +G +G P  G  GPKGP+GE G+ GLDG+NG++G +G +GL+               G   +L         +G  G++G++G +GE+G  G  G  G PG +G+RG      + G DGA G +G  GD G RG     LP +KG +G  G       P   G+KG  GP G+ GP G  G   P + G PG  GD+G  G  G                            G  GL G KG     G +GE+G+SG   +           G +GD G+ G QG  G  G KG+QG                               PG+PGK G+ G  G +G  G+ G  G  G  G  G KG       PG+    +    G+ GE G+ G  G  GD G  G  G QG  G  G +G +G  G TG  GP G +  KG  G +G PG++GL G  GE
Sbjct:  744 AIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGG---------------------IGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGP--KGVKGEQG---------------PDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEV-GSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPG---------------------IPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLP------------GRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDG----VAGRKGEVGSPGPNGLPGRHGLKGQRG--------------DRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFP--GPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGH--------------------------NGRHGLIGPKGELGDMGRQGERGESGYAIV-----------GRQGDIGDIGFQGEPGWDGAKGEQG------------------------------YPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKG------QPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 8 Score: 130.954 bits (328), Expect = 7.340e-30
Identity = 304/854 (35.60%), Postives = 382/854 (44.73%), Query Frame = 1
Query: 1906 KGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQ-----GPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGV------PGIPGKRGQSGLDGE--KGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSR---GEEGETGMRGLPGITGDIGNQGE---SGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDV------------------GPKGERGIKGEQGINGDKG--------------------------ESGMIGRTGENGE--------KGDQGLNGPKGNVGVIGDRGETGKPGPIGPD-------------------GATGPKGINGIKGEQGMMGVKG------NNGPKGDQGEKG-LETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNG---EFGS--KGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGIS------GEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGN-----TGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----QQGRSGN---RGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKG 4089
            KGIKG  G       P ++G  GD GP G+ GP G KG  G  G+ G  G  G +G KG+ G PG+ G                   GE G  G +GI   DG  G +G SG    N V          RG  G+PG Q        G +  KG +G +G  G  G  G PG  G++G KG  G+ G+      PG+PG +G +G   E     IG  G KG+ GD      K D    G  G +G++G+EG +   GE+G  G  GLPG  G+IG  GE    G+ G+ G FG KG KG  G TG  G  G    +G  G +G PGVQG  G  G        S  G  G +GD+                  GP G  G  G+ G+NG +G                          E+G+ GR G +GE        KG+ GLNG  G  G  GDRGE G PG  G                     G  G  G NG++G  G  G++G      N GP+G +G++G     G  G +G +G+ G  G +G  G PG  G KG  G  GI    G+ G +G +G   E GS  KG+ G  G+ G  G  G  G  G  G  G KG+ GE G RG  G  G  G+ GE G  G+DG  G +  +      GE G  GI  KGE G  GD G  G  G P         G PG  G  G  G KG KG +G +G +G +   GD+GP G       G+KG  GP GD+G+ G  G  G  G  GL G      Q+G  G    +GE+G PG+ GIKG  G  G PG+ G  G  G  G  G +GPDG +G  G
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGK-----------------SGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGV----------RGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGI--KGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEI---GDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG 862          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Zebrafish
Match: col4a5 (collagen, type IV, alpha 5 (Alport syndrome) [Source:ZFIN;Acc:ZDB-GENE-030131-2281])

HSP 1 Score: 223.787 bits (569), Expect = 3.703e-58
Identity = 102/232 (43.97%), Postives = 139/232 (59.91%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEV--QNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            FL TRH Q  E  P CP G++ I+EGYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+   M  +  +N++ YISRC  CE+PA   A HSQT  L    CPE+W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  VD    F  P+ + +KA      N+   +SRC VCMK+
Sbjct: 1436 FLITRHSQTIE-VPSCPDGTSPIYEGYSLLYVQGNERAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPQPMPMTMAPITGENIKPYISRCSVCEAPAMVIAVHSQTIQLP--ACPENWDTLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYGNSYSFWLATVDVNEMFRKPQSETLKA-----GNLRTRVSRCVVCMKR 1658          

HSP 2 Score: 119.783 bits (299), Expect = 2.322e-26
Identity = 185/553 (33.45%), Postives = 237/553 (42.86%), Query Frame = 1
Query: 1846 GAIGREGSYGDIGDRGLPG--DKGIKGAKGDSR------------------EETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGA------------IGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI---NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+ G  G+ G+ GDRG PG    G +G +G S                   ++  P + G KG+ G     GP G KG+PG  G PG  G  G  GV G  GNP                       G  GL+G+KG      E G +G  G  T   V        G +G++G PG  GP G     G+ GD G  G DG  G  G PG  G+          G+PGIPG  G +GL G  G++G  G+ G  G+ G+ G  G  G+             G PG G+ GN G +GE G  G  G  G+ G                    GF G +G TG PGP GD  + G +G  G PG +GL G  G +G  G     G+ G  G  G  G++G+ G  GI    G KGE G+ G+ G  G KGD G  GP G+ G  G +G+ G PG  G  G+ GP G  G+  +                       KG++G  G  G  G  G KG+ G PG  GS G  G  G+  KG+ G  G  G  G KG+
Sbjct:  829 GSPGVPGANGEKGDRGPPGLSTPGFQGDRGISGLPGPPGPVGPPGVPGRPGQDGLPGLPGSKGEMG---SMGPPGSKGNPGNPGAPGFPGPKGDDGVPGQSGNP-----------------------GFPGLKGDKG------ETGIQGPPGITTSTSVL------KGQKGESGVPGFSGPPGPKGITGISGDPGLPGQDGRPGLPGPPGPKGDA---------GLPGIPGSPGATGLKGAMGEMGLPGVPGVKGNSGQPGQPGQPGSPGGPGFPGPKGEAGVPGYGLPGNPGPKGEPGTPGFPGPAGLKGQ------------------PGFPGPQGLTGSPGPKGDPGLPGFQGAPGNPGPKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIPGDKGLAGRDGIPGPAGQKGEPGLPGQPGLKGAKGDPGFPGPAGSAGFPGPKGDAGFPGLPGQIGSVGPPGPPGLPLQGPKGIQGPPGP---PGRAGSGGVKGEKGLPGVPGTPGEAGQKGDYGSPGFPGSPGSPGPNGL--KGDPGPQGVPGFPGSKGV 1311          

HSP 3 Score: 112.464 bits (280), Expect = 4.133e-24
Identity = 180/492 (36.59%), Postives = 223/492 (45.33%), Query Frame = 1
Query: 1795 RDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGI-------KGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI--------------PGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE--------------RGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVK 3165
            +DG PG+ G +G  G+ G  G +G+ G+ G  G PG KG  G  G S    FP +KG+KG+ G    +GP GI       KG  G +G PG SG  G  G+ G                          + G+ GL G+ G   + G  G KGD+G   I              G  G  GL+G +G++G+ G  G KG+ G  G+ GQPG PG  G  G KG  GVPG               PG  G +GL G+ G  G QG+ G  G KG  G  G  GA GNPG      +G  G  G  G+ G PG  GD G  G  G  GD G  G  G  G  G  G+PG  G   +KG KGD G PG  G  GF G  GD G     G+ G               +G  GP G  G  G  G+ G+KG  G+ G  GE G+KGD G  G  G+ G  G  G  G PGP G  G  G KG++G  G  G+ G +
Sbjct:  880 QDGLPGLPGSKGEMGSMGPPGSKGNPGNPGAPGFPGPKGDDGVPGQSGNPGFPGLKGDKGETG---IQGPPGITTSTSVLKGQKGESGVPGFSGPPGPKGITG--------------------------ISGDPGLPGQDGRPGLPGPPGPKGDAGLPGIP-------------GSPGATGLKGAMGEMGLPGVPGVKGNSGQPGQPGQPGSPGGPGFPGPKGEAGVPGYGLPGNPGPKGEPGTPGFPGPAGLKGQPGFPGPQGLTGSPGPKGDPGLPGFQGAPGNPG-----PKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIPGDKGLAGRDGIPGPAGQKGEPGLPGQPGLKGAKGDPGFPGPAGSAGFPGPKGDAGFPGLPGQIGSVGPPGPPGLPLQGPKGIQGPPGPPGRAGSGGVKGEKGLPGVPGTPGEAGQKGDYGSPGFPGSPGSPGPNGLKGDPGPQGVPGFPGSKGVSGPPGISGLPGAR 1324          

HSP 4 Score: 90.8929 bits (224), Expect = 1.428e-17
Identity = 194/590 (32.88%), Postives = 238/590 (40.34%), Query Frame = 1
Query: 1360 LPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREET-----------------------FPSIKGEKGDNGPDGKEGPKGIKGSPG------LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQ 3021
            LPG +G++G  G  G  G  G  G  GF                  G KGD G  G  G  G  G KG KGE G  G P    +T ++     KG+KG SG+ G +G  GPKG+ G+ G                  + G  G+DG  G  G PG +GD G PG  G+ G  G  G +G+ GLPG  G+KG  G   +                          P   G KG+ G  G  GP G+KG PG      L G PG  GD G  G +G  GNP                       G +GL G  G   ++G  G  GD G   +  +        GD+G  G  G+ GP G+    G+ G  G KG+                         G PG PG  G +G  G KGD G  G+ G IG  G  G  G          G  G  G  G  G  G +GLPG+ G  G  G+ G+ G  G  G  G  G  G  G PGP G     G KG SG PG+ GL G  G+ GDKG     G   E   +  KGERG  G  G  G +G++G IG  G  G  G  
Sbjct:  886 LPGSKGEMGSMGPPGSKGNPGNPGAPGF-----------------PGPKGDDGVPGQSGNPGFPGLKGDKGETGIQGPPGITTSTSVL-----KGQKGESGVPGFSGPPGPKGITGISG------------------DPGLPGQDGRPGLPGPPGPKGDAGLPGIPGSPGATGLKGAMGEMGLPGVPGVKGNSGQPGQPGQPGSPGGPGFPGPKGEAGVPGYGLPGNPGPKGEPGTPGFPGPAGLKGQPGFPGPQGLTGSPGPKGDPGLPGFQGAPGNP-----------------------GPKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIP-------GDKGLAGRDGIPGPAGQKGEPGLPGQPGLKGAK------------------------GDPGFPGPAGSAGFPGPKGDAGFPGLPGQIGSVGPPGPPGLPLQGPKGIQGPPGPPGRAGSGGVKGEKGLPGVPGTPGEAGQKGDYGSPGFPGSPGSPGPNGLKGDPGPQGVPGFPGSKGVSGPPGISGLPGARGDPGDKGPPGPPGYAAE--PIVLKGERGPPGPPGNPGGRGQAGPIGLQGLPGSPGSS 1379          

HSP 5 Score: 60.077 bits (144), Expect = 3.224e-8
Identity = 57/158 (36.08%), Postives = 79/158 (50.00%), Query Frame = 1
Query: 2554 SGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKG---EQGINGDKGESGMIGRTGENGEKGD 3018
            +G+K D  ++     G+KG+ G  G +G+ G+ G PG  G +G +GE G+ G  G+ GPKG   I+G  G PG  G   I G+ G  G PG +G+ G          C+G            KGERG  G     G++G  G  G+IG+ GE GE  D
Sbjct:   33 TGSKCDCSSV----KGVKGDRGLPGLKGQPGVPGFPGPEGPMGPRGEKGDDGPQGSIGPKG---IRGPPGLPGFSGTPGIPGLPGQDGAPGPRGIPG----------CNGT-----------KGERGFPGNPGRSGLDGQPGPPGLIGQKGEPGEVID 162          

HSP 6 Score: 57.3806 bits (137), Expect = 2.039e-7
Identity = 57/130 (43.85%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 3715 GNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKG 4089
            G  G+ G KG  G  G  GP G  G  G  GP+G TGS G  G  G  G  G  GN GPKG  G  GP       GR G+ G  G PG  G KG  G +G+PG  G+ G+ G PG  G++G  GD G  G
Sbjct: 1068 GLPGNPGPKGEPGTPGFPGPAGLKGQPGFPGPQGLTGSPGPKGDPGLPGFQGAPGNPGPKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIPGDKGLAGRDGIPGPAGQKGEPGLPGQPGLKGAKGDPGFPG 1197          

HSP 7 Score: 57.3806 bits (137), Expect = 2.200e-7
Identity = 57/147 (38.78%), Postives = 69/147 (46.94%), Query Frame = 1
Query:  205 CNTVCTQNTCRCV---------GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKK 618
            C+   T + C C          G+PG KG  G  G PGP GP G  G  G+ G +G +G  G  G  GLPG  G  G  G+PG           G  G  G+PGCNGT GE+G  G  G+ GL G  G  G  G  GEPG+     +
Sbjct:   28 CHGCGTGSKCDCSSVKGVKGDRGLPGLKGQPGVPGFPGPEGPMGPRGEKGDDGPQGSIGPKGIRGPPGLPGFSGTPGIPGLPGQD---------GAPGPRGIPGCNGTKGERGFPGNPGRSGLDGQPGPPGLIGQKGEPGEVIDINR 165          

HSP 8 Score: 54.6842 bits (130), Expect = 1.552e-6
Identity = 51/117 (43.59%), Postives = 62/117 (52.99%), Query Frame = 1
Query: 3025 LNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKGESG 3351
            + G KG+ G+ G +G+ G PG  GP+G  GP+G  G  G QG +G KG  GP G  G  G        GQ G  G  G+ G  G KGE G PG  G  G +G+ G    IGQKGE G
Sbjct:   42 VKGVKGDRGLPGLKGQPGVPGFPGPEGPMGPRGEKGDDGPQGSIGPKGIRGPPGLPGFSGTPGIPGLPGQDGAPGPRGIPGCNGTKGERGFPGNPGRSGLDGQPGPPGLIGQKGEPG 158          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Zebrafish
Match: col4a5 (collagen, type IV, alpha 5 (Alport syndrome) [Source:ZFIN;Acc:ZDB-GENE-030131-2281])

HSP 1 Score: 223.787 bits (569), Expect = 4.399e-58
Identity = 102/232 (43.97%), Postives = 139/232 (59.91%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEV--QNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            FL TRH Q  E  P CP G++ I+EGYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+   M  +  +N++ YISRC  CE+PA   A HSQT  L    CPE+W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  VD    F  P+ + +KA      N+   +SRC VCMK+
Sbjct: 1456 FLITRHSQTIE-VPSCPDGTSPIYEGYSLLYVQGNERAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPQPMPMTMAPITGENIKPYISRCSVCEAPAMVIAVHSQTIQLP--ACPENWDTLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYGNSYSFWLATVDVNEMFRKPQSETLKA-----GNLRTRVSRCVVCMKR 1678          

HSP 2 Score: 100.908 bits (250), Expect = 1.377e-20
Identity = 192/571 (33.63%), Postives = 244/571 (42.73%), Query Frame = 1
Query: 1846 GAIGREGSYGDIGDRGLPG--DKGIKGAKGDSR------------------EETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGA------------IGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGE-----------SGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+ G  G+ G+ GDRG PG    G +G +G S                   ++  P + G KG+ G     GP G KG+PG  G PG  G  G  GV G  GNP                       G  GL+G+KG      E G +G  G  T   V        G +G++G PG  GP G     G+ GD G  G DG  G  G PG  G+          G+PGIPG  G +GL G  G++G  G+ G  G+ G+ G  G  G+             G PG G+ GN G +GE G     G PG  G  G                 GF G +G TG PGP GD  + G +G  G PG +GL G  G +G  G     G+ G  G  G  G++G+ G  GI G  G+            G+ G+ G  G KGD G  GP G+ G  G +G+ G PG  G  G+ G          QG  G++G  GP G  G  GLE           KG++G  G  G  G  G KG+ G PG  GS G  G  G+  KG+ G  G  G  G KG+
Sbjct:  829 GSPGVPGANGEKGDRGPPGLSTPGFQGDRGISGLPGPPGPVGPPGVPGRPGQDGLPGLPGSKGEMG---SMGPPGSKGNPGNPGAPGFPGPKGDDGVPGQSGNP-----------------------GFPGLKGDKG------ETGIQGPPGITTSTSVL------KGQKGESGVPGFSGPPGPKGITGISGDPGLPGQDGRPGLPGPPGPKGDA---------GLPGIPGSPGATGLKGAMGEMGLPGVPGVKGNSGQPGQPGQPGSPGGPGFPGPKGEAGVPGYGLPGNPGPKGEPG---TPGFPGPAGLKGQ---------------PGFPGPQGLTGSPGPKGDPGLPGFQGAPGNPGPKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIPGDKGLAGRDGIPGPAGQKGEPGAPGLGGPGLPGQPGLKGAKGDPGFPGPAGSAGFPGPKGDAGFPGLPGQIGSVG-PPGPPGLPLQGPKGIQGPPGPPGRAGPPGLEGPRGPPGSGGVKGEKGLPGVPGTPGEAGQKGDYGSPGFPGSPGSPGPNGL--KGDPGPQGVPGFPGSKGV 1331          

HSP 3 Score: 100.523 bits (249), Expect = 1.865e-20
Identity = 180/509 (35.36%), Postives = 224/509 (44.01%), Query Frame = 1
Query: 1795 RDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGI-------KGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPG--IPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI-----------------KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGP--------------------------KGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVK 3165
            +DG PG+ G +G  G+ G  G +G+ G+ G  G PG KG  G  G S    FP +KG+KG+ G    +GP GI       KG  G +G PG SG  G  G+ G  G+P                          GL G+ G   + G  G KGD+G   I              G  G  GL+G +G++G+ G  G KG+ G  G+ GQPG PG  G  G KG  GVPG  +PG  G  G  G  G  G  G+KG  G  G  G  G  G  G+PG+   G +G+ G  G  G+ G PG  G  G  G  G+ G  G  G  G KG+ G  G PGP G K                   KG KGD G PG  G  GF G  GD G     G+ G  G  GP                          +G RG  G  G+ G+KG  G+ G  GE G+KGD G  G  G+ G  G  G  G PGP G  G  G KG++G  G  G+ G +
Sbjct:  880 QDGLPGLPGSKGEMGSMGPPGSKGNPGNPGAPGFPGPKGDDGVPGQSGNPGFPGLKGDKGETG---IQGPPGITTSTSVLKGQKGESGVPGFSGPPGPKGITGISGDP--------------------------GLPGQDGRPGLPGPPGPKGDAGLPGIP-------------GSPGATGLKGAMGEMGLPGVPGVKGNSGQPGQPGQPGSPGGPGFPGPKGEAGVPGYGLPGNPGPKGEPGTPGFPGPAGLKGQPGFPGPQGLTGSPGPKGDPGL--PGFQGAPGNPGPKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIPGDKGLAGRDGIPGPAGQKGEPGAPGLGGPGLPGQPGLKGAKGDPGFPGPAGSAGFPGPKGDAGFPGLPGQIGSVGPPGPPGLPLQGPKGIQGPPGPPGRAGPPGLEGPRGPPGSGGVKGEKGLPGVPGTPGEAGQKGDYGSPGFPGSPGSPGPNGLKGDPGPQGVPGFPGSKGVSGPPGISGLPGAR 1344          

HSP 4 Score: 78.5666 bits (192), Expect = 9.184e-14
Identity = 190/599 (31.72%), Postives = 236/599 (39.40%), Query Frame = 1
Query: 1360 LPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREET-----------------------FPSIKGEKGDNGPDGKEGPKGIKGSPG------LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGD------------KGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQ 3021
            LPG +G++G  G  G  G  G  G  GF                  G KGD G  G  G  G  G KG KGE G  G P    +T ++     KG+KG SG+ G +G  GPKG+ G+ G                  + G  G+DG  G  G PG +GD G PG  G+ G  G  G +G+ GLPG  G+KG  G   +                          P   G KG+ G  G  GP G+KG PG      L G PG  GD G  G +G  GNP                       G +GL G  G   ++G  G  GD G   +  +        GD+G  G  G+ GP G+ G  G  G  G         +                G PG PG  G +G  G KGD G  G+ G IG               +               G++G  G  G  G  G +GLPG+ G  G  G+ G+ G  G  G  G  G  G  G PGP G     G KG SG PG+ GL G  G+ GDKG     G   E   +  KGERG  G  G  G +G++G IG  G  G  G  
Sbjct:  886 LPGSKGEMGSMGPPGSKGNPGNPGAPGF-----------------PGPKGDDGVPGQSGNPGFPGLKGDKGETGIQGPPGITTSTSVL-----KGQKGESGVPGFSGPPGPKGITGISG------------------DPGLPGQDGRPGLPGPPGPKGDAGLPGIPGSPGATGLKGAMGEMGLPGVPGVKGNSGQPGQPGQPGSPGGPGFPGPKGEAGVPGYGLPGNPGPKGEPGTPGFPGPAGLKGQPGFPGPQGLTGSPGPKGDPGLPGFQGAPGNP-----------------------GPKGLDGAPGPAGLNGAPGRPGDPGRSGLPGIP-------GDKGLAGRDGIPGPAGQKGEPGAPGLGGPGLPGQPGLKGA-------------KGDPGFPGPAGSAGFPGPKGDAGFPGLPGQIGSVGPPGPPGLPLQGPKGIQGPPGPPGRAGPPGLEGPRGPPGSGGVKGEKGLPGVPGTPGEAGQKGDYGSPGFPGSPGSPGPNGLKGDPGPQGVPGFPGSKGVSGPPGISGLPGARGDPGDKGPPGPPGYAAE--PIVLKGERGPPGPPGNPGGRGQAGPIGLQGLPGSPGSS 1399          

HSP 5 Score: 54.6842 bits (130), Expect = 1.336e-6
Identity = 101/337 (29.97%), Postives = 138/337 (40.95%), Query Frame = 1
Query: 2554 SGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM------------------------MGVKGNNGPKGDQGEKGL-----------------ETKGQRGEKGNMGVIGNV----------------GAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGM 3390
            +G+K D  ++     G+KG+ G  G +G+ G+ G PG  G +G +GE G+ G  G+ GPKG                     I+G  G PG  G  G  G  G  G                 G RGI G  G  G++G  G  GR+G +G+ G  GL G K   G + D     + G  G +G TG +G  G  G QG                         MG+    GPKG++G++GL                 +T  Q+GEKG+ G+ G+                 G KGE GE G RG  G +GE G +G  G+ G  G  G  G+ G 
Sbjct:   33 TGSKCDCSSV----KGVKGDRGLPGLKGQPGVPGFPGPEGPMGPRGEKGDDGPQGSIGPKG---------------------IRGPPGLPGFSGTPGIPGLPGQDGA---------------PGPRGIPGCNGTKGERGFPGNPGRSGLDGQPGPPGLIGQKAKPGEVIDINRISENGLPGFNGFTGRRGDPGPPGLQGPIGPPGPKGFEGRPGPPGPPGPKGNMGLN-FQGPKGEKGDRGLKGPPGPPGQVGEVSGSPDTVIQQGEKGDRGIPGDTGFPGPPGPPGPQGGQKGEKGEPGEAGKRGKPGKDGEPGLLGYPGDKGDQGPPGLPGRDGF 328          

HSP 6 Score: 54.6842 bits (130), Expect = 1.663e-6
Identity = 55/147 (37.41%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  205 CNTVCTQNTCRCV---------GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKK 618
            C+   T + C C          G+PG KG  G  G PGP GP G  G  G+ G +G +G  G  G  GLPG  G  G  G+PG           G  G  G+PGCNGT GE+G  G  G+ GL G  G  G  G   +PG+     +
Sbjct:   28 CHGCGTGSKCDCSSVKGVKGDRGLPGLKGQPGVPGFPGPEGPMGPRGEKGDDGPQGSIGPKGIRGPPGLPGFSGTPGIPGLPGQD---------GAPGPRGIPGCNGTKGERGFPGNPGRSGLDGQPGPPGLIGQKAKPGEVIDINR 165          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Zebrafish
Match: col4a3 (collagen, type IV, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070802-4])

HSP 1 Score: 223.016 bits (567), Expect = 6.534e-58
Identity = 150/388 (38.66%), Postives = 196/388 (50.52%), Query Frame = 1
Query: 4270 ENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGD------IGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGD--MIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQ 5400
            + GP G  GL G KG  G KG  G    +              + +        +G  G+ GEPGD       G  G+KG  G+    GP G KG  GL G SG E+G+ G +G  G  GA+G PG KG Q  +                   FLFTRH Q     P CP GS +++ GYS +  NGN+  +  +LGT  SCL  FN MPF  C+RD +C+   R D SYWL++  P+  D  M+  + ++ YISRC  CE+ A   A HSQT N+    CP  W  LW GYSFVM T  G  G GQ L SPGSCL  FR  P +EC +G   CN + D+ SY+L  +D    F +P  +  K ++         +SRC+VCMK++ Q
Sbjct: 1336 QCGPVGPAGLKGCKGSPGTKGPKGCDYTV--------------EIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSG-EKGLKGARGLTGEVGAKGAPGAKGPQLRK----------------RDGFLFTRHSQT-TVIPECPAGSKRLYTGYSLLFINGNNRGHGQDLGTLGSCLPMFNTMPFMVCNRDETCRYASRNDYSYWLSTDTPMLPDQQMMSGEILKWYISRCSVCEAIANVIAIHSQTINIPQ--CPVGWLSLWEGYSFVMQTGVGAEGSGQPLVSPGSCLEQFRKIPFIEC-HGRGTCNFYPDSYSYWLASLDHTNMFSMPNRQTAKQKEI--------ISRCQVCMKQQPQ 1680          

HSP 2 Score: 144.05 bits (362), Expect = 1.003e-33
Identity = 390/1188 (32.83%), Postives = 500/1188 (42.09%), Query Frame = 1
Query:  232 CRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGK-------CIGNIQ--------GPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGE-----NGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKG-------------ERGPSGRP-----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGI--KGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXX--XXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEK-------------------GDIGNQGMKGDIGDKG--RSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGL--PGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI------KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERG---------------------------------IKGEQGINGDKGESGMIGRTGENGEKGD---------------QGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGE---KGLETKGQRGEKGNMGVIGNVGAK------GELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            C C G+ G KG+ G +G  G +G +G+ G  G  G  GL G  G  G  G  G RG SG  G  G  G PG  G+ G RG  GLPGCNGT GE G  GL G MG  G +G  G +G  GE   F  A +   G     G  G  G+ G  G  G+ G+ G +G +G+ G QG  G  GE G +      P    QKGE+G PG  G  G   KLF    K P   +GD+                           GD G +G  G +G RG PGPKG+ G +G  G  G  G  G +G  G KG +G +G  G+ G +GE G+ G  G         + N +        GP G  G +G +G  G PGYQG  G              G  G   LPG +G  GDKGE      G  G  G RG+ G  GD G  G      +   G+KG  GD+GL G +G+ G  G +G               G    P     ++  VG +G KG +GL G  G  G  G  G+ G  G +                  G KG+ G+    G  G +GD G  G  G  G++G  G  G +G PG+KG   A     ++ +P + GE+G  GP G +G  G+   G+PG  G  G+ G  G +G  G++G+PG                        G  G  G +G   + G KGEKG                 +   GDT   GL GP G  GVKG QG+ G   I                      GV  +  +   + +  E                     ++G  G  G  G  G   SGAKGD G  G  G  G  G  G +G +GETG+ GL  PG+TG +G  G  G  G +G  GPKGF+G  G+ G PG  GD+         G+ G+ G PG++G KG  G +G  G+    G+ GE GD GP+G +G                                 + G  G+ G KGE G+ G  G+ G+ G                +GL G +G  G  GD+G  G P      G  G KG  G  GE G+ GV G NGPKG +G+    G ET G  GEKG  G  G  G K      G  G PG  G  G+ G TG+   G+ G  GE G  G  G 
Sbjct:   37 CDCQGVKGQKGEKGSLGLVGDVGVQGHQGKEGPPGFPGLKGYLGIPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPGPPGLIGPMGRPGIQGRPGIQGPKGE-TIFIAAAEQMIGLT---GQQGRAGDPGPPGLPGVQGNIGPEGPKGNPGPQGIPGFPGEKGKEGRSMGIPGPSGQKGERGPPGIPGQKGI--KLFASGPKEP---KGDT---------------------------GDSGDRGSPGIIGLRGRPGPKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTP----------IQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGPPGDPGLPGPSNVISRL--GLKGLKGDKGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPS------------------GPKGEMGMKYEIGEKGFKGDTGAVGLLGLSGQDGLPGIPGFKGPPGEKGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMGVGSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGSPGLPGPPGNEGCAGVQGFPGLCGLKGEKG-----------------LSTPGDT---GLTGPKGDKGVKGRQGSPGCGSIGRPGPPGPPGMPGPKHLAAQGQGVEKVCQEMKVALVHQESLVLLDYLDVEVKKDRMDHLENLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGD---EGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFP------GVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGV--TGDPGPPGEAGDDGFDGF 1127          

HSP 3 Score: 132.494 bits (332), Expect = 2.863e-30
Identity = 266/749 (35.51%), Postives = 336/749 (44.86%), Query Frame = 1
Query: 1156 NRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNAT--EMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXF---DGVPGIPGKRGQ--------SGLDGEKGDIGNQGMK---------------GDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNG 3318
            N G  G  G AG  G CI   +G +GP G +G  G  G+PG +G  GE G  G+              +PG  G +G  G  G  GA G RG  GF G  G  G          GI+GD G  G+ G  G+ G+ G  G RGP G     L+G  G  G++G  G  G  G  GPKG    + +  +L   G                  + G  G PG +G+ G PG  G  G+ G  G  G  G PGD GIKG  G+        + G  GD G  G  G KG+KGSPG +G+PGI G  G  G KG +G+P                  + P     GL GEKG     G  G+KGD G C IN +   +    E G  G TG+PG  G  G  G  G  G  G +G  G  G PG PG+ G  G +G    DG+PG  G++G         SGL G KG+ G +G +               G+IG  G+ G KG  G  G PG+ I G +G RG  G  G  GL G  G        G +GD G  GP+G        G PG  GD+      G  GEP +Q     +   G  G+C  RG    +G++GP G  G  G++G  G  G +G+ G  G  G KG +G +         GDRG  GK G  G  G  G KG+ G+KG +G  G  G NGP G +G  GL+  G  GEKG  G      A+G  GE G +G+ G  G
Sbjct:  776 NLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLS-------------IPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPG--------FPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKG-----LMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQ------GLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDP------------------SPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGP-PGDPGPGLKGDKGCVGPQG------RVGPPGCTGDR------GTPGEP-IQSCDELSCFQGKDGDCGLRGP---KGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQ--GDSGEKGLKG------ARGLTGEVGAKGAPGAKG 1449          

HSP 4 Score: 129.413 bits (324), Expect = 2.823e-29
Identity = 248/731 (33.93%), Postives = 304/731 (41.59%), Query Frame = 1
Query: 1528 LQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLD--GKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGD-----RGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQG--MKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNT---------------------GKPGPVGDKTIKG--IKGDSGEPGVQGLKGFTGE---------------SGDKGECSGRGEFGERG--------DVGPKGERG-----------------------IKGEQGINGDKGESGMIGRTGE-----------------NGEKGDQGLNGPKGNVGV---IGDRGETGKPGPIGPDGATGPKGINGIKGEQGM------------MGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKG 3387
            + G KG  G  G++G  GP G P     G KGP+GE GL GL   G  G VG  G+ G +G                    G +G  G  GRDG+PG  G RG  G+ G  G  G  G+ G  GL G KG+ G  G   +E  P   GE GD GP G +G      SPG  G PG+                       +   +  +  D   V G  GL G KG      E G  G  G C  N V   +           +G  G  GL G  G  GV G  G KG  G  G                  F G PGIPG  G +G  G KGD    G    G +G+KG  G  G TG  G+ GI GI G  G  G  GE   RG+ G+TGD G  GE+G+ G  G  GP G +G  G                       G PG  G+K  +G  + GDSG PG++G KG  G                SG+ G     GE G+RG          GPKGERG                       +KG++G  G +G  G  G TG+                  G+ GD GL GPKGN+G    +G  G+ G+ GP+GP G  G KG  G KG +G              G +G  G KG+ G+ G   KG RG KG  G  G++GA G  G  GM G +GD+GE G+  KG  G  GE G+KG  G
Sbjct:  793 ISGAKGDEGPSGIRGADGPPGLP-----GLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAV------------------GFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKP---GEPGDPGPRGPKGQSSNVTSPGELGPPGLP--------------------AFDKTWETFRLYDILCVLGLLGLPGSKG------EIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPG------------------FHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGE---RGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNG--DKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGL--KGARGLTGEVGAKGAPG 1446          

HSP 5 Score: 102.064 bits (253), Expect = 6.453e-21
Identity = 399/1243 (32.10%), Postives = 499/1243 (40.14%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXX--XXXXXLFGDRGDVGLPGCNGTNGEKGNDGLA--------------GKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC----IGNIQGPQGPFGDKGD------KGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGD---------------EGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDG------------------KNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGL-----AGRDGNPGI--------------RGDRGRPGNDGAIGREGSYGDIGDRGLPGDK--------------------GIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKG----DSGNCTINFVKPLNATEM----GDRGDTGEPGLQGPIGK---------------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQG--MKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNT---------------------GKPGPVGDKTIKG--IKGDSGEPGVQGLKGFTGE------SGDKGECSGRGEFGERGDVGPKGERGIKGEQG--INGDKGE--------------SGMIGRTGENGEKGDQGLNGPKGNV---GVIGDRGETGKP-----------GPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-------GQKGESGSNGEFGSKGQKGM 3390
            G PGPKG+ G  G+PG  G  G  G  GELG++G  GD G  G  G+ G++G+ G+ G PG  G+    +  + G +GD G PG  G  G +G  G                GK GL G KG+KGDK   GEPG      KG  G     G  G  G+ G  G   +    G KG++GD G  GP G+ G+PG+Q   +           +G               P +Q   S                     G+ G  G RG KG  G  G  G  G  G PG  G KG  G    IG                   +G KG+ G  G  G      +  I G +GP G+KG       KG+QG PG  G  G  G  G  G  G          PG++G++G  G  G  G  G +G  G                 V+ I GD G+               EG  G +G  G  G+KGE+G S    TGL GPKG KG KG  G  G                  K+     +G++ +     K+          +     E  KD +      G DG PG+               G  G  G DG  G  G  G  G+ GLPG                      G +G KG    +  P   G +GD G  G  GP G+ G+PG  G  G  G MG+ GV GDEG PG  G                   G RG +G+       GE G  G    D    T      L    +    G +G+ G PG+ G  GK                G+KG  G +G +G  G +G  G PG KGVKG+ GF G PGIPG  G +G  G KGD    G    G +G+KG  G  G TG  G+ GI GI G  G  G  GE   RG+ G+TGD G  GE+G+ G  G  GP G +G  G                       G PG  G+K  +G  + GDSG PG++G KG  G        G  G C   GE G  G  G KG+RG  G  G  I+G KGE                        G KGD+G  GP+G V   G  GDRG  G+P           G  G  G  GPKG  G  G  G  G KG  GP G  G KG +    TKG +G    + +    G +G  G+ G +G  GDNG+ G+       GQKG+ G+NG  GSKG  G+
Sbjct:  272 GRPGPKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTPIQGPNGKPGLPGFKGLKGDK---GEPGPDITGPKGRDG---QRGEQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQ-----------ANPANQVNSSSAV------------------GIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMKYEIG------------------EKGFKGDTGAVGLLGLSGQDGLPGIPGFKGPPGEKGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMGVGSPGA----PGEKGNLGVVGRQGNLGDPGEKGSPG----------------PVQTIPGDPGEPGLPGSPGLPGPPGNEGCAGVQGFPGLCGLKGEKGLSTPGDTGLTGPKGDKGVKGRQGSPGCGSIGRPGPPGPPGMPGPKHLAAQGQGVEKVC-QEMKVALVHQESLVLLDYLDVEVKKDRMDHLENLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGD-----------------PGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGE---RGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGL 1420          

HSP 6 Score: 99.7525 bits (247), Expect = 2.995e-20
Identity = 262/824 (31.80%), Postives = 333/824 (40.41%), Query Frame = 1
Query:  469 GDVGLPGC--NGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSG-------KCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGD----RGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLP---GITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRG 2889
            G  G+PGC  +G  G++G  G+ G  G  G  G+KG +G  G PG                                + G  G  GI G  G  G +G  G  G Q     + G  GFPG  GD G+        G T P                          PG+DG  G  G +G  G +G  G PG +G+PG  G  G RG  G                  +  N  S GE+G  G            + +I    G  G  G KG  G+PG  G  G+ G  G  GP GP GD G   LPG +G  G+ G+ G  G  G +G                    VKG  G  G+ G+ G  G +G KG+KG+  P G  T GL+G KG  G  G +G  G  G  G  G+ G  G                    GE+G  G+ G  G PG  GD G  G  G  G EG  G  G  G PGD G  G +G+   +  P   GEKGD G               + G  G+ G  G+ G+KG  G PG  G  G  G  G  G   KP  +G+RG  G  G+  I G KGE+G +G      ++             +GD G  G QG +G  G  GD+G  G                      +  D +    GK G  GL G KG+IG  G  G  G KG+ G  G  G  G    G  G +G +G +    +   P   G  G  G +GE G+ GD G  G KG KG KG+ G  GP G K + G++GDSGE G++G +G TGE G KG    +G
Sbjct:  784 GVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPG------------------------------LSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQ----GRDGSPGFPGIRGDQGS-------PGMTGP--------------------------PGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKG------------------QSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKG--------------------VKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVP------------------GERGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCT-------------MTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVC-ISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEP-------------------IQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGC--KGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGAPGAKG 1449          

HSP 7 Score: 93.2041 bits (230), Expect = 3.145e-18
Identity = 352/1120 (31.43%), Postives = 463/1120 (41.34%), Query Frame = 1
Query:  973 GAVGDRGQKGDTGNVGNRGTPGPKGQ------PGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGE------NGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEK-GISGSKGVKGERGPSGRP-----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGE---KGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDI-----GDRGLPGDKGIKGAKGDSREETFPSIKGEKGD--NGPDGKEGPKGIKGSPGLNGKPG--ISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQ-GPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKG-FTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGM-----IGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPG--MRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGED---------------GDKGNVGPKGNKGLSGPCQQ----------------------GRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
            G VGD G +G  G  G  G PG KG       PG KG++GI G+ G  G  G+ G  GIQG +G  G  G  G  GE G           P G  G  G  G QG PG QG  GE  F                 L G++G  GD G        G  G  GP+G+ G                  +GI G  G++G +G   GI G  G KGERGP G P          GPK PKG+ G SG  G  G +G +G  G  G   +    G  G+ G +G QGE   KG  G  G  G+ GI G++G+ GN G  G  G +  I     G +G PG  G+ G +G      FP  +G  G    GP+GK G  G KG  G  G+PG  I+G  G+ G +G++G                       V    GL+G KG K + G +G +GD GN     +  L      + G    P  Q      VG++G++G++G  G  G  G PG            F G+ G PG  G  G  G K +IG +G KGD G  G  G  G  G  G PG         +G  GE G        GD G  G  GEQG  G  G +G  G+ G+ G PG  G+  + G +G+ G+PG +G  G      GD GE    G  G  G  G +G  G++G  G+ G KGE G+      G TG  G+KG +G  G  G   +           P     A   +G+  +  E  +  V   +    D     L+ + ++    ++  +G  G  G  G PG  + G+KGD G +GI G  G  G  G  G +G+ G+ G                          G +G  G  G  G +G +G +G  G+DG  G  GI G++G  G+T    + G  GP G  GP                        +G +G  G  G +G+ G  G+ GP+G +G   N  S GE GP G    D               G  G  G KG  GL G C Q                      G  GN+G  G  G  G+ G  G++G+ G  G  G+ G P  G+ GP+G  G KG
Sbjct:   53 GLVGDVGVQGHQGKEGPPGFPGLKGYLGIPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPG-----------PPGLIGPMGRPGIQGRPGIQGPKGETIFIAAAEQMIG--------LTGQQGRAGDPGPPGLPGVQGNIGPEGPKGNPG-----------------PQGIPGFPGEKGKEGRSMGIPGPSGQKGERGPPGIPGQKGIKLFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTPIQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGP-----------PGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPG------------FSGLTGFPGPSGPKGEMGMKYEIGEKGFKGDTGAVGLLGLSGQDGLPGIPGF--------KGPPGEKGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMGV-GSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGSPGLPGPPGNEGCAGVQGFPGLCGLKGEKGLSTPGDTGLTGPKGDKGVKGRQGSPGCGSIGRPGPPGPPGMPGPKHLAAQGQGVEKVCQEMKVALVHQESLVLLDY----LDVEVKKDRMDHLENLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLSIPGV-------------------TGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGP------------------------KGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIP--GVPGPNGPKGIKG 1055          

HSP 8 Score: 92.4337 bits (228), Expect = 4.635e-18
Identity = 400/1249 (32.03%), Postives = 505/1249 (40.43%), Query Frame = 1
Query:  487 GCNGTNGEKGNDGLAGKMGLSGDKG------VKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP---IGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXX---XXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGK-----VGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPS-IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGN-------------------QGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKP--GPVGDKTIKGIKGDSGEPGV----QGLKGFTGESGDKGECSGRGEFGERGDVGPKGER-------GIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEK------GNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGD-----FGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG 4047
            G  G  GEKG+ GL G +G+ G +G        G KGY+G PG     +KG +G +G  G  G  G  G  G +G  G  G  G  G  G+ GP   IG  G PG Q       G  G  GP G+         + G T   Q+G +G+ G  G  G  G    +G  G PG  G  G  G+KG  G   + G PGP GQ G +G  GI G  G+  F     +                                  P+G  GD GD+G+ GI G +G  G KG KG  G  G  G  G   L G+ G  G KG+ G  G  G  G+ G  G+ G  G  G+       +KG  GD G  G  G+ GS+G  G  G  G P T + GP G  G  G  GL G  G+      GPKG  G  G        G  G   +    G KG  G  G  G  G+RGD   PGN G +        + D     + GI+    +    +    I+G KG  G  G  GP G  G  GL G PG SG  G+MG+K + G                   D   V G  GL G+ G+  I G KG  G+ G            + +  +GD G PG+ G  G  G  G QG+ G                          G PG PG++G  G+ G +G++G+                    G+ G                         G  G  G EG  G++G PG+ G  G +G S   GD G  GPKG KG+KG  G P  G +G     G  G  G   +    QG++    E              +  DV  K +R       G  G  G+ G  G   + G  G+ G  G +G +GP G  G+ G +GETG PG +   G TG  GI GI G  G +G +G  G +G  G  G    G RG++G+ G+ G  G  G  G PG+RG KG  G  G+ G +G+ G  G+ G +G KG                             GE+G  G                    G  GL G  GE GL GI      G  G NG  G  G PG  GD G KGLPG QG  G+ G++      G KGVKG  G  G  G  G  GP G  G KG+  P G       GE G+ G  G  G KG  G C  G +G  G  G PG+ G+ G  G  G PG+ G  G  G PG
Sbjct:   41 GVKGQKGEKGSLGLVGDVGVQGHQGKEGPPGFPGLKGYLGIPG--IPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPGPPGLIGPMGRPGIQ-------GRPGIQGPKGETIFIAAAEQMIGLT--GQQGRAGDPGPPGLPGVQGNIGPEGPKGNPGPQGIPGFPGEKGKEGR--SMGIPGPSGQKGERGPPGIPGQKGIKLFASGPKE----------------------------------PKGDTGDSGDRGSPGIIGLRGRPGPKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTPIQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGD---PGNQGYVLLLLLILVLQD-----NLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMKYEIGE-------------KGFKGDTGAV-GLLGLSGQDGLPGIPGFKGPPGEKGK----------PSALAPKGDQGYPGVGGEQGSTGPMGSQGSMGV-------------------------GSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGS-----------------------PGLPGPPGNEGCAGVQGFPGLCGLKGEKGLS-TPGDTGLTGPKGDKGVKGRQGSPGCGSIGRPGPPGPPGMPGPKHLAAQGQGVEKVCQEMKVALVHQESLVLLDYLDVEVKKDRMDHLENLGFDGFPGVAGVPGCC-ISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPG-LSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFP--GIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSP---------------------GELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGIC-----GQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGIC--GINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPG 1129          

HSP 9 Score: 88.1965 bits (217), Expect = 8.935e-17
Identity = 242/801 (30.21%), Postives = 327/801 (40.82%), Query Frame = 1
Query: 2005 KGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEM--------------GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGE------KGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGF---------------TGESGDKGE------CSGRGEF--------GERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQ---------------GMMGVKGNNGPKGDQGEKGLETKGQRGEKG-------------NMGVIGN----VGAKGELGEPGMRGSKG------------DNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQ-----GRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKG--KPGN-GIEGPDGDIGNKGR 4092
            +G+KG  G  G  G+ GD+G  G +G EG P                       G  GL+G  GI  I G KG +G SG         L                   G +G+ G PGL GP+G+ G++G  G +G  G +                    + + G+ G++G++G  G       +G+IG +G KG+ G +G  G  G+ G  G   +GI G  G +GE G  G+ G  GI   +   G    +GD G+ G +G  GI G  G+PGP G+K  +G  G  G+PG +GL+G                TG  G+KG+          GEF        G++GD GP G  G++G +G  G  G  G+ G          QG NG  G  G  G +G+ G+PGP      TGPKG +G +GEQ                 +G+KG  G KG  G +GL  +G  G +G             N+G+  N    V +   +G  G +GS+G             +G TG     G KGE G   E G KG KG                           D G +                           GL G+SG+ GL GI   G  GP G+                        +G    +  KG++G  G  G +G+ GP G QG  G  GS G  G KG+ G  G +GN+G  G KG  GP Q      G  G  G  G PG  G +G  G++G PG  G  G+KG   PG+ G+ GP GD G KGR
Sbjct:   40 QGVKGQKGEKGSLGLVGDVGVQGHQGKEGPP-----------------------GFPGLKGYLGIPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPGPPGLIGPMGRPGIQGRPGIQGPKGETIFIAAA--------------EQMIGLTGQQGRAGDPGPPGLPGVQGNIGPEGPKGNPGPQGIPGFPGEKGKEGR-SMGIPGPSGQKGERGPPGIPGQKGI--KLFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTP-------IQGPNGKPGLPGFKGLKGDKGEPGP----DITGPKGRDGQRGEQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGL--RGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMKYEIGEKGFKG---------------------------DTGAV---------------------------GLLGLSGQDGLPGIP--GFKGPPGE------------------------KGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMG-VGSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGSPGLPGPPGNEGCAGVQGFPGLCGLKGEKGLSTPGDTGLTGPKGDKGVKGR 706          

HSP 10 Score: 86.2705 bits (212), Expect = 3.808e-16
Identity = 250/775 (32.26%), Postives = 319/775 (41.16%), Query Frame = 1
Query: 1876 DIGDRGLPGDKG-----IKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGP---IGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPG------------IPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPG------------VQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMI------------------------GRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNM-----------------------GVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGE----SGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNK---GVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSG 3939
            ++G  G PG  G     I GAKGD   E    I+G  G  G  G +GP+G  G PGL+  PG++G +G  G+ G  G                    A   +G +G QG  G     G +G++G  G               G  G+ G PGL+GP   +G+ GV GD+G  G  G  G +G  G+  N    G  G  G+P             I    G  GL G KG+IG  G+ G  G  G  G+ G  G  G+PGI G+ GN+G  G  G+ G+ G PG+ G  G+ G  GE G  G  GP G KGIKG+   PGP       G+ G+ GEPG            + G+ G  G SG  GE   RG  G  GD GP GE G  G  G  G  G  G                          G  G  GEKGD+G     G+ G+ G +GE G  G  GP G  GP G  G  GE G  G  G  G +G  G  G+   G +GE+G                         G  G VG +G +G PG  G +G  GE  I    E     G +G+ G +G KG                           +IG +                     G+ GP G  G  G  G +G  LKG  G  G  GP G           G +G  G+ G +G+ G+ G+K   G+KG  G KG++G  G  G KG  G +G++G KG  G  G  G VG KG  G  GP  + R G
Sbjct:  776 NLGFDGFPGVAGVPGCCISGAKGD---EGPSGIRGADGPPGLPGLKGPQGETGLPGLS-IPGVTGVVGIPGIFGPVG--------------------AVGFRGPKGFQGRDGSPGFPGIRGDQGSPGM----------TGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGP----ETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGE---RGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTM-TGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEP-IQSCDELSCFQGKDGDCGLRGPKG---------------------------NIGPL---------------------GRVGPDGQKGQCGPVGPAG--LKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGAPGAKGPQLRKRDG 1457          

HSP 11 Score: 65.855 bits (159), Expect = 5.171e-10
Identity = 212/634 (33.44%), Postives = 261/634 (41.17%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNM---GELG---------------------ARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF------------------------FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPF-----------------------GDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGD 1932
            G+PG +G  G  G+PGP GPKG + N+   GELG                       GL+G  GS G+ GLPG  G+ G  G+PG  G PG  G  G +G   LPG  G NG  G+ G+   MG  G KGVKG  G+ GEPG                             +KGE G AG  G  G+KG  G  G  G  G  G++G+ G  GD GP G +G+           G  GFPG                  PP   G  G  G  G  G  G  G  GE G DG  G  G+KGD G        G  G PG KG KGI+G+ G  G  G  G  G  G+ G  G  G KG+ G +G  G CI   +G +GP                        GDKG  G QG  G  G  G++G                SC  GK GD G +G  G     GP G  G +                 G KG  G  G  G KG  GS G KG +G     T  +    G +G +G +G  G+ G  G KG++GL GT                  +G+KG  G  G DG+ G+ G +G  G  G  G  G  G++G +G PG KG +  K D
Sbjct:  905 GVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKG---LPGNQGLNGNFGDQGV---MGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGD----------DGFDGFPG------------------PPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMT----GDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRG----TPGEPIQSCDELSCFQGKDGDCGLRGPKGNI---GPLGRVGPD-----------------GQKGQCGPVGPAGLKGCKGSPGTKGPKGCDY--TVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGT------------------KGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGAPGAKGPQLRKRD 1456          

HSP 12 Score: 64.3142 bits (155), Expect = 1.559e-9
Identity = 98/290 (33.79%), Postives = 123/290 (42.41%), Query Frame = 1
Query: 2560 AKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDS------------------GEPGVQGLKGFTGESGDKGECSG-RGEFGERGDVGPKGERGIKGEQGINGDKGES-------GMIGRTGENGE------------KGDQGLNGPKGNV---GVIGDRGETGK-------PGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGE 3285
            +KG     G  G   +G +G +GE+G  G+       GD+G QG  G++G      P GF G+KG  G PG  G K  +GI G                                        C+G +GE G  G +GP G  GI+G  GI G KGE+        MIG TG+ G             +G+ G  GPKGN    G+ G  GE GK       PGP G  G  GP GI G KG +  +   G   PKGD G+      G RG  G +G+ G  G KGE GE
Sbjct:   25 SKGACDCSGKSGCDCQGVKGQKGEKGSLGL------VGDVGVQGHQGKEG------PPGFPGLKGYLGIPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPR-------------GPPGLPGCNGTKGEPGPPGLIGPMGRPGIQGRPGIQGPKGETIFIAAAEQMIGLTGQQGRAGDPGPPGLPGVQGNIGPEGPKGNPGPQGIPGFPGEKGKEGRSMGIPGPSGQKGERGPPGIPGQKGIK--LFASGPKEPKGDTGD-----SGDRGSPGIIGLRGRPGPKGEKGE 282          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 222.631 bits (566), Expect = 7.836e-58
Identity = 114/312 (36.54%), Postives = 162/312 (51.92%), Query Frame = 1
Query: 4462 GDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            G +G  G KG  G P + G  G +GE G  G+SG   EQG  G  G  GP G                          G+++   +L  +H Q+ EE P+CP G + ++ GYS +   G  + +  +LG   SCL  FN MPF  C+    C    R D+SYWL++  P+    +E   ++ YISRC  CE+P+   A HSQ   + +  CP  W  LW GYSF+MHT  G+ GGGQSL+SPGSCL  FR +P +ECN     C+++ +  S++L  +D  F+        +E  K+  +   +SRC+VCMK
Sbjct: 1387 GFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGM------------------------AGRSVNVGYLLVKHSQS-EEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDICYYASRNDKSYWLSTTQPIPMMPVEESEIKPYISRCSVCEAPSVAIAVHSQDTTIPN--CPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSIDESFQ----SSPSSETLKAGQLLSRISRCQVCMK 1667          

HSP 2 Score: 201.06 bits (510), Expect = 3.538e-51
Identity = 470/1405 (33.45%), Postives = 588/1405 (41.85%), Query Frame = 1
Query:  232 CRCV------GIPGP------KGDYGRIGNPGPIGPKGYTGNMGELG------ARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF------FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ-PKGIAQKGEKGFPGPIGDAGTDCK--LFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDG-VIGFX---XXXXXXXXXXXXXXXXNRGSKGE-----VGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGR-----PGNDGAIGREGSYGDIGDRGLPGD-----KGIKGAKGD--------------------SREETFPSIKGE-KGDNGPDGKEG---PKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP----VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFV-KPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGN------------------QGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGIT---GDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVG----VIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMG----VIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEG------LPGKIGRMGDKGKPG-------NGIEGPDGDIGNKG 4089
            C+C       G+PGP       G  GR G PG  GPKG  G  GE G      + G+ G  G NG DG+PG  G S                  G RG  G  GCNGT G+ G  G  G  G  G  G  G KG  G+P +       F+   G  GF G                  + G  GD G RG  G QGP G  G  G +  KG   K  KG  G +G+ G      +F      P D +G+ G+ G  G KG  G      E G+ G  G RG  G  G  G RG  G  G PG+ G KG  G  G ++G        G  G  G++G  GN G KG             G+    + GP+GP G KG  G  G PG                +        S     +G  G +G  G +G  GP+GD G    +              G  G +G+ G QG++G  G+KG  G  G  G  T GL GPKG KGE   +   G  G  G  G  G                       GE+G+ G+ GRDG PG RG  G      PG  G  G  G  G IG +G PG      KG+ G  GD                    SR  +  SI  E  GD GP G+ G   P+G++G PG+ G  G +G  G +G KG+ G PG  G  G  G  G +G    P    V+G  GL G+ G+    G KGE G+    +      P      GD G TG+PGL G  G  G+ G  G KG                          G PG+ G++G+ G  G  G  G                    G +GD G+ G  GA+G  GAIG+PG IG+ GN G  G++GETG  G  G+    G  G QG +G  G  G  G KGF G KG  G PG       +G KG  G PG +G +G TG  GDK              + P  +  +KG +G +G+ G+ G  G  G  G  G  G  G  G+ G    V G +G  G+PG  GP G  GP G+ GI+G  GM G KGN G  G  G  G    G +G KG++G    + G+ G +GE G PG  G+KG  G  G  ++G SG +G  G KG +G  G  G  G  G +G  G +G KG  GD G+ G+ G  G               + G KG  G+ G  GL G  LKG+ G  G  G                          G  G  G+KG  G+ G KG +G +G  GP+G  G     G +GD+G  G KG  G  G +G  G P   G  G+RG +G  G  G KG QG  G        G  GR GDKG+PG        G +G  G  G KG
Sbjct:   48 CQCYPEKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPS------------------GARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPG------------------IVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPG--TEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGF---------------------PGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGES------------------------GPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPG------HQGAKGAPGSPGQKGDRGLTGPPGDKPVI----------HITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPG--DSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPG--ERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQG---------------QPGQKGFPGLKGIFGLDG--LKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKG 1332          

HSP 3 Score: 184.882 bits (468), Expect = 3.200e-46
Identity = 368/1116 (32.97%), Postives = 465/1116 (41.67%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGP---IGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFA----XXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERG-PSGRPTTGLVGPKGPKGE---------------KGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGR---PGNDGAI-----------GREGSYGDIGDRGLPGDKGIKGAKG-------DSREETFPSIKGEKGDNGPDGKEGPKGIKGS---PGLNGKPGISGDMGKMGVKGDEGNPXXX--XXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGM-RGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERG---DVGPKGERGIKGEQG------------INGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPG--PIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G PG KG  G  G PG     GPKG  G + E   +G  GD G  G  G PG++G                    G  G  G PG  G  GE G  G  G  G SG  G  G  G  G PG    A KG  G                           G Q    +   +GD GP G SG PG  P+G+  +G  G PGP G AG    L            GD GE+GE G+ G  G           G  G RG  G  G  G +G PG  G+PG  GA G                               KGE GE  G+        G  G  GD G  G+ G+PGY G  G  G                    G +G+ G  G  GE G  GP G FGF G  G  G  G  G   +   G SG  G QGE G+ G++GVKG  G P     TG +GP G +GE               KG  G+ G  GK G +G+KG  GT  ++               G  G  G  G  G+PG +GDRG    PG+   I           G +G +G++GD G  G +G KG  G       D        +KG KG  G  G EGPKG+ G    PG+ G PG+SG  G  G  G  G PG                   +  ++GE G  G  G K + G  GE+G SG         L+  E G +G  GEPG  GP G  G++G  G++G                          G  G PG+ G +G+ G+ G  G  G+KG  G  G  G KG+ G  G    G  GN G++GE GETG+     G+ G +G++G +G+ G+ G  G +G  G +G  G         IKG +GD G PG++G+ GF G  G  G  S  G  G+RG   D G  GE+G++G++G              GDKGE GM+G  G  G +GD+G  GPKG+ G  G  G  G  G  P+       P+ + G +G  G MG++G +G             G  G  G+ G +G  G KG  G PG+ GS G  GE   G  G SG  GE G++G+ GM
Sbjct:  485 GDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRP------------------GIDGRDGEPGFRGPPGE-GPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVE-CIGDPGPPGESGLPG--PRGL--EGFPGVPGPKGTAGFSGDL------------GDKGERGEPGRGGPPGP---------KGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASG------------------------------GKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMT------------------GLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGE--PGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEI---------------GLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSG---------LDGIE-GMKGYQGEPGTVGPPGSDGLQGFPGSQGHK------------------------GRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGF------SDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPV-------PQKLPGEQGPPGQMGIQGPSGRN--------GNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEP--GSMGHSGLQGEQGTRGRPGM 1433          

HSP 4 Score: 184.111 bits (466), Expect = 5.014e-46
Identity = 383/1137 (33.69%), Postives = 488/1137 (42.92%), Query Frame = 1
Query:  979 VGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGE--KGISGSKGVKGERGPSGRPTTGLVGPKGPKGE-----KGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD---------------------IGDRGLPGDKGIKGAKGDS--------------REETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGP---------IGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG---------------IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPK----GERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGS-------------------KGETGPKGDFGEDG---------------DKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGK 4041
            VG  G KG       +G+PG +G+PGS G KG +G  G+                                     +    G QG  GD G KG  G+PG+ G  G  G K                  G++G++ +  + G +G  G  G  GF G+           +   GI G  G+ G +G   +G  G  G KG  GP GR  +GL+GPKG  G+     KGLSGL G +G+ GP G  G  G       +G           G+ G  G +G  G  G+ G  G PG  G  G  G  GD                      GD G PG KG+KG  G S                E F +  G  GD G  G  G  G+ G PGL G  G+ G  G  G+KG+ G PG                    +QGE+G  G  G     G+ G  G  G               G RGD GEPGL G           G +GV G+ G  G  G +G  G  G PG KG KG +G  G PG  G+RG  G  G KG+IG  G +G  G  G  G KGD G  G PG                G KG+ G+ G+ G TG RG  G  G  G +G+ G  G+     P   KG+KG  G+PG  G K   G+ G +G PG++G  G +G  G+KG     G  G+      +GD+GP     G  G++GE G  G  G  G+ G  GE G  G  G+ G KG  G  G  G  G  G  G  G+ G KG +G  G+ G  G++G  G KG  G KG+    G +G+KGN GV G        G+PG  G+KG+ GETGI     S + G  GS G KG  G+ G+ G                  +IG+ G  G  G+ G    KG +G+ G  G KG+ G  G +G  GI      KG+ G +GD G  G+ G+ GD+G+KG  G  G  G +GD GE G  G  G  G +G+ GP G   PKG+TG                     GE GP G  G  G               D G VGP G+KG+ G P   G  G RGE G+ G  G++GEQG  G PG  G +G  G+
Sbjct:  414 VGPPGPKGSLEEY-FKGSPGHRGRPGSAGKKGPKGDHGLC---------------ECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPK------------------GRKGELMEAVQKGSAGDPGDPGHSGFPGE-----------QGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGYSGPPGR--SGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPG--------------------LQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNI----GEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGE-----PSVVKGVKGLPGEPGLEGPK---GMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD----NWGQPGNPGTKGELGETGI----PSTTTGVPGSLGHKGTTGDSGNKG------------------EIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFG---PKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGR 1442          

HSP 5 Score: 130.954 bits (328), Expect = 8.258e-30
Identity = 311/953 (32.63%), Postives = 392/953 (41.13%), Query Frame = 1
Query:  277 IGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ-------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGA---------KGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFN--XXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNC-TINFVKPLNATEMGDRGDTGEP----GLQGPIGKVGVKGDQGAKGS------DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLD---------------------------------------------GEKGDIGNQGMKGDIGDKGRSGAKGDT----------------------GAIGNPG-IGIKG---------------NEGSRGEEGETGMRGLPGITGDIGNQGE------SGEQGDIGNFGPKGFKGIKGNTGKPGPVG 2781
            IG+PGP    G +G  G  G  G  G  G  G  G  GD G+ G+ G PG  G PG  G  G RGD+G PG   T G KG  GL+GK GL G  G KG+ G +      F A  G  G                    G+ G +GD G+ GD G  G  GM G PG         P G+  +GE+G PGP G        F   G+T     G  G  G  G+ G +G +G  GEPGL GA G +G  GD GN+G  G  GP G  G  G          KG +G  G+ GF G  G++G++G        G+KGE+G  G  G      +G  G  G KGD+G  G PG +  +                          +G  GD G  G+ G  GPRG  GF        +     E   VKG+KG  G+ GL+G KG+ G  G+ G          G  G  GPKG KG SG  G+ G  G KG KG LG    L                           G+ G+RG+ G PG+ GA   +G YG  G+RG  G  GI+G KG          +GE G  GP G +G   ++G PG  G  G SGD G+ G  G +G P                       G++G  G KGI  +DG KG+KG+ G   T N+ +P N    G+ G+TG P    G+ G +G  G  GD G KG        G  G++G     G +G  G  G  G+PG PG RG  G+                                              GE G +G  G +G  GD+G  G KGDT                      G  G PG +GI+G               + G  G  G  GM GLPGI G  G +GE      SG QG+         +G +G  G PGP+G
Sbjct:  635 IGDPGP---PGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPG---TKGVKGPPGLSGKPGLDGASGGKGEHGEV------FGASSGAPG------------------DPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGL--QGEQGRPGPPGT-------FGFPGQT--GYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKG------FSGTKGEIGLPGHQG-----AKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEV----------------MKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPG--------IEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISL--------------------------PGSTGLRGETGHPGSTGA---KGLYGMPGERGSSGLDGIEGMKG---------YQGEPGTVGPPGSDG---LQGFPGSQGHKGRSGDPGQTGTTGIQGQP-----------------------GQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGE---------QGTRGRPGMPGPLG 1438          

HSP 6 Score: 83.9593 bits (206), Expect = 1.999e-15
Identity = 226/634 (35.65%), Postives = 285/634 (44.95%), Query Frame = 1
Query:  253 GPKGDYGRIGNPGPIGP---KGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLF-----GDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKG----VKGDKGYIGEPG-DFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP-IGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPG---LDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXX--XXXXXXXXXXNRGSKGEVGEAGGSGKCIG-----NIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLG-TACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVK 2079
            G KG  G  G PG  G    KG++G  GE+G  G  G  G+ G  G  GDRG +G  G   +      +        GD G++G PG  G  G KG  G+ G  G  G  G    VKG KG  GEPG +  +   G  G  G EG  G  G KG  G  G  G  GD GI+G  GD GP I + G  G        +GE G PG  G  G    L+ +     P +RG SG  G  G KG  G  G  G PG   L G  G +G KG +G+ G  GT G +GQPG KG  G++G  G+ G KG +G +        G+ GN G+KGE+GE G      G       +G  G  G+KG+ G +G+PG QG   ++GF               S + G +GD G  G  G  G  G RG  G     G            KG +G+ GD GL GEKG+ G +G KG  G SG         KG KGE G+ G  G+ G  G +G  G  G T           +      Q   G+ G  G+ G  G  G  G PG  G  G  G  G  G +G+PG  GI G+ G      F    G  G +G  G++G +G  G PG  G  G S ++G + VK
Sbjct:  875 GSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTG-------LRGETGHPGSTGAKG----LYGM-----PGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQG---QQGF---------------SDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFG-----------AKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGR-----KGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPG------FRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVK 1452          

HSP 7 Score: 68.9366 bits (167), Expect = 7.375e-11
Identity = 81/219 (36.99%), Postives = 102/219 (46.58%), Query Frame = 1
Query: 2776 VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKG--LET-------KGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGE-----SGSNGEFGSKGQKG 3387
            +   T  G+K  +G  G +   G      +KG     G  G +G  GPKG +G  G QG  G KGE G  G  G  G  G +G+ G  G  GV G  G +G  G  GPDG  G +G +G+ G  G+ G +G  G  G +GEKG  LE        +G  G  G  G++G  G  G  G PG +G  G  G  G  GQKGE      G  GE G  G+ G
Sbjct:   24 LTSTTFSGVKKSTGPCGGRDCSGGCQCYPEKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPG 242          

HSP 8 Score: 63.5438 bits (153), Expect = 2.759e-9
Identity = 161/476 (33.82%), Postives = 197/476 (41.39%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGY-----IGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVI---GFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESG------AHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKG 1623
             + +PG  G  G  G+PG  G KG  G  GE G+ GL G  G  G  G PG  G  G  G+ G  G  G  G  GD G  G  G  G  G+KG  GL G  GL G KG KG++G       G+PG+     KGE G                    G+ G  G KG  GD G++G IG  G PG Q       G++GF        +D K                                     G  G  G  G KG  G  G RGTPG     G+KG +G  G  G+    G +G  G+KG  G+ G  G +G KGE G  G  G+     QG +GPFG KGD G  G     G  G KG+  +P             LPG++G  G  G  G SG        GP GD GF              K + G+ G  G  G +GE G  G  G++GE+G  GRP  G+ GP G
Sbjct: 1054 TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGN--PGTKGELG-----------ETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQ-------GQQGF--------SDIK-------------------------------------GTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRR--GFQGDRGPFGPKGDTGPPGF---PGLPGAKGYPPVPQK-----------LPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGF--------VGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRP--GMPGPLG 1438          

HSP 9 Score: 54.6842 bits (130), Expect = 1.392e-6
Identity = 56/133 (42.11%), Postives = 72/133 (54.14%), Query Frame = 1
Query: 3712 QGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPK----GNKGLSGPC-QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGR 4092
            +G  G+ G +G KG+ G  G  G  G  G  GPKGN GS G  G  GD G  G KG++GP     G+ GL G     G +G +G  G PG+ G  G  G+EG+ G  G  G  G PG +G++G  G  G+KGR
Sbjct:  994 KGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGR 1126          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 218.394 bits (555), Expect = 3.009e-57
Identity = 112/306 (36.60%), Postives = 159/306 (51.96%), Query Frame = 1
Query: 4480 GSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            G KG  G P + G  G +GE G  G+SG   EQG  G  G  GP G                          G+++   +L  +H Q+ EE P+CP G + ++ GYS +   G  + +  +LG   SCL  FN MPF  C+    C    R D+SYWL++  P+    +E   ++ YISRC  CE+P+   A HSQ   + +  CP  W  LW GYSF+MHT  G+ GGGQSL+SPGSCL  FR +P +ECN     C+++ +  S++L  +D  F+        +E  K+  +   +SRC+VCMK
Sbjct:  761 GHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGM------------------------AGRSVNVGYLLVKHSQS-EEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDICYYASRNDKSYWLSTTQPIPMMPVEESEIKPYISRCSVCEAPSVAIAVHSQDTTIPN--CPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSIDESFQ----SSPSSETLKAGQLLSRISRCQVCMK 1035          

HSP 2 Score: 173.326 bits (438), Expect = 5.421e-43
Identity = 294/842 (34.92%), Postives = 375/842 (44.54%), Query Frame = 1
Query: 1009 GNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERG-PSGRPTTGLVGPKGPKGE---------------KGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGR---PGNDGAIG--------REGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNG----PDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI---------PGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGM-RGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERG---DVGPKGERGIKGEQG------------INGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGE-------------TGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGET 3324
            G++G  GT G KG PG  G  G+ G+ G                         KGE GE  G+        G  G  GD G  G+ G+PGY G  G  G                    G +G+ G  G  GE G  GP G FGF G  G  G  G  G   +   G SG  G QGE G+ G++GVKG  G P     TG +GP G +GE               KG  G+ G  GK G +G+KG  GT  ++               G  G  G  G  G+PG +GDRG    PG+   I          +GS GD G+ G PG  G +G KG      FP I G +G +G    P   +G KG+ G PGL G  G+ G  G  G++G  G                        QG +G  G  G     G KG KGD G  TI+          G RG+TG PG  G  G  G+ G++G+ G DGI G KG  G+PG  G  G+ G  G PG          PG+ G +G+ G+ G  G  G+KG  G  G  G KG+ G  G    G  GN G++GE GETG+     G+ G +G++G +G+ G+ G  G +G  G +G  G         IKG +GD G PG++G+ GF G  G  G  S  G  G+RG   D G  GE+G++G++G              GDKGE GM+G  G  G +GD+G  GPKG+ G  G  G               G+ GP G  G  GP G NG  G  G  G  G +G KG  G  G+  + G RGE G+MG  G  G +G  G PGM G  G  G +
Sbjct:   63 GDLGYPGTKGVKGPPGLSGKPGLDGASG------------------------GKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMT------------------GLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGE--PGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEI---------------GLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKG------FPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPG----------------MSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGP-TISL-----PGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGF------SDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 811          

HSP 3 Score: 171.785 bits (434), Expect = 1.691e-42
Identity = 335/1000 (33.50%), Postives = 423/1000 (42.30%), Query Frame = 1
Query:  277 IGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ-------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGA---------KGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXX--XXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGP-KGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNC-TINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDV-------------------------GPKGERGIKGEQGIN---------------GDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIG 3096
            IG+PGP    G +G  G  G  G  G  G  G  G  GD G+ G+ G PG  G PG  G  G RGD+G PG   T G KG  GL+GK GL G  G KG+ G +      F A  G  G                    G+ G +GD G+ GD G  G  GM G PG         P G+  +GE+G PGP G        F   G+T     G  G  G  G+ G +G +G  GEPGL GA G +G  GD GN+G  G  GP G  G  G          KG +G  G+ GF G  G++G++G        G+KGE+G  G  G      +G  G  G KGD+G  G PG +  +                          +G  GD G  G+ G  GPRG  GF G      +     E   VKG+KG  G+ GL+G KG+ G  G+ G  G       G+ GPK   +G KG SG  G+ G  G KG KG LG    L                           G+ G+RG+ G PG+ GA   +G YG  G+RG  G  GI+G KG          +GE G  GP G +G   ++G PG  G  G SGD G+ G  G +G P                       G++G  G KGI  +DG KG+KG+ G   T N+ +P N    G+ G+TG P                                             GVPG  G +G +G  G KG+IG +G+ G  G +G S  KG  G  G PGI        +G  G  G RG PGI    G +G+ G  GD G FG KG   ++G+ G+ G  G+  + G KGD GEPG+ G  G  G  GD      RG FG +GD                          GP G+ GI+G  G N               G KG  G+ G  G  G +G+ G  G  G  G  G RG  G PGP+G
Sbjct:    2 IGDPGP---PGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPG---TKGVKGPPGLSGKPGLDGASGGKGEHGEV------FGASSGAPG------------------DPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGL--QGEQGRPGPPGT-------FGFPGQT--GYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGF------SGTKGEIGLPGHQGA-----KGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEV----------------MKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEG-----FPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISL--------------------------PGSTGLRGETGHPGSTGA---KGLYGMPGERGSSGLDGIEGMKG---------YQGEPGTVGPPGSDG---LQGFPGSQGHKGRSGDPGQTGTTGIQGQP-----------------------GQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTT-----------------------------------------TGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGI--------KGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKG---VQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGD------RGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLG 806          

HSP 4 Score: 160.999 bits (406), Expect = 3.295e-39
Identity = 333/957 (34.80%), Postives = 421/957 (43.99%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ-------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSK---------GAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXX--XXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGP-KGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVG 3051
            C+G PGP G+ G    PGP             G  G  G  G  G  G  GD G+ G+ G PG  G PG  G  G RGD+G P   GT G KG  GL+GK GL G  G KG+ G +      F A  G  G                    G+ G +GD G+ GD G  G  GM G PG         P G+  +GE+G PGP G        F   G+T     G  G  G  G+ G +G +G  GEPGL GA G +G  GD GN+G  G  GP G  G           G KG +G  G+ GF       G  G++G  G  G+KGE+G  G  G      +G  G  G KGD+G  G PG +  +                          +G  GD G  G+ G  GPRG  GF G      +     E   VKG+KG  G+ GL+G KG+ G  G+ G  G       G+ GPK   +G KG SG  G+ G  G KG KG LG    L         G  G +GE G  G  G  G  G+ G+RG  G DG  G +G  G+ G  G PG  G++G         FP  +G KG +G  G+ G  GI+G PG  G PG+ G  G  G+KG +GN                     P     G  G  G       KGE G++G  +     P     +G +G TG+ G +G IG+ GV G QG +G              G +G  G  G  G+PG PG RG  G+    G  G++G  GD G  G  G +GD G  G+   G  G  G +G++GE GM G PG  G  G++G  G +GD G  G  G  G KG      PV  K    + G+ G PG  G++G +G +G+ G     G+ G  G  G  G  GI G  G  G+ G  G  G  GE G +G  G+ GP G  G
Sbjct:    1 CIGDPGPPGESGL---PGP------------RGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYP---GTKGVKGPPGLSGKPGLDGASGGKGEHGEV------FGASSGAPG------------------DPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGL--QGEQGRPGPPGT-------FGFPGQT--GYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGF------PGKTGERGLKGFSGTKGEIGLPGHQGA-----KGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEV----------------MKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEG-----FPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISL--------PGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQG---------FPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGN------------------QGVPGTDNWGQPGNPGT------KGELGETGIPSTTTGVP---GSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFS---------DIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGS--SGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYP----PVPQK----LPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAG 809          

HSP 5 Score: 160.229 bits (404), Expect = 5.420e-39
Identity = 272/758 (35.88%), Postives = 345/758 (45.51%), Query Frame = 1
Query: 1204 CIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGF------KXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGI---KGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGN-PXXXXXXXXXXXXXXXXXDAKPV--QGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPG----IPGKRGQSGLDGEKGDIGNQGMKGDIGDK----GRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGE-----CSGRGEFGERGDVGPKGERGIKG----EQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVG---VIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKG 3378
            CIG+  GP G  G  G +G +G PG  G  G  GF      KG  G  G  G  G     G RGD+G  G  G  G  G  G  G +G +G +G+ G+      G  GD G  G +G+ G++G  G+ G  G  G P  TGL      KGE G  GL G+ G+ GP G  G  G        G  G  G  G  G +G  G  G  G  G++G  G PGN G  G  G  GD G+ G PG  G+   KG+KG      FP   GE+G  G  G +G  G+ G  G  G PG  G  G  G+ G  G+ P +               D   +   G  G +G KG   I G +G+ G  G  ++  VK       G +G  GEPGL+GP G  G  G  G +G                        F G+ G      G +G SG  G  GD G +G KGD+G      G +G +G+TG  G+      G +G  G  GE G  GL GI G  G QGE G  G  G+ G +GF G +G+ G+ G  G     GI+G  G+ G  GLKG  G  G KG+       G   +G+ G+ G KGE G  G      G+ G  G  G  G +G  GE G +G+ GP+G  G   + G +G+ G PG  G  G  G +G  GI    G  G +GN G  G  GEKG++  G RGEKG+ G  G  G KG+ GEPGM G          G++G  G  G FG KG
Sbjct:    1 CIGD-PGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGL------KGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSV--VK-------GVKGLPGEPGLEGPKGMPGPTGLPGIEG------------------------FPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGS-----TGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQ--GDRGEKGSSGESGVSGRKGDKGEPGMMGFP--------GRRGFQGDRGPFGPKG 703          

HSP 6 Score: 159.073 bits (401), Expect = 1.429e-38
Identity = 316/885 (35.71%), Postives = 404/885 (45.65%), Query Frame = 1
Query: 1609 VGPKGPKGEKGLSG---LDGKNGKVGPKGMKGL---LGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDI--GDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG---------------IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGE----SGDKGECSGRGEFGE------RGDVGPK----GERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGS-------------------KGETGPKGDFGEDGDKGN------------VGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGK 4041
            +G  GP GE GL G   L+G  G  GPKG  G    LG   +  + G  G  G KG  G +G  G  G  G  G  G  G+PG DGA G +G +G++     G PGD G+ G +GD+       + G+ G  G  G EG  G+ G  G +G PG+ G+ G+ G  G  G PG  G  G  G  G  G       G RG QGE G+    G KG  GD GN  +          +G  GD GE G  G  G  G+KG +G +G                          G PG  G+RG  G  G KG+IG  G +G  G  G  G KGD G  G PG                G KG+ G+ G+ G TG RG  G  G  G +G+ G  G+     P   KG+KG  G+PG  G K   G+ G +G PG++G  G +G      G+KG     G  G+      +GD+GP     G  G++GE G  G  G  G+ G  GE G  G  G+ G KG  G  G  G  G  G  G  G+ G KG +G  G+ G  G++G  G KG  G KG+    G +G+KGN GV G        G+PG  G+KG+ GETGI     S + G  GS G KG  G+ G+ G                  +IG+ G  G  G+ G    KG +G+ G  G KG+ G  G +G  GI      KG+ G +GD G  G+ G+ GD+G+KG  G  G  G +GD GE G  G  G  G +G+ GP G   PKG+TG                     GE GP G  G  G  G              GP G+KG+ G P   G  G RGE G+ G  G++GEQG  G PG  G +G  G+
Sbjct:    2 IGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDT------GLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGP--SGRRGDQGEPGLIGARGVKGAIGDPGNIGVT-------GNIGPPGDQGETGGPGFFGLPGLKGSKGGQG------------------------MTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGE-----PSVVKGVKGLPGEPGLEGPK---GMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGT----DNWGQPGNPGTKGELGETGI----PSTTTGVPGSLGHKGTTGDSGNKG------------------EIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFG---PKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGR 810          

HSP 7 Score: 153.295 bits (386), Expect = 7.174e-37
Identity = 258/779 (33.12%), Postives = 324/779 (41.59%), Query Frame = 1
Query: 1381 IGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGL------------------QGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKG--------------LSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSY---------------------GDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEG------------PKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGD------SGNCTINFVKPLNATEM----GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGK-RGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQ----GESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGV------QGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGP-----KGNVGVIGDRGETGKPGPI-GPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKG------------ESGSNGEFGSKGQKGM 3390
            IGD G  GESG  GPRG  GF G  G         K   G  GD GD+G                   +G+ G  G+KGVKG  G SG+P  GL G  G KGE G              L G  G  G  G  G+ G  G                   +G  G  GL G  G PG++G++GRPG  G  G  G                       GD G+ GL G +G+KGA GD      P   G  G+ GP G +G             KG KG  G+ G PG +G+ G  G  G                           +GE GL G +G K   G  G+KGD       G+  +  + P     M    GD G+ G+PG  GP G  G  G  G +G D                        G PG P   +G  GL GE G  G +GM G  G  G  G  G +G    P +  +GN+GS G  G  G  G+ G  GD+G      G +G +G+ G+ G  G KG+ G  G+ G  G   I+G+KG  GEPG        GL+GF G  G KG           GD G  G  GI+G+ G  G  G  G+ G  G  G+KG+QG+ G       GN G  G+ GETG P    G  G+ G KG  G  G +G +G +G  GP+G QG   ++ T+G  G  G  G+ G  G +G  G P   G+KGD G  G     G+KG            ESG +G  G KG+ GM
Sbjct:    2 IGDPGPPGESGLPGPRGLEGFPGVPGP--------KGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKP--GLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGM------------------EGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGD------PGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSG--------------------------TKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKD------------------------GHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSG----PKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRS---------GDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGM 683          

HSP 8 Score: 127.487 bits (319), Expect = 7.818e-29
Identity = 266/762 (34.91%), Postives = 340/762 (44.62%), Query Frame = 1
Query: 1963 GEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP----VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFV-KPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGN------------------QGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGIT---GDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVG----VIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVK----GNNGPKGDQGEKGLETKGQRGEKGNMG----VIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEG------LPGKIGRMGDKGKPG-------NGIEGPDGDIGNKG 4089
            G+ G  G  G  GP+G++G PG+ G  G +G  G +G KG+ G PG  G  G  G  G +G    P    V+G  GL G+ G+    G KGE G+    +      P      GD G TG+PGL G  G  G+ G  G KG                          G PG+ G++G+ G  G  G  G                    G +GD G+ G  GA+G  GAIG+PG IG+ GN G  G++GETG  G  G+    G  G QG +G  G  G  G KGF G KG  G PG       +G KG  G PG +G +G TG  GDK              + P  +  +KG +G +G+ G+ G  G  G  G  G  G  G  G+ G    V G +G  G+PG  GP G  GP G+ GI+G  GM G K    GN G  G  G  G    G +G KG++G    + G+ G +GE G PG  G+KG  G  G  ++G SG +G  G KG +G  G  G  G  G +G  G +G KG  GD G+ G+ G  G               + G KG  G+ G  GL G  LKG+ G  G  G                          G  G  G+KG  G+ G KG +G +G  GP+G  G     G +GD+G  G KG  G  G +G  G P   G  G+RG +G  G  G KG QG  G        G  GR GDKG+PG        G +G  G  G KG
Sbjct:    3 GDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGES------------------------GPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPG------HQGAKGAPGSPGQKGDRGLTGPPGDKPVI----------HITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPG--DSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPG--ERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQG---------------QPGQKGFPGLKGIFGLDG--LKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKG 703          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 369.392 bits (947), Expect = 2.017e-103
Identity = 553/1551 (35.65%), Postives = 711/1551 (45.84%), Query Frame = 1
Query:  979 VGDRGQKGDTGNVGNRGTPG-----PKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFG--------DKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHG--------PRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGR--PTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGN----PGIRGDRGR---PGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGI--KGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEM----GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA------KGDTGAIGNPGI------------------------GIKGNEGSRGEEGETGMRGL--PGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLA-------SLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
             G++G+KG  G  G RG PG      KG+PG  G +G  G DG  G KG++G  GI G  G  G  G+KGE GE+G           PQGP G        +  +KG++G+PG+ G+ G+KG KG  G  G  G  G   LPG  G  G  GE GE G HG        P+G  GF G  G  G  G    +++   G  GD GL G  G +G +G +G++G  G   P+  LV      G  G  G  G  G  G  G+ G+ G        G  G  G +G+ G  G  G  G  G     P ++GD+G    PG+ GA GREG  G  G +GLPG KG+ G  G   E+  P  +G  G+ G  G  GP G    G PG  G+PG+ G +G  G  G +G PG   +K                 G++G +G  G     G +GEKG+ G   + +  P          G  G  G PG QG  G  G++GD G KG  G+                      G+PG  G +G  G  G  GD GN G  G  G++G SG       KG+ G +G PGI                        G  G  G +GE G  G  GL  PG  GD GN G  G  G  G  G  G  G +G  G PGP G+  + G+ G  G+PG  G  G  GE GD G     G  G  G  G KGE G++GE G   +  +  M G  GE GE+G+ G++G KG++G  G  G  GK G  G  G +GPKG    KG QG+ G +G  G KG  GE GL   G  GEKG  G+ G+ G+ G  G  G +G KG+ G  GIG  G  G  G+ G  G  G+ GE+G                     D G++G  G  G  G  G  G  G  G  G  G  G  G  GL GI   G+ G  GD+G                  + G  G+ G+ GE G  G+ G  G KG  G  G +G  G+ G  GE G KGD G  G  G  G  G KG  G               P  + ++G +G +G PG+ G  G  G    G+ G  G  G KG +G++G  G  G +G  G++G QG  G  G  G  G  G+TG  G  G  G  G  GI GE G RGD G+ G KG  G  G  G+  +                             +GE GEPG  G  G +G  G P  +G KGV G  GL G SG     G  G KG  GP G  G+ G  G  G  G  G IG  G    ++   FL TRH Q  E  P CP G+  ++ GYS +   GN   +  +LG   SCL  F+ MPF  C+ +  C    R D SYWL+       S+AP+TGD      ++ +ISRC  CE PA   A HSQT  +    CP+ W  LW GYSFVM T+ G  G GQ+L+SPGSCL  FR  P +EC +G   CN++ +  S++L  ++    F+ P    +KA D ++      +SRC+VCM++
Sbjct:  236 YGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESG-----------PQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVP-LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVP----PGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPG-FPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----------------------GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGE---KGSQGIKGSQGLQGQKGSIGEMGL--PGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERG---------------------DKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIP--GQKGLTGDSG------------------VQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGP--VGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV----------------------------TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSP--SMAHGFLVTRHSQTTE-TPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGD-----GIKPFISRCTVCEVPAMVMAVHSQTIQIPQ--CPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIEC-HGRGTCNYYANTYSFWLATIEKNEMFKKPTPSTLKAGDLRT-----HVSRCQVCMRR 1654          

HSP 2 Score: 207.608 bits (527), Expect = 5.648e-53
Identity = 367/1093 (33.58%), Postives = 463/1093 (42.36%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIG-NPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMG-----LSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGN---------PGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPI--DGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG--------------------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPKGERGIKGEQGINGDKGES------------GMIGRTGENGEKGDQGLNGPKGNVGVIG-------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG 3327
             +G PG KG+ G +   P   G KG +G  G  GA G  G  G +GQ GLPG +G +G                 G +G+ GLPG  G+ G  G  G  G  G     L G+KG  G  G++G PG      KGE G A  +           I      GDQG+KG  G  G  G  G  GEPG    G+      G+PGP G+ G                                      G PG  G  G  G +G  G  G RG PGPKG+PG     G+ G  GV      +G  G  G  G  GN G+ G  GE G SG          G  G KG+ G  G+PG QG  G  G                    G  G  G  G  G +G  G RG  GF G                 + G  GD+G  G  G +G+ G+ G+ G  G+   GL G  GPKGE G+ G+ G  G+ G  G  G LG        G  G  G  G +GEKG++GL G  G           G +G++G  G  G  G +GS GD G  G PG  G +G +G+S               GP G++G +GIKGS GL G+ G  G+MG  G  G++G                       ++GE+GL+GE G+  I   G  G KGD+G    + +      E GD+GD G PG+ G        G +GA G                          G+PG PG  G+ G  G  G +G  G KG  GD G  G  G +G  G PG  GI G+ G +GE G  G RGLPG  G+ G +G  G+ G  G  G  G  GIKG+ G                      GP G+K   G  G  G PG  GL G TG+ G KGE   RG  G       +GD G +G  G  G  GI G KG++            G +G +GE G++GDQG+ GPKG++G  G        +GE+G+PGP GP G  G +G+ G KG++G+ G  G  GP G  G       G  G+KG  G  G  G  G  G PG  G  G  G  G
Sbjct:  506 LMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAG---------------TIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGT--PGAKGEPGKAIIKTGPPGPMGGAGIPG--FPGDQGEKGSPGHPGRPGSQGEKGEPGL--PGV------GYPGPSGEKGFQ------------------------------------GMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPG----LGLPGPKGV------QGPPGPVGIPGDKGNPGASGVPGEQGFSGV--------PGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQ-------------GSSGPQGLSGFPGPAGVKGERGYAGFPGLD---------------MPGPKGDKGNIGSPGPTGATGIPGQPGAPGK--EGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGES---------------GPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQ--------HGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGL----PGERGDKGDVGIPGMPG------FPGSKGATG------------------------HAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPG-----IHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1424          

HSP 3 Score: 199.134 bits (505), Expect = 2.261e-50
Identity = 390/1221 (31.94%), Postives = 496/1221 (40.62%), Query Frame = 1
Query:  214 VCTQNTCRCVGIPGPKGDYGRIGN--------------PGPIGPKGYTGNMGELGARGLVGDS--GSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMG---------------------------LSGDKGVKGDKGYI------------------------GEPGD-FFQAK-KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNR-GSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGE-----------------------NGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIK-----------GDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPK---------GPKGEKGLSGLDGKNGK------VGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGR---------EGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGE---KGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIK--PIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG--------------------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPKGERGIKGEQGINGDKGES------------GMIGRTGENGEKGDQGLNGPKGNVGVIG-------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQ 3336
            VC +      G PG KGD G  G               PG  GP G+ G  GE G  GL G +  G  G+D              P    D       G  GD GLPG  G NG +G  G  G  G                            SG  G+KGD+G+                         GEPG+ FF+ + KG+KG +G  G  G  G +G  G  G  G  G KG+ G +G +G  G+ G+ G         GE+GFPGP G                                            G  G  G++G+ G  G VG  GTPG KG+PG    K                    +        R GS+GE GE G  G       G  GP G+KG +G  G PG  G  G +G  G               LPG RGD G KGE                        G  GA G  G+ GF+G  G  G  G+ G   V GI+           G  G  G QG  G  G  GVKGERG +G P   + GPK         GP G  G+ G  G  GK       GPKG  G++G    + + G  G  G  G +G+ G  G  G  G PG +G++G  G  G  G+         +GS G+ G+RG  G  G KG+ GD      P   G+   +G++GP G++G +GIKGS GL G+ G  G+MG  G  G++G                       ++GE+GL+GE G+    I G  G KGD+G    + +      E GD+GD G PG+       G  G +GA G                          G+PG PG  G+ G  G  G +G  G KG  GD G  G  G +G  G PG  GI G+ G +GE G  G RGLPG  G+ G +G  G+ G  G  G  G  GIKG+ G                      GP G+K   G  G  G PG  GL G TG+ G KGE   RG  G       +GD G +G  G  G  GI G KG++            G +G +GE G++GDQG+ GPKG++G  G        +GE+G+PGP GP G  G +G+ G KG++G+ G  G  GP G  G  G  T GQ+GE G  G  G  G  G  G  G+ G  G  G   +  
Sbjct:  327 VCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRD----GFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSP----GNPGERGFPGPAGT-------------------------------------------GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV------GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDG---------------LPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQ--------HGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGL----PGERGDKGDVGIPGMP------GFPGSKGATG------------------------HAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHG--TPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAH 1430          

HSP 4 Score: 152.14 bits (383), Expect = 3.971e-36
Identity = 331/975 (33.95%), Postives = 429/975 (44.00%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGE--SXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKM----------------GLSGDKGVKGDKGYIGEPGDFFQAKKGEKG-----FAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP-----IGMSGEPGDQ--------------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRG--------QKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGP--FGDKGDKGNQGIPG---YQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIK-----------------PIDGEKGEKGDSGNCTIN-----FVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGD---------------IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGI--KGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG 2883
            G+PG  G  GR G PG        G  G  G++G+ G  G+ G+ GLPGDRG   +            G  GL G++G+ G+PG  G  G  G  G  GK                 G  GD+G KG  G+ G PG   Q +KGE G     + G  G  G +G  G  G+ G  G QG  G+ G  GD GP     +G+ G  G Q              P      GE+GF G  G  G   +  ++ G             G  GQ+G +G +G++G PG  G  G+RG          G  G+ GN G+PGP G  G  G  G  G +G+ GF                   G KGE+G  G  G  IG    P  P   G+KGD G  G PG   Y G  GEKG +G+ G  G + +     + G +G+ G++GE G SG  G  GDFG  G  G +G         +G++G+SG +G +G +GI GS+G++G++G  G    GL GP G KG+ G+SG  G  G  G KG KGL G          IG  G+ G +G+ G+DG  G  G  G +GD G PG  G  G +G+ G  G  G PG  G KGAKG       P  KG  GD+G  G  G  G KG PG +G PG  G+ G+ G+ G  G PG  G  GE G KG  G    P + G  G++G++G+                  P++G KGEKG  G             P +  + G +G+ GE G  G  G  G KGD G +G                                G  G SG+ G+KGD               +G  G KGD GD+G +G KGD G  G  G     KG  G  G +G +G RG+ G+ G  G++G +G  G  G   P G  GI G  G+ G  G     G  G  G PG  GL G  G  G      G
Sbjct:  533 GLPGHPGAPGREGRPG------IDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGS--QGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV-GVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFP------------------GPKGEMGVMGMPGS-IGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQ--------QGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGE--MGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEV----GLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPS------------------------------GDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPG---PSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHG 1431          

HSP 5 Score: 91.2781 bits (225), Expect = 1.606e-17
Identity = 233/732 (31.83%), Postives = 292/732 (39.89%), Query Frame = 1
Query: 1687 MKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDR---------------GRPGNDGAIGREGSYGDIGDRGLPGDKG------------IKGAKGD------SREETFPSIKGEKGDNGPDGKEGP---------KGIKGSPGLN------------------------------GKPGISGDM-----GKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG--LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGS---RGEEGETGMRGLPGITG----------------------DIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKT---------------------------IKGIKGDSGE------------PGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGA--TGPKGINGIKGEQGM---MGVKGNNGPKGDQGEKGLET--------------KGQRGEKGNMGVIGNVGAKGELGEPGMR--GSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            M   +  AC  C        G+KG +GE+G  GL G  G PG++G                 G PG  G  G  GS+G  G+ GLPG  G              G KGD                G  G  GP G+ G          KG KG PG+N                              G PG  G+M     G  G +GD G P         G       + +  + E+   GEKG K + GE GE+G  G                 +G+ GEPG  GP GK G  GDQG KG  G+ G  G PG PG  G KG KG  G  G PG    +G     EKGD G  G  G  GDKG  GA+G  G  G+PG+ + G+ G     GE GE G  GLPG+                        D   + +SG+ GD G  G  G  G +G  G+ G  GD                             + GIKGD G              G  GL G  G  G+ GE      F E    G KGE G+ G  G  G +G  G+ G+ G  G KG  G  G KG  G+ GDRG  G PG  G  G   TG  G+ G KGE G+   +G+ G  G KG+ G+  ++T               G +GEKG+ G  G  G++GE GEPG+   G  G +GE G   +G  G+ G+ G  G +G+
Sbjct:    3 MMNYIAKACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPP---------GAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSF--------------KGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEV-----FFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGF--QGMPGTPGQAGFPGPQGV 704          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 369.007 bits (946), Expect = 3.037e-103
Identity = 553/1551 (35.65%), Postives = 711/1551 (45.84%), Query Frame = 1
Query:  979 VGDRGQKGDTGNVGNRGTPG-----PKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFG--------DKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHG--------PRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGR--PTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGN----PGIRGDRGR---PGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGI--KGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEM----GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA------KGDTGAIGNPGI------------------------GIKGNEGSRGEEGETGMRGL--PGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLA-------SLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
             G++G+KG  G  G RG PG      KG+PG  G +G  G DG  G KG++G  GI G  G  G  G+KGE GE+G           PQGP G        +  +KG++G+PG+ G+ G+KG KG  G  G  G  G   LPG  G  G  GE GE G HG        P+G  GF G  G  G  G    +++   G  GD GL G  G +G +G +G++G  G   P+  LV      G  G  G  G  G  G  G+ G+ G        G  G  G +G+ G  G  G  G  G     P ++GD+G    PG+ GA GREG  G  G +GLPG KG+ G  G   E+  P  +G  G+ G  G  GP G    G PG  G+PG+ G +G  G  G +G PG   +K                 G++G +G  G     G +GEKG+ G   + +  P          G  G  G PG QG  G  G++GD G KG  G+                      G+PG  G +G  G  G  GD GN G  G  G++G SG       KG+ G +G PGI                        G  G  G +GE G  G  GL  PG  GD GN G  G  G  G  G  G  G +G  G PGP G+  + G+ G  G+PG  G  G  GE GD G     G  G  G  G KGE G++GE G   +  +  M G  GE GE+G+ G++G KG++G  G  G  GK G  G  G +GPKG    KG QG+ G +G  G KG  GE GL   G  GEKG  G+ G+ G+ G  G  G +G KG+ G  GIG  G  G  G+ G  G  G+ GE+G                     D G++G  G  G  G  G  G  G  G  G  G  G  G  GL GI   G+ G  GD+G                  + G  G+ G+ GE G  G+ G  G KG  G  G +G  G+ G  GE G KGD G  G  G  G  G KG  G               P  + ++G +G +G PG+ G  G  G    G+ G  G  G KG +G++G  G  G +G  G++G QG  G  G  G  G  G+TG  G  G  G  G  GI GE G RGD G+ G KG  G  G  G+  +                             +GE GEPG  G  G +G  G P  +G KGV G  GL G SG     G  G KG  GP G  G+ G  G  G  G  G IG  G    ++   FL TRH Q  E  P CP G+  ++ GYS +   GN   +  +LG   SCL  F+ MPF  C+ +  C    R D SYWL+       S+AP+TGD      ++ +ISRC  CE PA   A HSQT  +    CP+ W  LW GYSFVM T+ G  G GQ+L+SPGSCL  FR  P +EC +G   CN++ +  S++L  ++    F+ P    +KA D ++      +SRC+VCM++
Sbjct:  249 YGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESG-----------PQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVP-LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVP----PGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPG-FPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----------------------GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGE---KGSQGIKGSQGLQGQKGSIGEMGL--PGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERG---------------------DKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIP--GQKGLTGDSG------------------VQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGP--VGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV----------------------------TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSP--SMAHGFLVTRHSQTTE-TPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGD-----GIKPFISRCTVCEVPAMVMAVHSQTIQIPQ--CPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIEC-HGRGTCNYYANTYSFWLATIEKNEMFKKPTPSTLKAGDLRT-----HVSRCQVCMRR 1667          

HSP 2 Score: 203.756 bits (517), Expect = 7.929e-52
Identity = 356/1034 (34.43%), Postives = 457/1034 (44.20%), Query Frame = 1
Query:  454 LFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP--IGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXX-XXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKG--QPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENG--------------ESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGN---------PGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPI--DGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG--------------------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPKGERGIKGEQGINGDKGES------------GMIGRTGENGEKGDQGLNGPKGNVGVIG-------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG 3327
            L GD+G+ GLPG  G  G +G  G+ G+ GL G KGV G  G            KGE+G                     + GD+G  G  G+ G  GP   G SG PG+       KGE G PG +G  GT            P  +G+ G+   + G  G  G  GI G PG  G  G  G  G  G+ G +G PG  G   PG  G KG +G  G  G  G  G +G+ G  G  G+ G KGE G      K +    GP G  GDKG+ G  G+PG QG  G  G                   PG +G+ G  G  G              + G+ GP+G  GF G AG +G+ G  G     + G  GD+G  G  G +G+ G+ G+ G  G+   GL G  GPKGE G+ G+ G  G+ G  G  G LG        G  G  G  G +GEKG++GL G  G           G +G++G  G  G  G +GS GD G  G PG  G +G +G+S               GP G++G +GIKGS GL G+ G  G+MG  G  G++G                       ++GE+GL+GE G+  I   G  G KGD+G    + +      E GD+GD G PG+ G        G +GA G                          G+PG PG  G+ G  G  G +G  G KG  GD G  G  G +G  G PG  GI G+ G +GE G  G RGLPG  G+ G +G  G+ G  G  G  G  GIKG+ G                      GP G+K   G  G  G PG  GL G TG+ G KGE   RG  G       +GD G +G  G  G  GI G KG++            G +G +GE G++GDQG+ GPKG++G  G        +GE+G+PGP GP G  G +G+ G KG++G+ G  G  GP G  G       G  G+KG  G  G  G  G  G PG  G  G  G  G
Sbjct:  538 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIG-----------AKGEQG---------------------LPGDRGSPGNPGERGFPGPAGTGTSGLPGE-------KGEPGVPGFVGIPGT------------PGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGH------------------PGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGK--EGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGES---------------GPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQ--------HGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGL----PGERGDKGDVGIPGMPG------FPGSKGATG------------------------HAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPG-----IHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1437          

HSP 3 Score: 199.134 bits (505), Expect = 2.225e-50
Identity = 390/1221 (31.94%), Postives = 496/1221 (40.62%), Query Frame = 1
Query:  214 VCTQNTCRCVGIPGPKGDYGRIGN--------------PGPIGPKGYTGNMGELGARGLVGDS--GSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMG---------------------------LSGDKGVKGDKGYI------------------------GEPGD-FFQAK-KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNR-GSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGE-----------------------NGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIK-----------GDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPK---------GPKGEKGLSGLDGKNGK------VGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGR---------EGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGE---KGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIK--PIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG--------------------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPKGERGIKGEQGINGDKGES------------GMIGRTGENGEKGDQGLNGPKGNVGVIG-------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQ 3336
            VC +      G PG KGD G  G               PG  GP G+ G  GE G  GL G +  G  G+D              P    D       G  GD GLPG  G NG +G  G  G  G                            SG  G+KGD+G+                         GEPG+ FF+ + KG+KG +G  G  G  G +G  G  G  G  G KG+ G +G +G  G+ G+ G         GE+GFPGP G                                            G  G  G++G+ G  G VG  GTPG KG+PG    K                    +        R GS+GE GE G  G       G  GP G+KG +G  G PG  G  G +G  G               LPG RGD G KGE                        G  GA G  G+ GF+G  G  G  G+ G   V GI+           G  G  G QG  G  G  GVKGERG +G P   + GPK         GP G  G+ G  G  GK       GPKG  G++G    + + G  G  G  G +G+ G  G  G  G PG +G++G  G  G  G+         +GS G+ G+RG  G  G KG+ GD      P   G+   +G++GP G++G +GIKGS GL G+ G  G+MG  G  G++G                       ++GE+GL+GE G+    I G  G KGD+G    + +      E GD+GD G PG+       G  G +GA G                          G+PG PG  G+ G  G  G +G  G KG  GD G  G  G +G  G PG  GI G+ G +GE G  G RGLPG  G+ G +G  G+ G  G  G  G  GIKG+ G                      GP G+K   G  G  G PG  GL G TG+ G KGE   RG  G       +GD G +G  G  G  GI G KG++            G +G +GE G++GDQG+ GPKG++G  G        +GE+G+PGP GP G  G +G+ G KG++G+ G  G  GP G  G  G  T GQ+GE G  G  G  G  G  G  G+ G  G  G   +  
Sbjct:  340 VCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRD----GFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSP----GNPGERGFPGPAGT-------------------------------------------GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV------GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDG---------------LPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQ--------HGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGL----PGERGDKGDVGIPGMP------GFPGSKGATG------------------------HAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHG--TPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAH 1443          

HSP 4 Score: 152.14 bits (383), Expect = 4.649e-36
Identity = 331/975 (33.95%), Postives = 429/975 (44.00%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGE--SXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKM----------------GLSGDKGVKGDKGYIGEPGDFFQAKKGEKG-----FAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP-----IGMSGEPGDQ--------------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRG--------QKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGP--FGDKGDKGNQGIPG---YQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIK-----------------PIDGEKGEKGDSGNCTIN-----FVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGD---------------IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGI--KGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG 2883
            G+PG  G  GR G PG        G  G  G++G+ G  G+ G+ GLPGDRG   +            G  GL G++G+ G+PG  G  G  G  G  GK                 G  GD+G KG  G+ G PG   Q +KGE G     + G  G  G +G  G  G+ G  G QG  G+ G  GD GP     +G+ G  G Q              P      GE+GF G  G  G   +  ++ G             G  GQ+G +G +G++G PG  G  G+RG          G  G+ GN G+PGP G  G  G  G  G +G+ GF                   G KGE+G  G  G  IG    P  P   G+KGD G  G PG   Y G  GEKG +G+ G  G + +     + G +G+ G++GE G SG  G  GDFG  G  G +G         +G++G+SG +G +G +GI GS+G++G++G  G    GL GP G KG+ G+SG  G  G  G KG KGL G          IG  G+ G +G+ G+DG  G  G  G +GD G PG  G  G +G+ G  G  G PG  G KGAKG       P  KG  GD+G  G  G  G KG PG +G PG  G+ G+ G+ G  G PG  G  GE G KG  G    P + G  G++G++G+                  P++G KGEKG  G             P +  + G +G+ GE G  G  G  G KGD G +G                                G  G SG+ G+KGD               +G  G KGD GD+G +G KGD G  G  G     KG  G  G +G +G RG+ G+ G  G++G +G  G  G   P G  GI G  G+ G  G     G  G  G PG  GL G  G  G      G
Sbjct:  546 GLPGHPGAPGREGRPG------IDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGS--QGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV-GVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFP------------------GPKGEMGVMGMPGS-IGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQ--------QGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGE--MGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEV----GLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPS------------------------------GDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPG---PSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHG 1444          

HSP 5 Score: 88.9669 bits (219), Expect = 8.123e-17
Identity = 232/726 (31.96%), Postives = 290/726 (39.94%), Query Frame = 1
Query: 1705 TACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDR---------------GRPGNDGAIGREGSYGDIGDRGLPGDKG------------IKGAKGD------SREETFPSIKGEKGDNGPDGKEGP---------KGIKGSPGLN------------------------------GKPGISGDM-----GKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG--LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGS---RGEEGETGMRGLPGITG----------------------DIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKT---------------------------IKGIKGDSGE------------PGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGA--TGPKGINGIKGEQGM---MGVKGNNGPKGDQGEKGLET--------------KGQRGEKGNMGVIGNVGAKGELGEPGMR--GSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
             AC  C        G+KG +GE+G  GL G  G PG++G                 G PG  G  G  GS+G  G+ GLPG  G              G KGD                G  G  GP G+ G          KG KG PG+N                              G PG  G+M     G  G +GD G P         G       + +  + E+   GEKG K + GE GE+G  G                 +G+ GEPG  GP GK G  GDQG KG  G+ G  G PG PG  G KG KG  G  G PG    +G     EKGD G  G  G  GDKG  GA+G  G  G+PG+ + G+ G     GE GE G  GLPG+                        D   + +SG+ GD G  G  G  G +G  G+ G  GD                             + GIKGD G              G  GL G  G  G+ GE      F E    G KGE G+ G  G  G +G  G+ G+ G  G KG  G  G KG  G+ GDRG  G PG  G  G   TG  G+ G KGE G+   +G+ G  G KG+ G+  ++T               G +GEKG+ G  G  G++GE GEPG+   G  G +GE G   +G  G+ G+ G  G +G+
Sbjct:   22 AACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPP---------GAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSF--------------KGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEV-----FFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGF--QGMPGTPGQAGFPGPQGV 717          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 369.007 bits (946), Expect = 3.037e-103
Identity = 553/1551 (35.65%), Postives = 711/1551 (45.84%), Query Frame = 1
Query:  979 VGDRGQKGDTGNVGNRGTPG-----PKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFG--------DKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHG--------PRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGR--PTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGN----PGIRGDRGR---PGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGI--KGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEM----GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA------KGDTGAIGNPGI------------------------GIKGNEGSRGEEGETGMRGL--PGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLA-------SLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
             G++G+KG  G  G RG PG      KG+PG  G +G  G DG  G KG++G  GI G  G  G  G+KGE GE+G           PQGP G        +  +KG++G+PG+ G+ G+KG KG  G  G  G  G   LPG  G  G  GE GE G HG        P+G  GF G  G  G  G    +++   G  GD GL G  G +G +G +G++G  G   P+  LV      G  G  G  G  G  G  G+ G+ G        G  G  G +G+ G  G  G  G  G     P ++GD+G    PG+ GA GREG  G  G +GLPG KG+ G  G   E+  P  +G  G+ G  G  GP G    G PG  G+PG+ G +G  G  G +G PG   +K                 G++G +G  G     G +GEKG+ G   + +  P          G  G  G PG QG  G  G++GD G KG  G+                      G+PG  G +G  G  G  GD GN G  G  G++G SG       KG+ G +G PGI                        G  G  G +GE G  G  GL  PG  GD GN G  G  G  G  G  G  G +G  G PGP G+  + G+ G  G+PG  G  G  GE GD G     G  G  G  G KGE G++GE G   +  +  M G  GE GE+G+ G++G KG++G  G  G  GK G  G  G +GPKG    KG QG+ G +G  G KG  GE GL   G  GEKG  G+ G+ G+ G  G  G +G KG+ G  GIG  G  G  G+ G  G  G+ GE+G                     D G++G  G  G  G  G  G  G  G  G  G  G  G  GL GI   G+ G  GD+G                  + G  G+ G+ GE G  G+ G  G KG  G  G +G  G+ G  GE G KGD G  G  G  G  G KG  G               P  + ++G +G +G PG+ G  G  G    G+ G  G  G KG +G++G  G  G +G  G++G QG  G  G  G  G  G+TG  G  G  G  G  GI GE G RGD G+ G KG  G  G  G+  +                             +GE GEPG  G  G +G  G P  +G KGV G  GL G SG     G  G KG  GP G  G+ G  G  G  G  G IG  G    ++   FL TRH Q  E  P CP G+  ++ GYS +   GN   +  +LG   SCL  F+ MPF  C+ +  C    R D SYWL+       S+AP+TGD      ++ +ISRC  CE PA   A HSQT  +    CP+ W  LW GYSFVM T+ G  G GQ+L+SPGSCL  FR  P +EC +G   CN++ +  S++L  ++    F+ P    +KA D ++      +SRC+VCM++
Sbjct:  249 YGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESG-----------PQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVP-LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVP----PGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPG-FPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----------------------GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGE---KGSQGIKGSQGLQGQKGSIGEMGL--PGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERG---------------------DKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIP--GQKGLTGDSG------------------VQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGP--VGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV----------------------------TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSP--SMAHGFLVTRHSQTTE-TPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGD-----GIKPFISRCTVCEVPAMVMAVHSQTIQIPQ--CPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIEC-HGRGTCNYYANTYSFWLATIEKNEMFKKPTPSTLKAGDLRT-----HVSRCQVCMRR 1667          

HSP 2 Score: 203.756 bits (517), Expect = 7.929e-52
Identity = 356/1034 (34.43%), Postives = 457/1034 (44.20%), Query Frame = 1
Query:  454 LFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP--IGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXX-XXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKG--QPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENG--------------ESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGN---------PGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPI--DGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG--------------------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPKGERGIKGEQGINGDKGES------------GMIGRTGENGEKGDQGLNGPKGNVGVIG-------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG 3327
            L GD+G+ GLPG  G  G +G  G+ G+ GL G KGV G  G            KGE+G                     + GD+G  G  G+ G  GP   G SG PG+       KGE G PG +G  GT            P  +G+ G+   + G  G  G  GI G PG  G  G  G  G  G+ G +G PG  G   PG  G KG +G  G  G  G  G +G+ G  G  G+ G KGE G      K +    GP G  GDKG+ G  G+PG QG  G  G                   PG +G+ G  G  G              + G+ GP+G  GF G AG +G+ G  G     + G  GD+G  G  G +G+ G+ G+ G  G+   GL G  GPKGE G+ G+ G  G+ G  G  G LG        G  G  G  G +GEKG++GL G  G           G +G++G  G  G  G +GS GD G  G PG  G +G +G+S               GP G++G +GIKGS GL G+ G  G+MG  G  G++G                       ++GE+GL+GE G+  I   G  G KGD+G    + +      E GD+GD G PG+ G        G +GA G                          G+PG PG  G+ G  G  G +G  G KG  GD G  G  G +G  G PG  GI G+ G +GE G  G RGLPG  G+ G +G  G+ G  G  G  G  GIKG+ G                      GP G+K   G  G  G PG  GL G TG+ G KGE   RG  G       +GD G +G  G  G  GI G KG++            G +G +GE G++GDQG+ GPKG++G  G        +GE+G+PGP GP G  G +G+ G KG++G+ G  G  GP G  G       G  G+KG  G  G  G  G  G PG  G  G  G  G
Sbjct:  538 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIG-----------AKGEQG---------------------LPGDRGSPGNPGERGFPGPAGTGTSGLPGE-------KGEPGVPGFVGIPGT------------PGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGH------------------PGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGK--EGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGES---------------GPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQ--------HGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGL----PGERGDKGDVGIPGMPG------FPGSKGATG------------------------HAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPG-----IHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1437          

HSP 3 Score: 199.134 bits (505), Expect = 2.225e-50
Identity = 390/1221 (31.94%), Postives = 496/1221 (40.62%), Query Frame = 1
Query:  214 VCTQNTCRCVGIPGPKGDYGRIGN--------------PGPIGPKGYTGNMGELGARGLVGDS--GSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMG---------------------------LSGDKGVKGDKGYI------------------------GEPGD-FFQAK-KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNR-GSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGE-----------------------NGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIK-----------GDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPK---------GPKGEKGLSGLDGKNGK------VGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGR---------EGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGE---KGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIK--PIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG--------------------KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGE------RGDVGPKGERGIKGEQGINGDKGES------------GMIGRTGENGEKGDQGLNGPKGNVGVIG-------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQ 3336
            VC +      G PG KGD G  G               PG  GP G+ G  GE G  GL G +  G  G+D              P    D       G  GD GLPG  G NG +G  G  G  G                            SG  G+KGD+G+                         GEPG+ FF+ + KG+KG +G  G  G  G +G  G  G  G  G KG+ G +G +G  G+ G+ G         GE+GFPGP G                                            G  G  G++G+ G  G VG  GTPG KG+PG    K                    +        R GS+GE GE G  G       G  GP G+KG +G  G PG  G  G +G  G               LPG RGD G KGE                        G  GA G  G+ GF+G  G  G  G+ G   V GI+           G  G  G QG  G  G  GVKGERG +G P   + GPK         GP G  G+ G  G  GK       GPKG  G++G    + + G  G  G  G +G+ G  G  G  G PG +G++G  G  G  G+         +GS G+ G+RG  G  G KG+ GD      P   G+   +G++GP G++G +GIKGS GL G+ G  G+MG  G  G++G                       ++GE+GL+GE G+    I G  G KGD+G    + +      E GD+GD G PG+       G  G +GA G                          G+PG PG  G+ G  G  G +G  G KG  GD G  G  G +G  G PG  GI G+ G +GE G  G RGLPG  G+ G +G  G+ G  G  G  G  GIKG+ G                      GP G+K   G  G  G PG  GL G TG+ G KGE   RG  G       +GD G +G  G  G  GI G KG++            G +G +GE G++GDQG+ GPKG++G  G        +GE+G+PGP GP G  G +G+ G KG++G+ G  G  GP G  G  G  T GQ+GE G  G  G  G  G  G  G+ G  G  G   +  
Sbjct:  340 VCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRD----GFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSP----GNPGERGFPGPAGT-------------------------------------------GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV------GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDG---------------LPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQ--------HGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGL----PGERGDKGDVGIPGMP------GFPGSKGATG------------------------HAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHG--TPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAH 1443          

HSP 4 Score: 152.14 bits (383), Expect = 4.649e-36
Identity = 331/975 (33.95%), Postives = 429/975 (44.00%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGE--SXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKM----------------GLSGDKGVKGDKGYIGEPGDFFQAKKGEKG-----FAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP-----IGMSGEPGDQ--------------PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRG--------QKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGP--FGDKGDKGNQGIPG---YQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIK-----------------PIDGEKGEKGDSGNCTIN-----FVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGD---------------IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGI--KGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG 2883
            G+PG  G  GR G PG        G  G  G++G+ G  G+ G+ GLPGDRG   +            G  GL G++G+ G+PG  G  G  G  G  GK                 G  GD+G KG  G+ G PG   Q +KGE G     + G  G  G +G  G  G+ G  G QG  G+ G  GD GP     +G+ G  G Q              P      GE+GF G  G  G   +  ++ G             G  GQ+G +G +G++G PG  G  G+RG          G  G+ GN G+PGP G  G  G  G  G +G+ GF                   G KGE+G  G  G  IG    P  P   G+KGD G  G PG   Y G  GEKG +G+ G  G + +     + G +G+ G++GE G SG  G  GDFG  G  G +G         +G++G+SG +G +G +GI GS+G++G++G  G    GL GP G KG+ G+SG  G  G  G KG KGL G          IG  G+ G +G+ G+DG  G  G  G +GD G PG  G  G +G+ G  G  G PG  G KGAKG       P  KG  GD+G  G  G  G KG PG +G PG  G+ G+ G+ G  G PG  G  GE G KG  G    P + G  G++G++G+                  P++G KGEKG  G             P +  + G +G+ GE G  G  G  G KGD G +G                                G  G SG+ G+KGD               +G  G KGD GD+G +G KGD G  G  G     KG  G  G +G +G RG+ G+ G  G++G +G  G  G   P G  GI G  G+ G  G     G  G  G PG  GL G  G  G      G
Sbjct:  546 GLPGHPGAPGREGRPG------IDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGS--QGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV-GVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFP------------------GPKGEMGVMGMPGS-IGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQ--------QGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGE--MGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEV----GLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPS------------------------------GDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPG---PSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHG 1444          

HSP 5 Score: 88.9669 bits (219), Expect = 8.123e-17
Identity = 232/726 (31.96%), Postives = 290/726 (39.94%), Query Frame = 1
Query: 1705 TACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDR---------------GRPGNDGAIGREGSYGDIGDRGLPGDKG------------IKGAKGD------SREETFPSIKGEKGDNGPDGKEGP---------KGIKGSPGLN------------------------------GKPGISGDM-----GKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG--LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGS---RGEEGETGMRGLPGITG----------------------DIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKT---------------------------IKGIKGDSGE------------PGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGA--TGPKGINGIKGEQGM---MGVKGNNGPKGDQGEKGLET--------------KGQRGEKGNMGVIGNVGAKGELGEPGMR--GSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
             AC  C        G+KG +GE+G  GL G  G PG++G                 G PG  G  G  GS+G  G+ GLPG  G              G KGD                G  G  GP G+ G          KG KG PG+N                              G PG  G+M     G  G +GD G P         G       + +  + E+   GEKG K + GE GE+G  G                 +G+ GEPG  GP GK G  GDQG KG  G+ G  G PG PG  G KG KG  G  G PG    +G     EKGD G  G  G  GDKG  GA+G  G  G+PG+ + G+ G     GE GE G  GLPG+                        D   + +SG+ GD G  G  G  G +G  G+ G  GD                             + GIKGD G              G  GL G  G  G+ GE      F E    G KGE G+ G  G  G +G  G+ G+ G  G KG  G  G KG  G+ GDRG  G PG  G  G   TG  G+ G KGE G+   +G+ G  G KG+ G+  ++T               G +GEKG+ G  G  G++GE GEPG+   G  G +GE G   +G  G+ G+ G  G +G+
Sbjct:   22 AACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPP---------GAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSF--------------KGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEV-----FFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGF--QGMPGTPGQAGFPGPQGV 717          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 227.254 bits (578), Expect = 5.397e-59
Identity = 129/370 (34.86%), Postives = 185/370 (50.00%), Query Frame = 1
Query: 4282 RGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            RGD+G  G+KG  G  G M    ++ A+                   +   G +G +G PG  G+ G +G  G P    P G +GEQG  G +G   G  G  G  G  G                       G  G+++   +L  +H Q  EE P+CP+G  +++ GYS +   G  + +  +LG   SCL  F+ MPF  C+    C    R D+SYWL++ AP+    +  + +  YISRC  CE+PA   A HSQ  ++S   CP+ W  LW GYSF+MHT  G+ GGGQSLSSPGSCL  FR +P +ECN G   C+++ +  S++L  +D  F+        A+  K+  +   +SRC+VCMK
Sbjct: 1384 RGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGV----QGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTG-PNGFKGASGVPGRAGL---------------------PGMPGRSVNIGYLLVKHSQTDEE-PMCPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYCNPGDVCYYANRNDKSYWLSTTAPLPMMPVVEEEIRPYISRCSVCEAPAVAIAVHSQ--DVSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIDEPFQ----SSPPADTLKAGLIRTHISRCQVCMK 1720          

HSP 2 Score: 224.172 bits (570), Expect = 5.004e-58
Identity = 463/1382 (33.50%), Postives = 584/1382 (42.26%), Query Frame = 1
Query:  253 GPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMG----LSGDKGVKGDKGYIGEPGD--FFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVG----DQGPIGMSGEPGDQPKG---------IAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGD-RGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEK-----------GISGSKGVKGE---RGPSGRP-TTGLVGPK-----------------------------------------GPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD--------IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQG--------------MKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGI-TGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGI---NGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVG-AKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGP-------KGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGK 4041
            G KGD G  GNPG  G    TG  GE G  G  G  G  G DG  G  GE                   G  G  G+PG  GT G+KG  G  G  G    ++G +  KG +G IG PG    +              +       G  G  G+ G +G KG +GD G      GP G+ G PG +            I  KG  GFPG  G  G             P  RG                       G+ G  G+ R  +GD    G  G PGP G PG +G  G +G  G                     +RG +G  G  G  G  +    G  GP G+KGDK      G +G  G+ GF G               +PG+ G  G  G +G  G  GP GD                   +KG+ G  G  GL G             G  GSKG++GE   RG SG P   GL GP+                                         G +G+KG  G  G +G  G KG+KG  GT             G  G  G++G  G AG  G PG+ G  G+PG  G  G +GS GD         G+ GLPG +G+KG +GD        I G +G  G  G  G KGIKGSPG  G PGI G     G  G  GNPG  G +G +G  G  G      +GE+G  G  G+K + GE G  G                 +G RG  G PG+ G +G  G+ G +G KGS G+ G +G  G  G    +G KG  G  G PG +G +G  G KGD G QG               KG+ GD+G SG KG +        G+KG++G  G  G+ G+ GLPG+ + + G++GE+G  G IGN G  G  G  G  G PG  G +   GI G  G PG +G  G  GE GD  +  G RG  G+ G  G  G+RGI GE+G  GD+G  G+ G  GE+G+ G++G  G +G VG  G +G  G PG  G  G++G  G+   +G  G +G+ G+ G  G KG  G+ G +  G +G KG  G  G  G A   +G PG  GSKG  G+ G    IG  G  G  G  G   + G+ G+ G  GP G  G  G  G  G     G  G  G +G  G  G KG  G+ GK G  GL+GI G KGL G        G SG  GD GP                     +G  GDIGE G KG  G+ GP           G  G  G  G+ G +G+ GPKG  G  G  G  G +G  G+ G       G+RGE G  G+ G  G +G  G+PG+ G  G  G+
Sbjct:  285 GAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGE------------------IGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGA------------PGSRGLR---------------------GIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAG---------------------DRGVQGLPGAPGTVG--LAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPG---------------VPGRDGYPGRNGRDGSPGFPGPSGD------------------GIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGT---------DSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQ------GIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGD--EGEKGPPGPAGMKGLPGELGVGG----------------FIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGIS--------GLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGP---------------------KGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPG--WPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGR 1495          

HSP 3 Score: 185.267 bits (469), Expect = 3.526e-46
Identity = 402/1173 (34.27%), Postives = 507/1173 (43.22%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXX-------XXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT------------VKGIKGDSGDEGLQGEKGISGSKGVKGE-------------RGPSGRP-------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDS--REET-FPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP---------VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGP---IGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----------GIKGN---------------------EGSRGEEGETGMRGLPG---ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKG------------DSGEPGVQGLKGFTGESGDKGE--------------CSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIG----RTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKG--LETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNG-PTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGP---------------------KGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN 4050
            G     G++G++G TG  G RG PG  G  G+ G  G  G++GV G  G                +G KGEVG+ G           PQGP       G Q   GY+G +G  G  G+ G +G  GD          S  PG+ GD G KG+ G  G  G  G   F            +               +KG+ G  G +G +G  G  G +G+KGE             RGP+G P         G  G KG  G++G+ GL G  G VG  G  G  G A +   K    EKG KG QG+ G  G+ GRDG PG      R G DG+ G  G  GD G +GLPG  G  G  G++  R ET FP   G  G  G  G+ G +G+ G PG+   PG+SG  G    + DE N   K   G           A           ++G++G  G  G   + G KG KGD G  ++    P  + + GDRG+ G PGL G     GK G KG QG KGS G                       G  G+PG +G  G  G++G  G QG  G  G  G  G KG  GA G PGI          G+ GN                     EG +G  G  GM+GLPG   + G IG +G  G  G  G  G  G  G+KG  G PG  G + +KG KG            + G PGV+G  G +G  GD+GE                 +GE G++G  G KG  G+KG +G+ G  G+ G+ G    R+ E G+KG+ G  G  GN G++G   E G  G IG  G TGP+G  GI G     GV G  G  GD GE+G  ++  G+RG KG  G  G  G +G  GE G  G +G  G  G IG+ G++G  G  G +G  G  G +G  G  G                 GE GS G  G  G  G  G RG  G DG  G  GI+G+ G   I LKG  G  G  G P     + G  G  G KG  G QG  G IG  G  GV+G  G     G  GD GP                      G  G  G+ G +G++G  G  G+ G  G  GL+G P  +G  G+ G  G  G  G +G+QG +GL G IG  G KG PG 
Sbjct:  300 GQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPG---------------TKGKKGEVGDLG-----------PQGPV--TFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPG------RNGRDGSPGFPGPSGD-GIKGLPGSHGFPGLPGNAGARGETGFPG-PGFPGSKGLRGEPGNRGVSGFPGV---PGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLP-GPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGE-------------QGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILG---EVGPDGIIGFPGFTGPRGTPGISG---FPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVP---------------GEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQ 1398          

HSP 4 Score: 149.058 bits (375), Expect = 3.549e-35
Identity = 450/1398 (32.19%), Postives = 575/1398 (41.13%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGV------KGERGPSGRPTTGLV---GPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDI----------GDRGLPGDKGIKGAKG----------DSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLN----GKPGISGDMGK-------------MGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGE----KGD-SGNCTINFVKPL-------NATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQG--MKGDIGDKGRSGAKGDTGA---IGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQG----ESGEQGDIGNFGP-------------------KGFKGIKGNTGKPGPVGDKTI---KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDK--------GESGMIGRTGENGEKGDQGLNGPKGNVGVIG---DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKG---------DQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTG------SKGETGPKGDFGEDGDK-------------GNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEI------------------------------------------GEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGAR 4617
            PGL G  G +G+KGD G  G  G  GP G  G  G  G  G+DGV G                  + G  G  G+ G  G       G QG  G  G  G++G PG  G  G KG KG P                 RGD G+ G NG  G  G  G  GF G  G  G  G  G         +   G  GEKG  G  G       +GER    +    L+   G KG +GEKG  G  G+    G KG +G+ G   +       G  G  GN G  G+ G  G +G PG+ G +G+ G  G +G +G    +          G+ G PG  G+ G  G          +     FP   G+ GD G  G+ GPKG +G  GL     G PGI G  GK             +G+KG  G PG                      G+RG  G +G++ I GE+GE    +GD +G        P+       +A   G+ GD G  GL G  G VG+ G  G  G  G  G K    + G+KG +G  GF GVPG  G  G++G DG  G  G  G  +KG  G  G  G  G+ GA    G PG G  G++G RGE G  G+ G PG+ G  G QG    E+ E+ +IG  G                     G+ GI+G  G PGP G   +   KGIKGD G   + G  GF+G+ GD+G     G  G  G  G  G +G++GE+G  GD+        G +G+ G  G  G +GDQG+ G +G VG  G   ++G  G PG  G  G  GP  + G  G  G  G  G  G  G         D+GEKG     G +G  G +GV G +G +G  G PG+ G  G +G  G+    G  G  G  G  G+KG+    G KG  G IG  G  G  G  G KGD GE           G   K         G  G  G+SG KG+SG+   KG  GP G  G                    G +G  G  G  GN+G+ GE+GP G +G  G  GP+G  G        GE G  GD GE GD              G  G  G +G+ G  ++G +G+ G  G  G +G  G+ G +G PG+ G +G  G  G  G+ G  G+ G+ G  G  G  G  G +G  G  G  G KGI G+ G      +     S G         I G  GP G  G  G +G+ G  G  G+ G+ G  G                   +K G  G++                                          G PGD GKVG  G  G P  +G KG  G QG  G SG   +QG  G +G IG  G +
Sbjct:   88 PGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPG------------------HTGQGGPRGKPGHDG-----CNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNR------LRGDPGEAGFNGIQGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQ------RGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFP---GQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGR--------------------DGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGE-------QGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLG--------LPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHG--EKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGF-----------------SNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLK 1393          

HSP 5 Score: 131.724 bits (330), Expect = 7.148e-30
Identity = 301/877 (34.32%), Postives = 369/877 (42.08%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNG---TNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPG----DFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKG--IAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSG-KCIGNIQGPQG-------------------PFGDKGDKGNQGIPGYQGNLGEKG------FKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGD--RGLPGDKGIKGAKGDSRE-ETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP----VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKR-------GQSGLDGEKGDIGNQGMKGDIGDKG---RSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG 2709
              G+ G KGD G    PGP G  G  G+ G  G  GL G  G +G+ G  G +GE G  G              G++G+ GLPG  G   T G++G  GL GK+G  G  G KG KG  G PG        A  G  G  G+ G+ G +G  G  G  G  GD+G+KG        GP GM G PG+   G  I  +G  G PG  G  G      V   K  P   G                       G+ GA G    +G  G  GN G PG KG  G+ G KG RG  G  G             +  +    +KGE G+ G SG K I  ++G +G                    FGDKG+ G  G+ G QG LGE G      F G  GP G  G  G   +PG+RG  GD GE G++                       +    +G KG  G  GL G++GI G KG  G+ G  G    G++G  G  GEKG  G  G  G  G +G  GL G                    GEKG  G  G  G  G  G RG  G DG  G +G  G  G    GL G KG+ G KG   E  T   + G  G  G +G +G  G+ G PG  G  G+ G   K G+ GD G PG  GL G  G  G  G+ +KP    V G+ GLQG  G K I G++G+ G  G   I           G +G  G  G QG +G  G +GDQG KG  G  G+ G                 G PG PG          + G  G  G IG+QG++GD+G KG     GA G TG  G PG+ G     GSRGE+G  G  G  G  G  G  G +G  G
Sbjct:  726 VFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPS-------GEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKG------PPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQ---------------------GMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPG----------DPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDT----------------------IDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRG--IEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVP------------------GEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIP----------GAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYG---------------LKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPG 1491          

HSP 6 Score: 52.373 bits (124), Expect = 9.867e-6
Identity = 104/280 (37.14%), Postives = 128/280 (45.71%), Query Frame = 1
Query:  277 IGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF-FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDG---AVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGF 1104
            +G PGP G KG  G+ G     GL+G  G+ G  GLPG   ++G  G  G  G PG  G  G  G  GLP   G  G  G+ GL G  G    KG+ GD+G +G PG       KG KG AG +G  G  G           GDQG KG+RGD+G+ G  G  G+PG   +      E+G+PG  G  G                +GD G KG  G  G  G  G  G PG+ G     G RG++G  G  G  G  G  G PG  G  G+ G    IG+
Sbjct: 1249 VGMPGPAGSKGAEGDQG---LPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGA---KGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSG---------YRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQ------------GVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGY 1501          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 227.254 bits (578), Expect = 5.715e-59
Identity = 129/370 (34.86%), Postives = 185/370 (50.00%), Query Frame = 1
Query: 4282 RGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            RGD+G  G+KG  G  G M    ++ A+                   +   G +G +G PG  G+ G +G  G P    P G +GEQG  G +G   G  G  G  G  G                       G  G+++   +L  +H Q  EE P+CP+G  +++ GYS +   G  + +  +LG   SCL  F+ MPF  C+    C    R D+SYWL++ AP+    +  + +  YISRC  CE+PA   A HSQ  ++S   CP+ W  LW GYSF+MHT  G+ GGGQSLSSPGSCL  FR +P +ECN G   C+++ +  S++L  +D  F+        A+  K+  +   +SRC+VCMK
Sbjct: 1372 RGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGV----QGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTG-PNGFKGASGVPGRAGL---------------------PGMPGRSVNIGYLLVKHSQTDEE-PMCPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYCNPGDVCYYANRNDKSYWLSTTAPLPMMPVVEEEIRPYISRCSVCEAPAVAIAVHSQ--DVSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIDEPFQ----SSPPADTLKAGLIRTHISRCQVCMK 1708          

HSP 2 Score: 223.787 bits (569), Expect = 5.971e-58
Identity = 463/1382 (33.50%), Postives = 584/1382 (42.26%), Query Frame = 1
Query:  253 GPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMG----LSGDKGVKGDKGYIGEPGD--FFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVG----DQGPIGMSGEPGDQPKG---------IAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGD-RGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEK-----------GISGSKGVKGE---RGPSGRP-TTGLVGPK-----------------------------------------GPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD--------IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQG--------------MKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGI-TGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGI---NGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVG-AKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGP-------KGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGK 4041
            G KGD G  GNPG  G    TG  GE G  G  G  G  G DG  G  GE                   G  G  G+PG  GT G+KG  G  G  G    ++G +  KG +G IG PG    +              +       G  G  G+ G +G KG +GD G      GP G+ G PG +            I  KG  GFPG  G  G             P  RG                       G+ G  G+ R  +GD    G  G PGP G PG +G  G +G  G                     +RG +G  G  G  G  +    G  GP G+KGDK      G +G  G+ GF G               +PG+ G  G  G +G  G  GP GD                   +KG+ G  G  GL G             G  GSKG++GE   RG SG P   GL GP+                                         G +G+KG  G  G +G  G KG+KG  GT             G  G  G++G  G AG  G PG+ G  G+PG  G  G +GS GD         G+ GLPG +G+KG +GD        I G +G  G  G  G KGIKGSPG  G PGI G     G  G  GNPG  G +G +G  G  G      +GE+G  G  G+K + GE G  G                 +G RG  G PG+ G +G  G+ G +G KGS G+ G +G  G  G    +G KG  G  G PG +G +G  G KGD G QG               KG+ GD+G SG KG +        G+KG++G  G  G+ G+ GLPG+ + + G++GE+G  G IGN G  G  G  G  G PG  G +   GI G  G PG +G  G  GE GD  +  G RG  G+ G  G  G+RGI GE+G  GD+G  G+ G  GE+G+ G++G  G +G VG  G +G  G PG  G  G++G  G+   +G  G +G+ G+ G  G KG  G+ G +  G +G KG  G  G  G A   +G PG  GSKG  G+ G    IG  G  G  G  G   + G+ G+ G  GP G  G  G  G  G     G  G  G +G  G  G KG  G+ GK G  GL+GI G KGL G        G SG  GD GP                     +G  GDIGE G KG  G+ GP           G  G  G  G+ G +G+ GPKG  G  G  G  G +G  G+ G       G+RGE G  G+ G  G +G  G+PG+ G  G  G+
Sbjct:  273 GAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGE------------------IGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGA------------PGSRGLR---------------------GIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAG---------------------DRGVQGLPGAPGTVG--LAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPG---------------VPGRDGYPGRNGRDGSPGFPGPSGD------------------GIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGT---------DSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQ------GIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGD--EGEKGPPGPAGMKGLPGELGVGGF----------------IGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGIS--------GLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGP---------------------KGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPG--WPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGR 1483          

HSP 3 Score: 185.267 bits (469), Expect = 3.844e-46
Identity = 402/1173 (34.27%), Postives = 507/1173 (43.22%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXX-------XXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT------------VKGIKGDSGDEGLQGEKGISGSKGVKGE-------------RGPSGRP-------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDS--REET-FPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP---------VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGP---IGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----------GIKGN---------------------EGSRGEEGETGMRGLPG---ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKG------------DSGEPGVQGLKGFTGESGDKGE--------------CSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIG----RTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKG--LETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNG-PTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGP---------------------KGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN 4050
            G     G++G++G TG  G RG PG  G  G+ G  G  G++GV G  G                +G KGEVG+ G           PQGP       G Q   GY+G +G  G  G+ G +G  GD          S  PG+ GD G KG+ G  G  G  G   F            +               +KG+ G  G +G +G  G  G +G+KGE             RGP+G P         G  G KG  G++G+ GL G  G VG  G  G  G A +   K    EKG KG QG+ G  G+ GRDG PG      R G DG+ G  G  GD G +GLPG  G  G  G++  R ET FP   G  G  G  G+ G +G+ G PG+   PG+SG  G    + DE N   K   G           A           ++G++G  G  G   + G KG KGD G  ++    P  + + GDRG+ G PGL G     GK G KG QG KGS G                       G  G+PG +G  G  G++G  G QG  G  G  G  G KG  GA G PGI          G+ GN                     EG +G  G  GM+GLPG   + G IG +G  G  G  G  G  G  G+KG  G PG  G + +KG KG            + G PGV+G  G +G  GD+GE                 +GE G++G  G KG  G+KG +G+ G  G+ G+ G    R+ E G+KG+ G  G  GN G++G   E G  G IG  G TGP+G  GI G     GV G  G  GD GE+G  ++  G+RG KG  G  G  G +G  GE G  G +G  G  G IG+ G++G  G  G +G  G  G +G  G  G                 GE GS G  G  G  G  G RG  G DG  G  GI+G+ G   I LKG  G  G  G P     + G  G  G KG  G QG  G IG  G  GV+G  G     G  GD GP                      G  G  G+ G +G++G  G  G+ G  G  GL+G P  +G  G+ G  G  G  G +G+QG +GL G IG  G KG PG 
Sbjct:  288 GQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPG---------------TKGKKGEVGDLG-----------PQGPV--TFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPG------RNGRDGSPGFPGPSGD-GIKGLPGSHGFPGLPGNAGARGETGFPG-PGFPGSKGLRGEPGNRGVSGFPGV---PGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLP-GPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGE-------------QGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILG---EVGPDGIIGFPGFTGPRGTPGISG---FPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVP---------------GEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQ 1386          

HSP 4 Score: 142.51 bits (358), Expect = 3.875e-33
Identity = 333/1021 (32.62%), Postives = 440/1021 (43.10%), Query Frame = 1
Query: 1360 LPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKG-IKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPK---GMKGLLGTACKLCXXXXXXXXXXXX--------NQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGRE--GSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXX-----XXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDI----GDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGD--KGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNV-----------------------------------GVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-------------TKGQRGEKGNMG--VIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDK---GNVGPKGNKGLSGP------------CQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIG----------RMGDKGKPGN----------GIEGPDGDIGNKG 4089
            + G +G  GDKGE G  G  GP GD G +G  G  G  G  G T +G  +G  G +G  G +G +G  G  G RGP G   +G  G KG KGE     ++ KN   GP+   G  G +G       +G  G  G +G          GEKG+ G  G  G    +G+R +      +  +  G+ GD G++G PGDKG     G+  EE      G++G  G DG  G  G  G PG NG PG+ G  GK G  GD G                       V G++  +G +G     G  G  GD G+         N +     G TG+ GL+G  G  G +GD G                 +          G  G  G+PG PG+ GQ G  G +G  G +G +G+     GD+   G  G+ G +G PG   +G+ G +GE G+ G++GLPG  G +G  G +G  G  G  G K F   KG+ G  G  G   + G  G  G  G  G  GF G SGD  KG     G  G  G+ G +GE G  G  G  G KG  G  G  G +G  G  GL+GP+G+                                    G  G RG+ G PGP G DG  G KGI G +G   + G  G +G +GD+G  GL               KG +GEKG++G  +    G +G  G PG++G KG  G+ GI   G  G  G  G+ G KG++G  G  G  G  GP  L G  G  G+ G  G +G +G  G  G++G+ G  G  GP G+ G+ GE G+ G I ++G  G                             G  G +G  G  GVKG  G  G  G QG +G KG    +G  GP G+ G  G K   G  G KG++G  GP              +G +G++G  G  G  G+KG +G+ G PG++G            GDKG+ G           G  GPDG IG  G
Sbjct:   93 IAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPG--ISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGP----------------QGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGF--QGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP-GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGI--PGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHG---------------------------NPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPG 1063          

HSP 5 Score: 141.739 bits (356), Expect = 6.654e-33
Identity = 385/1218 (31.61%), Postives = 498/1218 (40.89%), Query Frame = 1
Query: 1366 GKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGP-KGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXN-QGEKGKDGLAGRDGNPGIRGDRGRP-------GNDGAIGREGSYGD-------IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGD-NGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQG----ESGEQGDIGNFGP-------------------KGFKGIKGNTGKPGPVGDKTI---KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDK--------GESGMIGRTGENGEKGDQGLNGPKGNVGVIG---DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKG---------DQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTG------SKGETGPKGDFGEDGDK-------------GNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEI------------------------------------------GEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGAR 4617
            G++G+ GDKG+   +G  G  G  GF G               +G  G+ G+ G  GE G  G+ GV G  G  G+    G +GP+GP     G     G  G++G  G+ G+ G        G  G+ G      G+ G  GL G+ G  G +GD G P       G DGA G+EG  G        IG +GLPG  G  G +G         IKGE+G+    +G E  +G  G PG  G PG  G  G+ G  GD G                       VQG  G  G  G+    G  G  G+ G+          ATE G +G  G+ G  G  G+ G  G  G                            DG PG PG  G    DG KG  G+ G  G  G+   +GA+G+TG    PG G  G++G RGE G  G+ G PG+ G  G QG    E+ E+ +IG  G                     G+ GI+G  G PGP G   +   KGIKGD G   + G  GF+G+ GD+G     G  G  G  G  G +G++GE+G  GD+        G +G+ G  G  G +GDQG+ G +G VG  G   ++G  G PG  G  G  GP  + G  G  G  G  G  G  G         D+GEKG     G +G  G +GV G +G +G  G PG+ G  G +G  G+    G  G  G  G  G+KG+    G KG  G IG  G  G  G  G KGD GE           G   K         G  G  G+SG KG+SG+   KG  GP G  G                    G +G  G  G  GN+G+ GE+GP G +G  G  GP+G  G        GE G  GD GE GD              G  G  G +G+ G  ++G +G+ G  G  G +G  G+ G +G PG+ G +G  G  G  G+ G  G+ G+ G  G  G  G  G +G  G  G  G KGI G+ G      +     S G         I G  GP G  G  G +G+ G  G  G+ G+ G  G                   +K G  G++                                          G PGD GKVG  G  G P  +G KG  G QG  G SG   +QG  G +G IG  G +
Sbjct:  279 GEKGNPGDKGQPAVTGEKGEEGITGFPGQ--------------RGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRG-----------------------VQGLPGAPGTVGLAGPAGFPGPAGEKGDKVF-------ATEKGSKGAQGDSGFPGVPGRDGYPGRNGR---------------------------DGSPGFPGPSG----DGIKGLPGSHGFPGLPGN---AGARGETGF---PGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGE-------QGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLG--------LPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHG--EKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGF-----------------SNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLK 1381          

HSP 6 Score: 131.724 bits (330), Expect = 8.576e-30
Identity = 301/877 (34.32%), Postives = 369/877 (42.08%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNG---TNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF----FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKG--IAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSG-KCIGNIQGPQG-------------------PFGDKGDKGNQGIPGYQGNLGEKG------FKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGD--RGLPGDKGIKGAKGDSRE-ETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP----VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKR-------GQSGLDGEKGDIGNQGMKGDIGDKG---RSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG 2709
              G+ G KGD G    PGP G  G  G+ G  G  GL G  G +G+ G  G +GE G  G              G++G+ GLPG  G   T G++G  GL GK+G  G  G KG KG  G PG        A  G  G  G+ G+ G +G  G  G  G  GD+G+KG        GP GM G PG+   G  I  +G  G PG  G  G      V   K  P   G                       G+ GA G    +G  G  GN G PG KG  G+ G KG RG  G  G             +  +    +KGE G+ G SG K I  ++G +G                    FGDKG+ G  G+ G QG LGE G      F G  GP G  G  G   +PG+RG  GD GE G++                       +    +G KG  G  GL G++GI G KG  G+ G  G    G++G  G  GEKG  G  G  G  G +G  GL G                    GEKG  G  G  G  G  G RG  G DG  G +G  G  G    GL G KG+ G KG   E  T   + G  G  G +G +G  G+ G PG  G  G+ G   K G+ GD G PG  GL G  G  G  G+ +KP    V G+ GLQG  G K I G++G+ G  G   I           G +G  G  G QG +G  G +GDQG KG  G  G+ G                 G PG PG          + G  G  G IG+QG++GD+G KG     GA G TG  G PG+ G     GSRGE+G  G  G  G  G  G  G +G  G
Sbjct:  714 VFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPS-------GEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKG------PPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQ---------------------GMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPG----------DPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDT----------------------IDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRG--IEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVP------------------GEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIP----------GAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYG---------------LKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPG 1479          

HSP 7 Score: 52.373 bits (124), Expect = 9.293e-6
Identity = 104/280 (37.14%), Postives = 128/280 (45.71%), Query Frame = 1
Query:  277 IGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF-FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDG---AVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGF 1104
            +G PGP G KG  G+ G     GL+G  G+ G  GLPG   ++G  G  G  G PG  G  G  G  GLP   G  G  G+ GL G  G    KG+ GD+G +G PG       KG KG AG +G  G  G           GDQG KG+RGD+G+ G  G  G+PG   +      E+G+PG  G  G                +GD G KG  G  G  G  G  G PG+ G     G RG++G  G  G  G  G  G PG  G  G+ G    IG+
Sbjct: 1237 VGMPGPAGSKGAEGDQG---LPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGA---KGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSG---------YRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQ------------GVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGY 1489          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Mouse
Match: Col4a3 (collagen, type IV, alpha 3 [Source:MGI Symbol;Acc:MGI:104688])

HSP 1 Score: 224.557 bits (571), Expect = 2.282e-58
Identity = 125/331 (37.76%), Postives = 172/331 (51.96%), Query Frame = 1
Query: 4432 KGNRGEIGEPGDIGKVGSKGDVGE---PAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEV--QNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKK 5394
            KG+ G +G PG  G  G +G  G+   P   GP G KG +GL G  G     G+ G KG+ G +G                        P        F+FTRH Q     P CP G+  ++ G+S +   GN   +  +LGT  SCL  F  MPF  C+ +  C    R D SYWL++ A +  DM  +  + +E YISRC  CE PA   A HSQT  +    CP+DW  LW G+SF+M T+ G+ G GQ+L+SPGSCL  FR SP +EC +G   CN++ ++ S++L  ++ E  F  P    +KA D     + K +SRC+VCMKK+
Sbjct: 1370 KGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGT-----------------------PATGTRMRGFIFTRHSQT-TAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPP--CPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIEC-HGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGD-----LEKIISRCQVCMKKR 1668          

HSP 2 Score: 83.5741 bits (205), Expect = 2.921e-15
Identity = 134/404 (33.17%), Postives = 169/404 (41.83%), Query Frame = 1
Query: 2461 IPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKG-----------------DTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKG---------IKGDSGEPGVQGLKGFTGESGDKGEC------------------SGRGEFGERGDVGPKGERGIKGEQGI---NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIG--------------------DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKG----------------------QRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            IPG RG  GL G  G  G  G +GD G KG  G  G                   G +G PG     G  G  G  GE+GE GM G PG TG  G  G+ G QG  G+ G     G+KG  G+PG  G++  KG         +KGD GEPG++G  G  GE G++G                      RG+ G RG+ G  G  G+ G  GI    G KG  G  G  G  G  G  G++GP+G+ G  G                    D+G+ G+ G  GP G +GP G +G  G  G  G  G  GP GD G KG +                          RG++G  G+ G  G KGE G   +    G  G  G+ G KG+ G  G  G  G+KG+
Sbjct:  808 IPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLG---IPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGL--LGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGV 1206          

HSP 3 Score: 80.4925 bits (197), Expect = 2.208e-14
Identity = 210/637 (32.97%), Postives = 260/637 (40.82%), Query Frame = 1
Query: 1759 NQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGK--------------------EGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGN-----CTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGM------------------KGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQG-----------------DIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG---------------------RGEFGERGDVGPKGERGIKGEQGINGD-KGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKG--INGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGE---------------PGMRGSKGDNGETGIGQKGESGSNGEFG 3369
            + G  G+ G  GR G PGI G +G P    ++GR G     G  G PG++G  G  GD      P + G  G  G DG                      GP+G +G PGLNG  G  G  G  G KGD G PGM                     G  G +G  G     G  GEKG+ G       T     P      G RG  G PG++G  G+ G KG++G KG  G S                     G  G PG +G  G  GEKG+ GN G+                  +GD G +G  G  G  G  G+ GI G+ G +G +G  G  G+ G PG+TG  G QG+ GE G                   G+ G KG +G+ G  G+ GP G     G  G  G PG  G  G  G  G KG                         RG+ G  G  GP GE   KGE G+ G   G  G  G  G  G++G  GL+G  G  GV+GD G  G PG  G  G  G  G  I G KG++G+ G++GN G  G  G  G   KG +G+KG MG  G  G  G +G+               PG+RG  G  G  GI  KGE G+ G  G
Sbjct:  717 SPGCPGEMGKPGRPGEPGIPGAKGEP----SVGRPGK---PGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTL---------------LKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGE---KGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGI--KGEKGNPGFLG 1326          

HSP 4 Score: 77.0258 bits (188), Expect = 2.418e-13
Identity = 227/710 (31.97%), Postives = 285/710 (40.14%), Query Frame = 1
Query: 1501 IKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGL--------------------VGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPK------------------GIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNC----TINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQG------------------MKGDIGD---KGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQG-----------LKGFTGESGDKGECSGRGEFG---ERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGP------------------KGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQK 3339
            I G  G +GL G  G+ G  G +G+ GP G P   G+                    +GP G KG  G  G  G  G+ G  GM G  GT       G  G  G  G+QG++G  G+      PG++G++GRPG  G  G +G  G      L GDKG  G KG      F    GEKG+ G  G  GPK                  G +G+PG  G  G+ G MG MGV G +G                     K   G  GL G  G+  I G +G+KG+ G              +    GD+G  GE G+ GP G+ G  G  GA GS G                       G PG PG  G  GL G+KG  G  G                  M+GD G     G  G KG+TG +G       G +GS G  G  G RG+PG++G  G +G     GD+G  GP G  G+ G  G         I G KGD G PG++G                G  GDKG     G  G     GD+GP G  G  G  G+ G +G+ G  G  G  GEKG+ G  GP                   G + VI   G  G        G  G  G+ G  G  G+ G+ G  GP+G  G+ G   T G  G KGN G+ G  G  G  G PG++G+ GD G    G +
Sbjct:  808 IPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTT------GPPGLPGKPGSQGQRGSLGI------PGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKG------FVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGR--------------------KGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGS---------------------PGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLG----AYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGV---MGDVGPQGPPGTAGLPGPPGL----PGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGP------PGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGTR 1441          

HSP 5 Score: 71.633 bits (174), Expect = 1.216e-11
Identity = 294/937 (31.38%), Postives = 353/937 (37.67%), Query Frame = 1
Query: 1780 DGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGP---------KGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTI-------------------------NFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIG---DKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGL------------------PGITGDIGNQGES-----------------------------GEQGDIGNFGPKGFKGIKGNT-------------------------GKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNG-----PKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPK---------------GNTGSKG---ETGPKGDFGEDGDKGNVGPKGNKGLSG-------PCQQGRSGNRGEMGAPGKV--------------------GIKGEQGLEGLPGKIGRMGDKGKPGN-------GIEGPDGDIGNKGR 4092
            D      G PG  G RG+PG DGA G  G+ G  G+RG PG +G  G            IKG KGD GP G  GP         KG +G PGL G  G  G  G  G  G  G+                   ++P     GL+G  G   + G KGE+G  G  T+                         + V   +  E G  GDTG PG+ G     G KG+ G+  ++                       DG+ GIPG RG  GL G  G  G+ G+ G  G   D+G  G KGD G    P  G  GN G  G  G  G +G                   P ++G  G+QG                               G QG  G  GP G  G+KG                           G PGPVG K   G+ G  GEPG+              +    G  G  G  G  G+ G  GE GI G KGE  +    G  G+ G  G  G +GN G  GD G  G PG  G  G  G  G  G  G+ G  G KG+ G     P+G QG  GL      G KG  G  G+ G KG+ G PGM  S            G  G  GE G  GQK               G  G  G  G  G+ GE+G  G  G TG  G  G+ G+ G+ G  G+ G+ GEKG  G   KGE G  G  GP+    L                  +GD GE G KG  G  G KGN G  G  GPK               G+TGS+G     GP G  G  G  G  GPKG KG SG       P   G  G +G+ G PG                      G KGE+G+ G PG+ G  G  G PG+       G  GP GD+G KG+
Sbjct:  281 DSYGSEKGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAG------------IKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGS----------------PGLSRP-----GLRGPIGWPGLKGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPG---LDGPKGEPGSPCTECHCFPGPPGVPGFPG-------LDGIKGIPGGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKGDTPLP-WGQVGNPGDPGLRGLPGRKGFDGTPGGPGAKGPPGPQGEPALSGRKGDQGPPGPPGFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTPDLGPPGPPGPPGQAGPRGLPGLPGPVG-KCDPGLPGPDGEPGIPEAGCPGPPGPKGNQGF-PGTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSV----GRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLN-----GLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPG---PPGTPGCPGEMGPPGQK---------------GYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGA--KGERGEKGKPGPSQTTLL------------------KGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQ 1124          

HSP 6 Score: 66.2402 bits (160), Expect = 5.341e-10
Identity = 184/521 (35.32%), Postives = 217/521 (41.65%), Query Frame = 1
Query: 2731 KGFKGIKGNTGKPGPVGDKTIKGIKGDS--GEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGE--------RG----------------IKGEQG--INGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIG-DRG----------------ETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQ-------KGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDK---------------------------------GNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKG 4038
            KG  G  G  GKPG  G+  I G KG+   G PG  G  GF GE         RG  GE GD+G  G         RG                 KG  G  I G +G  G+ G  G  G+ G +G  GPKG+ G+ G DR                 E G PG  G  GA G  G  G KGE GMMG  G              ++GQRG       +G  G KGE G PG +G +G+ G+ G  Q       KGE G  G  G+ G+KG  G  G  GP G +G  GL G  G +GD G  G+ G+ G  G  G  G  G  G  G KG SG+ G  G  G+T  G  GP GD G         +    G  G  G  G  GD G+KG +GV G  G  G  GP G  G  G+ G  G+ GP GD G  G K                                 G  GP G KG +G       G +G  G PG  G +G  GL GLPG+ G MGD G
Sbjct:  715 KGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGE---------RGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTT--GPPGLPGKPGSQGQRGS------LGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLT--GIHGPQGDKG----EPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETG-LLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVG 1211          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Mouse
Match: Col4a1 (collagen, type IV, alpha 1 [Source:MGI Symbol;Acc:MGI:88454])

HSP 1 Score: 218.394 bits (555), Expect = 1.899e-56
Identity = 94/237 (39.66%), Postives = 140/237 (59.07%), Query Frame = 1
Query: 4696 ALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQ--NVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            +++  FL TRH Q  ++ P+CP G+  ++ GYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+   M  +   N+  +ISRC  CE+PA   A HSQT  +    CP  W+ LW GYSFVMHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ +A S++L  ++    F+ P    +KA + ++      +SRC+VCM++
Sbjct: 1441 SVDHGFLVTRHSQTTDD-PLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQ--CPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRT-----HVSRCQVCMRR 1668          

HSP 2 Score: 177.563 bits (449), Expect = 5.613e-44
Identity = 259/720 (35.97%), Postives = 333/720 (46.25%), Query Frame = 1
Query: 1492 VKGIKGDSGDEGLQGEKGISGSKG---VKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDG--LAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKG-----------------------------------------AKGDSREETFPSI-----KGEKGDNGPDGKEGPKGIKGSPGLNGKPGISG------DMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTIN-FVKPLNATEM-GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQ------SGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETG---------------KPG-PI-GPDGATGPK------------------GINGIKGE---QGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI 3330
              G+ G  G  G QG++G  G+ G   + GE+G  G+P  G  G  GPKG  GL G  G+ G  G  G  GL G                 G QG+KG+ G  L G  G PG+ G  G PG  G+IG  G  G+ G  G PG +GI+G                                          KG+     FP +     KG+KG  G  G  G  G+ G PG  G PG+ G      +MG MG  G  G+PG  G  G  GE           +G+ GL G  G +   G KG+KGD G   +   ++ ++   M G +GD GE G  GP G  G +GD G  G  G  G+ G PG+PG KG  G  G  G PG+PG +G        G  GEKG  G  G +G  G  G  GAKG+ G  G PGIGI G  G +G++   G+ G PG  G+ G +G +G  G  G+ GP+G  G  G+ G PG  G+K  KG+ G  G PGV+G  G  G  G  G    +GE G  G  G  GE   KGEQG+ G +G  G  G  G+ G KG+ G  G  G+ G+ G +GE G                PG P+ GP G  GP+                  GING KG+   QG  G  G  GPKGD G +G+     + G  G KG+MG+ G  G +G+ G PG++G KGD G+ G+
Sbjct:  650 AAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNP---------------GPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGE-----------KGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQ---GLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGE---KGEQGVPG-RGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          

HSP 3 Score: 163.696 bits (413), Expect = 9.159e-40
Identity = 301/965 (31.19%), Postives = 388/965 (40.21%), Query Frame = 1
Query: 1600 TGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDG-------LAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKG------------AKGDS---------------------------------------REETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGD--TGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA-----------------------KGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECS------------------GRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE---TKGQRGEKGNMGVIGNVGAKGELGE------PGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGEL-----------------------GPKGNVGPQGD------------------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKG 4038
             G  G  G KG++GL G DG  G  GP+G  GL+G                    G KG+ G       L G  G+PG  G  G PG  G  GR+G  G  G +G PG  G+KG            ++GD                                        +    P   G  G  G  G  GP+G +G PG  G+PGI G+ G +G                           +P  G  GL G KG+  + GE G  G  G    N + P N    G +G+   G PGL+G  G  G+ G  G KGS G                       GVPG  G  G  GL G +GD G  G++G  G  G  G                        KG+ G  G PG+ + G +G +G +G  G+ G  G+ G  G QG  G  G  G+ G  G  G  G  G PGP G   + G KGD G PG  G +G  G  GDKG+                     +G+ GE+G +GP G++G +G+ G  G  G+ G  G  G+ G KGD GL+G  G+ G+ G +G  G    +G  G+ G KG+ GI G QG+ G  G  G KG++G+ GL      G+ G+KG+ G+ G  G+ GE GE      PGM GS G  G  G IG  G  G  GE G KG  G++G  G  G  G  G  G  G  G+KG+ G                         DG  G +G  GE+G+ G    G  G  GD G                    G  G  G  G  G  GVKGE                        GPKG+ GPQG                    GPKG+ G++G  G  G  G  GD G    +G  G+ G    G +G++G+MG PG  G +G++GL GL G  G  GD+G
Sbjct:  488 IGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIG------------------QPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVG---------------------------QPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGL-PGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGG---------------------PGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGG---MGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGS------------------------DGIPGSAGEKGEQGVPGRGFPGFPGSKGDKG------------------SKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGF---QGMPGIGG--SPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQG 1335          

HSP 4 Score: 147.132 bits (370), Expect = 1.080e-34
Identity = 286/871 (32.84%), Postives = 356/871 (40.87%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGP---KGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTI--------NFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKG--DIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG---KPGPVGDKTIKG------IKGDSGEPGVQGL--KGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQG--------------------INGDKGESG------------------MIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKG---INGIKGEQGMMGVKGNNGPKGDQGEKGLE-----------------------------------TKGQRGEKGNMGVIGN 3258
            PG  GA G  G  G  G  G+RG PG  G+PG  G KG  G  G IGF G+ G KG+          G  GE+G  G  G+     + G  GP G KG+ G  G+PG +G  G  G  G                PG++G IG  G  GE G  GP G                    ++GI+GD G  G+QG  G  G  G+            G  G  GP   KGEKG  G  G +   GPKG                        ++G +G  GL G+ G PG+ G +G PG  G  G +G  G +G  G PG  G  G          P + GEKGD+G  G  GP+G          PG  GD G +G+ G  G+               + +D   ++G++G QGEKG     G+KG +GD G   +        +  +P    + G  G  G PGL GP G VG  G  G+ G                          GVPGIPG +G  G  GEKG  G +G  G   IG  GR G KGD G  G PG     G KG+ G+ G  G  G RG PG  G  G+ G  GE+GD G  G  G  G+KG  G    PGP G    KG      I G +GE G QG+  +GF G  G KG+   +GE G  G  G  G  G+KGEQG                    + G KG+ G                    G  G  G+KG+QG  G  G  G  GD G  G PG  G  G TG KG   + G+ G QG  G+ G  G KGDQG++G+                                     +G  G KG  GV G+
Sbjct:  645 PGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPG-IGFPGLPGPKGVD---------GLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI-GLPGLKGQPGLPGIPG---------------TPGEKGSIGGPGVPGEQGLTGPPG--------------------LQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLD-MPGPKG------------------------DKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGT---------PGLPGEKGDHGLPGSSGPRG---------DPGFKGDKGDVGLPGMPGS--------------MEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEK------------------------GVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGS 1388          

HSP 5 Score: 144.821 bits (364), Expect = 5.472e-34
Identity = 226/619 (36.51%), Postives = 288/619 (46.53%), Query Frame = 1
Query: 2461 IPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGI------KGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGP-----KGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG-----------------------------RGEFGERGDVG--PKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL----------ETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXX------XXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGP------KGDFGEDGDKGNVGPKGNKGLSG------PCQQGRSGNRGEMGAPGKV------GIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNK 4086
            +PG  G +GL G  G  G QG +G  G  GR G  G+ GA+G PGIG       KG +G  GE G  G  G PG  G  GN G  G++G+ G   P      G  GI G  G+ G +G   + G +G +G PG+QG++G  G  G +G                                 +GE G  G  G    G +G KG QG+ G  G+SG+ G  G+ G  G  G  G KG +GV+G  G+ G PGP G  G  G KG +G+ G  G  G  G  G KGD G  G+            KGQ+G++G  G IG  G KG  G+PG  G  G +G+ G  GQ G  G  G  G+ G  G+ G KG                      +G +G  G  G+ G  G  G +G  G  G KG  G  G+ GL GI + G  G  GD G  G  G PG        G  G  G PG +G+ G+IG  G+ G+ GE G KG  G  G  G KG  G  G  GP      KG+ G DG  G+ G KG +G+ G      P  +G  G++GE+G PG        G+KGEQG  G PG  G+ G  G PG+ +EGP GD G +
Sbjct:  644 LPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKG---------------------SVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQ 1241          

HSP 6 Score: 105.531 bits (262), Expect = 5.717e-22
Identity = 220/623 (35.31%), Postives = 272/623 (43.66%), Query Frame = 1
Query: 2446 DGVPGIPGKRGQSGLDGEKGDIGNQG-------MKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESG-----------------------------------EQGDIGNF-GPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKG-----FTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGN--------------------------------NGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG---PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN 4050
            DG+ G+PG +G  GL G+ G  G  G       +KGD GD G  G  G  G  G PG     G+ G +GS G  G  G RG PG  G  G++G+ G                                   E G +    GP G  G+ G+ G PGP GD+   G  G  G PG +G  G     F G  G KG     GE G  G  G  G  G+ G  G  G KGE G+    G  G KG  GL    G  G  G++G  G PG  G  G TGP G+ GI+G+ G  GV+G                                  G KG  G  GL+  G +G+KG+ G+ G  G  G  G PG +G+ G  G  G  G+ G  G+ G+ GS G  G  G  G+ G  G  G  G +G  G KGD G++G  G  G    +                +  + G+KG  G   KG+ GP GD G  GD G PG  G  G  G PG+ G +GD G  G  G  G  GPKG+VG  G  G  G  G  G  G +G  G  G+KG  G KG  GL G   P + G  G++G  G PG  G KGE+G  G PG  G  G +G PGN
Sbjct:  506 DGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI----GLPGLKGQPGL---PGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVD---------------MGSMKGQKGDQG--EKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGN 1104          

HSP 7 Score: 92.4337 bits (228), Expect = 4.823e-18
Identity = 221/630 (35.08%), Postives = 273/630 (43.33%), Query Frame = 1
Query:  247 IPGPKGDYGRIGNPGPIGPKG---------------YTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGT---------NGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQA-------KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGE------NGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKG---------------ISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPG-------------------------------------IRGDRGRPGNDGAIGREGS 1869
            +PGPKGD G  G PG  G  G               + G+ GE+G  G  G  GS G  G PG  GE GD+G+PG  G  GD G  GD+GDVGLPG  G+          G+KG+ G  G++G +GDKG +GD G  G PG   QA        KG+ G +G  GS G  G KG +G  G+ G  G+KG+ G  G QG  G  GE G +     +KG+ G PG IG  G             P  +GD G  G  G  G+ G KG  G PG+ G+ G RG     GN+G+ G+PG    PG KG KG+ G DGV G                      KGE G  G          GP GP G KG+ G+ GIPG  G  GE+G  G   P            PG +GD G KGE       G  G  G +G+ GF G  G +G  G  G     ++G  GD G QG+ G               I+G KG KG +G  G P  G+ GPKG  G +G+ G+ G  G  G KG  GL G                 G QG+KG  GL G  G+ G                                     ++G +G PG  G  G  GS
Sbjct:  838 MPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAK----GEKGQSGLPG-IGIPGR------------PGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRG---SPGNIGHPGSPG---LPGEKGDKGLPGLDGVPGV---------------------KGEAGLPG--------TPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPG----------FPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAP--GVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVP---------------GFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGS 1388          

HSP 8 Score: 53.1434 bits (126), Expect = 4.682e-6
Identity = 112/348 (32.18%), Postives = 154/348 (44.25%), Query Frame = 1
Query: 2542 DKGRSGAKGDTGAIGNPGI---GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI------------------KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGP----KGERGIKGEQGINGDKG---------------------------ESGMIGRT--GENGEKGDQGLNGP-----------KGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDN-GETGIGQKGESGSNGEFGSKGQKG 3387
            ++ R+ AKGD G  G       G+KG +G RG  G  G+ G PG+ G  G  G  G++GD G  G  G KG +G  G  G  G+  +                   G KG+ G  G  GL GF+G  G  G    +G+ GE     P    KGERG  G  G+ G  G                           E G +G +  G  G+KG+QG++GP           KG+    G++G+ G+PG  G  G        G KGE G  G +G  G  G++GE+G  + G  G+ G  G+ G  G +GE GE G+ G  G   G   +G+KG+ G  G  G +G+ G
Sbjct:   21 ERSRAAAKGDCGGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPG-------YGEKGEPGKQGPRGKPGKDGEKGERG--SPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPG 359          

HSP 9 Score: 52.7582 bits (125), Expect = 6.131e-6
Identity = 75/194 (38.66%), Postives = 91/194 (46.91%), Query Frame = 1
Query: 3577 ISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQG---PKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGL-------SGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-------------NGIEGPDGDIGNKG 4089
            I GEKG  G       GP GD G  G  GL G  G  G  G  G  G  G  G KG  GV G  G  G+ GP G  G    KG+ G  G +GP+GD G  GDKG+VG  G  G        S   Q+G  G +G++G  G  G +G+ G  G+PGK G+ G  G+PG              G+ GP G +G  G
Sbjct:  824 IKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMG 1017          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Mouse
Match: Col4a2 (collagen, type IV, alpha 2 [Source:MGI Symbol;Acc:MGI:88455])

HSP 1 Score: 218.394 bits (555), Expect = 1.946e-56
Identity = 136/371 (36.66%), Postives = 192/371 (51.75%), Query Frame = 1
Query: 4282 RGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE-FEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            RG  G  G +G  G  G MGS GI G       +                 G +G  G PG +G++G +G  G+P  RG  G  G QG  G S    G  GD+G +G QG        G +G  G  G  G  G  G+++   +L  +H Q  +E P+CP+G NK++ GYS +   G  + +  +LG   SCL  F+ MPF  C+    C    R D+SYWL++ AP+    +  + ++ YISRC  CE+PA   A HSQ  ++    CP  W  LW GYSF+MHT  G+ GGGQSL SPGSCL  FR +P +ECN G   C+++ +  S++L  +  + F+        A+  K+  +   +SRC+VCMK
Sbjct: 1362 RGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQ-------------PGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVP-GFRGDQGPMGHQGP------VGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQE-PMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPH--CPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQ----STPSADTLKAGLIRTHISRCQVCMK 1705          

HSP 2 Score: 185.267 bits (469), Expect = 2.810e-46
Identity = 306/854 (35.83%), Postives = 394/854 (46.14%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGD--------SREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGK-------MGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGK-PGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQ------------GINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRG---ETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQG---EKGLE--TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKG 3387
            PG  GA G++G KG  G+ G  G PGP   PG  G +G +G+ G+ G  G  G  G+ G  G  G+RG  GEV         +G   G +G  G  G  G +G+PG  G  G +G +GMPG            +PG +G  G  G +G+ G  GP G  GF                     G  G EG  G+ G  G  G+ G+RG  G P   G VG KG  G++G +G+ G+ G  G  G KG+ G                 G  G+KG  G  G DG  G+ G +GR G  G  G  G +G  G +GLPG+ G+KG +GD                IKGEKGD GP G +G  G+KG  G+ G PG+SG  G         GVKGD G PG  GL G  G  G  GI   P   G RG +G  G+  + GE G  GD G+       P +    G+RG TG PGL+G  G+ G  GD G                           F G+ G+ G +G  GL G+ G  G  G++G  G+ GR G  GD G  G PG+   G  G  G  G +G+ GLPG  G  G+ G     GD G  GP G +G +G     PGPVG   + G KG+ G PG +G  G  G  G  G        G  GDVG  G  G++G Q            GI GD+G SG  G  G+ G  GD G  G  G +G+ G++G   E G  G  GP GA G +G  G KG+QG  G  G+ G  G  G   +  ++  T G +G +G  G +G +G +G  G+PG RG+ G  G  G        G +G+ G  G  G  GQ+G
Sbjct:  702 PGFPGASGEQGLKGFPGDPGREGFPGP---PGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEV---------LGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPG------------MPGLKGQPGFPGPSGQPGQSGPPGQHGF--------------------PGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMP---------------GIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIG---------------------------FPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGV--PGLPGFPGIRGISGLHGLPGTKGFPGSPGVD-AHGDPGFPGPTGDRGDRGEANTLPGPVG---VPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEG 1463          

HSP 3 Score: 158.688 bits (400), Expect = 3.660e-38
Identity = 298/922 (32.32%), Postives = 375/922 (40.67%), Query Frame = 1
Query:  460 GDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ-----PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGD------KGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----TTGLV-GPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAI-GREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-------------------GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTG----------ESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPG 3087
            G RG  G PG +G  G KG  G  G+ G  G  G  G +G  G  G                                  G +GD G+ G  G +G  G +G PG +     P     KG+ GFPGP G  G            PP Q G  G                   PG +G +G  G  G  G  G+RG PG  G PG  G KG+ G  G                     + G  GE G  G  G     + G  G  G KGD+G+ G+ G+QG LG KG +G                PG +G+ G       KG  GE G  G RGD    G  G    I    K +KG KGD G  GL+G  G+ G +G+ G  G SG P      G + G KG  G  G  GL G  G  GP G+ G  G                 G++GEKG  G+AG  G  G  GD G  G+   + G  G  G+ G  G+PG KG  G KG + +  FP I G  G  G     G KG  G PGL G  G  G+ G++G+ GD+G+ G  G                 V G  G  G +GI  + G  G KG  G+  ++                G+PG  GP G    +GD+G   +                         G  G+PG++G+ G  GE+G  G+ G++G  G    S   G  G +G PGI                   GIKG+EGS G  G  G +G     GD G QG+ G  G  G  GPKG +G  GNTG  G VGD+  KG KGD G PG  G  G  G          + G  G    RG  G  G++GP+G  G  G +G  G  G  G  G +   G +GDQ   GP G+ G +G  GE G+PG
Sbjct:  697 GVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQS---------GPPGQHGFPGT------------------PGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRG---------------------DAGMSGERGHPGSPG--FKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQG---------------FPGTKGEAGFFGVPGLKGLPGEPGVKGNRGD---RGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFT---------------GSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQG---SPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPG-----------------VPGLPGFPGIRGISGLHGLPGTKGFPGSPGVD--------------AHGDPGFPGPTGD---RGDRGEANT-----------------------LPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGW---VGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQ---GPMGHQGPVGQEGEPGRPG 1469          

HSP 4 Score: 157.532 bits (397), Expect = 8.524e-38
Identity = 287/857 (33.49%), Postives = 349/857 (40.72%), Query Frame = 1
Query: 1810 GIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSRE-----------------------------ETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-------GIKGNEGSR--------------------GEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGF-KGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVG----------PKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIG---PDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLS----------GPCQQGRSGNRGEM---------------GAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
            G+RG  G PG  G  G +G  GD G  G PG  G  G +G                                 E   +  G +GD G  G+ G   +KG PG  G PG  G  G  G+ G +G PG  G                   G+ G  G  G     G  G +G  G               GDRG+ G+PG+ GP+G  G+ GD+G  G  G  G  G PG            F G+ G+PG  GQ G  G  G  G QGM G  G +G  G KG+ G  G PG+       G+KGN G R                    G+EG  G++G  G+ G  G  G  G  G  G  G  GF KG+KG+ G PG  G   + G  G SG PG+ G  GFTG  G+KG     G FGE G  G            G  G+KGE+GI G  G  G  G  G  G+ G  G+ G  G  G  G +G+TG PG  G   P G  G  GI G KG+ G  GV G  G  G +G  GL   G  G KG  G  G V A G+ G PG  G +GD GE      G  G  G+ G +G  G  G  G  G  G  G      + G  GD+G  G  G  G  G  G  G            L GI G++G SG     G+ G +GD GP                            G+ G  G+ GE GPKG  G  G+ GP G  G +G  GPKGD G  G  G++G  G  G+           GP  QGR G  G +               GAPGK G +G  G+  +PG  G  G  G      +GP G  G  GR
Sbjct:  697 GVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPG---LKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGP-----------------SGQPGQSGPPGQHGFPGTPGREGPLGQPGSP----GLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPG------------FKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPG---LPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLH--GLPGTKGFPGSPG-VDAHGDPGFPGPTGDRGDRGEANT-LPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGP---------NALPGIKGDEGSSGAAGFPGQKGWVGDPGPQ---------------------------GQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGP--QGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGH-----QGPVGQEGEPGR 1467          

HSP 5 Score: 144.821 bits (364), Expect = 6.517e-34
Identity = 290/869 (33.37%), Postives = 386/869 (44.42%), Query Frame = 1
Query: 1531 QGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGV---------KGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGD-----------IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEF-------GERGDVGPKGERGIKGEQGINGD------------KGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNG--PKGDQGEKGLE-TKGQRGEKGNM-GVIGNVGAKGELGEPGMRGSKGDNGETGIG----QKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNG-PTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGEL------------GPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEM 3954
            +G +G+ G  G  GE+G  G P           G+ G  G  G  G +GP+G KG  G        G IG  G  G  G++G  G       PG RGD G PG  G             +GLPG+ G  G +G       P +KG+ G  GP G+ G  G  G  G  G PG  G +G+ G          +G+ G+PG+ G                PV G +GL G++G   + GE+G  G  G   +  +  +     G +GD G PG+ G  G +G+KG QG  G+ G +G                  F GVPG+ G  G+ G+ G +GD            G + +KG+ GD+G  G KG         +G+KG +G  G  G +G  GLPG  G I      G +GDIG  G  G  G  G +G PG  G     G +G+ G PGV G+ G TG +GD G+     +        GERG  G  G +G  GE+G  GD            +G  G+ G+TG  G  G QG  G  G +G+ GD+G+ G PG  G  G  G +GI+G+ G  G  G  G+ G    GD G  G    +G RGE   + G +G  G KGE G PG RG  G  G  G          SGS G+ G+ G  G++G +G  GP GP    G+KG +G  G  G  G +G +G  G  G+ G  G  G+ GPKG  G  G  G SG +  +G  GP GD G P     +         + +  + G  G  G +G  G  GE+            G  G  GPQG  G     G +G+ GP G  G  G +G  G  G+ GL G    GRS + G +
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFP-----------GDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEV-LGAQPGTRGDAGLPGQPGL------------KGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPG----------------PV-GMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIP----GQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAG------------------FFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGY--------LGLKGIQGMPGVPGVSGFPGLPGRPGFI-----KGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPG--MPGRSVSIGYL 1486          

HSP 6 Score: 137.887 bits (346), Expect = 8.038e-32
Identity = 286/838 (34.13%), Postives = 355/838 (42.36%), Query Frame = 1
Query:  460 GDRGDVGLPG---CNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQA-KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGP---QGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGR-----PTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK------------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEG-------SRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGE 2874
            G RGD GLPG     G  GE G  G  G  G+ G  G+KG  G+ G  G   Q+   G+ GF G  G  G  G+ G  G  G+ GD+G+ G   D G  GP+GM G  GD  +G A   GE+G PG  G  G      +      P Q+GD G                   PG+DG  G  G KG  G  G +G  G  G PG KG  G  G  G                     NRG +G  G        + +I+G    +GP G KG  G +GI G  G  G  GF G               LPG+ G I  KG  G+ G  G  G  GF G +G             GI G  G  G +GEKG  G  GV GE GP+G       T  L G  G KGE+G++G+ G  G  G KG  G +G                       G  G+AG  G+PG++G  G PG  G  G +G  G IG   +PGDKG  G  G      FP I+G  G +G     G KG  GSPG++      GD G  G  GD G+                  +A  + G  G+ G+KG +   GE+G  G  G      + P +    G  GD G PG+ G  G              G+KGD+G+ G+ G  G+KG  G PG           G PG+ G  G+ G  GE+G +GN G  G +GD+G  G KGD G  G PG +G  G  G         G  G  G RGLPG  G+IG QG  G+          GF+G  G  G  G  G   + G +GD G  G QG  G  GE G  G 
Sbjct:  777 GTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPG---DPGVPGPVGMKGLSGD--RGDAGMSGERGHPGSPGFKGMAGMPGI------PGQKGDRGS------------------PGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKG---------------------NRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPG---------------LPGRPGFI--KGVKGDIGVPGTPGLPGFPGVSGP-----------PGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFP---------------------GITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIG---IPGDKGDFGWPGVPGLPGFPGIRGISGLHG---LPGTKGFPGSPGVDAH----GDPGFPGPTGDRGD----------------RGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNIS-GSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGP---------QGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGD---------PGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGS 1470          

HSP 7 Score: 135.191 bits (339), Expect = 5.466e-31
Identity = 295/927 (31.82%), Postives = 376/927 (40.56%), Query Frame = 1
Query:  307 GYTGNMGELGAR-GLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGP---QGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGR-----PTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK------------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQ 3021
            G  G +  LGA+ G  GD+G  GQ GL G  GE+G                 G RG  G+PG  G  G+ G  G +G+ G SG  G  G  G  G  G   Q                              G  GD+G  GD G  GP+GM G  GD  +G A   GE+G PG  G  G      +      P Q+GD                   G PG+DG  G  G KG  G  G +G  G  G PG KG  G  G  G                     NRG +G  G        + +I+G    +GP G KG  G +GI G  G  G  GF G               LPG+ G I  KG  G+ G  G  G  GF G +G             GI G  G  G +GEKG  G  GV GE GP+G       T  L G  G KGE+G++G+ G  G  G KG  G +G                       G  G+AG  G+PG++G  G PG  G  G +G  G I   G+PGDKG  G  G      FP I+G  G +   G  G KG  GSPG++      GD G  G  GD G+                  +A  + G  G+ G+KG +   GE+G  G  G      + P +    G  GD G PG+ G  G              G+KGD+G+ G+ G  G+                   G  G PG +GQ G+ G  G+ G +G +G +G+ G SGA GD G  G      KG++G  G  G  G  G+PGI   I  Q         G  GP+G +G+ G  G+ GP G     G +G  G+ G QG  G +   G +G+   +G  G +G VG +GE G  G  G+ G  G S  IG       + DQ
Sbjct:  766 GIPGEV--LGAQPGTRGDAGLPGQPGLKGLPGETGAP---------------GFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGL-----------------------GGLPGDRGEPGDPGVPGPVGMKGLSGD--RGDAGMSGERGHPGSPGFKGMAGMPGI------PGQKGDR------------------GSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKG---------------------NRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPG---------------LPGRPGFI--KGVKGDIGVPGTPGLPGFPGVSGP-----------PGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFP---------------------GITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRI---GIPGDKGDFGWPGVPGLPGFPGIRGISGLH---GLPGTKGFPGSPGVDAH----GDPGFPGPTGDRGD----------------RGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNIS-GSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQ------------------KGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGP-----KGDQGFPGAPGSMGSPGIPGIPQKIAVQ--------PGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGD---QGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQ 1495          

HSP 8 Score: 112.079 bits (279), Expect = 6.220e-24
Identity = 235/690 (34.06%), Postives = 288/690 (41.74%), Query Frame = 1
Query:  259 KGDYGRIGNPGPIGPKGYTGNMGELGA---RGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGK--------TP--PDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-IGNIQGPQGPFG------DKGDKGNQGIPGY------------QGNLGEKGFKXXXXXXXXXXXX------------XXSCLPGKRGDIGDKGENGESGAHGPRGDFG-------------------------FNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGI-------------RGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVK 2079
            +G+ G  G PGP+G KG +G+ G+ G    RG  G  G  G  G+PG  G+                   GDRG  G+ G  G  G KG  G  G  G +G  GV G KG  GEPG   +  +G++                           G K I+G+ GD+GP+G+ G  G   KGI  +G  G PG  G  G   +   +KG         TP  P   G SG  G  G  G TG +G  G PG+ G  G+ G  GD G++G+  T    G PG KG +GI G  G+ GF G +G  G  G  G  G  G++G  G  G +G   +  +QGPQG  G      DKGD G  G+PG              G  G KGF G PG +                    + LPG  G  G KGE G  G  GP G  G                         F                + GIKGD   EG  G  G  G KG  G+ GP G+P   GL G KGPKGE+G  G  G +G VG +G KG  G                  +QG  G  G  G  G PGI             +G RG PG  G IG +G  GD G RG PG  G +G  G S    F   +G  G  GP G+EG  G  GSPGL G PG S  +G + VK
Sbjct:  863 RGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQK------------------GDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPG--VKGNRGDR----------------GPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGL--KGI--QGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGD--TVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGD---EGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKG------------------DQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVK 1489          

HSP 9 Score: 57.3806 bits (137), Expect = 2.385e-7
Identity = 115/333 (34.53%), Postives = 138/333 (41.44%), Query Frame = 1
Query: 2638 ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERG------IKGEQGINGDKGESGMIG---RTGENGEKGDQGLNGPK--------------------------------------GNVGVIGDRGETGKPGP---------IGPDGAT-------------GPKGINGI--KGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRG----------SKGDNGETGI-GQKGESGSNGEFGSKGQKG 3387
            E G RG PG  G  G  G  G QG  G    +G KG KG  G PGP G K   G +G SG PG  G+ G  G+ G +G     G  G RGD GP+G  G      + G QG  G KGE   +    R    GE G+ GL G +                                      G  G  G++G+ G+PGP         +GP  +T             G +GI G+  KGE+G+MG  G  G  G  GEKG+   KG RG  G  G  G  G KGE GE G  G          +KG  G+ G  G  GE GS GE G  G  G
Sbjct:   56 EKGARGQPGAVGPQGYNGPPGLQGFPGL---QGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAG 385          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Mouse
Match: Col4a5 (collagen, type IV, alpha 5 [Source:MGI Symbol;Acc:MGI:88456])

HSP 1 Score: 214.927 bits (546), Expect = 2.180e-55
Identity = 98/237 (41.35%), Postives = 144/237 (60.76%), Query Frame = 1
Query: 4696 ALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDM--IEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            ++   FL TRH Q  E  P CP G+  I+EG+S +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+  +M  ++ Q+++ +ISRC  CE+PA   A HSQT  +    CP+ W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  VD    F  P+ + +KA D +++     +SRC+VCMK+
Sbjct: 1463 SVAHGFLITRHSQTTE-APQCPRGTVHIYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMNMEPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPH--CPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATVDMSDMFNKPQSETLKAGDLRTR-----ISRCQVCMKR 1690          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Mouse
Match: Col4a5 (collagen, type IV, alpha 5 [Source:MGI Symbol;Acc:MGI:88456])

HSP 1 Score: 214.927 bits (546), Expect = 2.180e-55
Identity = 98/237 (41.35%), Postives = 144/237 (60.76%), Query Frame = 1
Query: 4696 ALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDM--IEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            ++   FL TRH Q  E  P CP G+  I+EG+S +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++  P+  +M  ++ Q+++ +ISRC  CE+PA   A HSQT  +    CP+ W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  VD    F  P+ + +KA D +++     +SRC+VCMK+
Sbjct: 1463 SVAHGFLITRHSQTTE-APQCPRGTVHIYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMNMEPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPH--CPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATVDMSDMFNKPQSETLKAGDLRTR-----ISRCQVCMKR 1690          
BLAST of Collagen alpha-2(IV) chain vs. UniProt/SwissProt
Match: sp|P08120|CO4A1_DROME (Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3)

HSP 1 Score: 469.159 bits (1206), Expect = 2.278e-135
Identity = 665/1886 (35.26%), Postives = 869/1886 (46.08%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIG----------EPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGF----------PGPIGDAGTDCKLFVLK-GKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQ--------------------GPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTV---KGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGE---KGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXF------DGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFG---PKGFKGIKGNTGK------PGPVGDKTIKGIKGDSGEPGVQGLKGF---TGESGDKGECSGRGEFGERGDVGPKGERG------------------IKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM--MGVKGNNGP---KGDQGEKGLETK----GQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT--LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNT--------------GSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVG------------------IKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALEST--FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVE--KYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            KNC         +C+       + G  G PGP+GP G  G MG  G  G  GD G  G  G  G RG+ G+ G PG+HG  G  G+ G  G+ G PG NG +G  G DG+ G  GLSG  G +G  G +G          E GD+ + +KGE G+                G  G+ G QG  G +G+ GD GP G  G  G+       KGEKG           PG  G+ G     F +K   T    RGD G+KGE G  G+ G  G  G+ GLDG  G++G  G  G+ G +G  GP   PGS G KG RG  G+ G  G               N G KGE G AG +GK                             G  G +G  G  G+PG QG  G+KG              G    PG  G  G KGE G +G +GP+G  G  G  G  G  G +G       GI+G  GD G+ G  G+ GSKG +G +G +G P        G  G  G  G+KG +G  G  G+ G  G+KG +G  C  C+ G  G+KG  G  G  GKDG  G  G  G  G+RG  G +G  G  G  G+ G  GLPG  G  G            +KG+KG  G  G +G +G KG+ GL G PG  G+ G  G KG  G PG  G  G  G  G  GI  + ++GE G  G    KG K   G  GEKG+ G+C ++ +K       G++G+ G+ G+ GP G+          G+KG+ G +G  G+ G +G  G  G KG +G  G       DG+ GIPG+ GQ G  GE G I   G  G  G  G  G KGD G  G   IG  G +GS G  G+ G  GLPG++G  G  GE G+ G IG  G   P G  GI G  G+      PG  G   + G KGD G PG  G KGF   TG  G +G     G  G +GD G  G  G                  IKG+QG+ G  G+ G+ G  GE G +G  GL+GP G  G   ++G+ G+PGP G  G TGP G  G  GE+G+  + V G  GP   KGDQG  G++ +    G++GE+G  GV G  G KG +G PG+ G+ G +G  G       +G  G+ G  GE G  G  G++G                        + G +G +G  G                 GPKG  GI G+ GL      ++G+ G  G+ G TG+ G  G++G  G  G+ G +G+ G  G  G  G+ G  G KG++GP+G+ G  G T              G +G  G  G  GE G  G  G  G  GL GP    G  G RG  G+PG+ G                   KGE+GL G  G+ G  GD+G    G  G  G +G KG  G  G+ G  G  G  GE G  G KG  G  G  G  G+ G  G     G  G+ G  G NGP+G+ G  G +G+ G +GE G                             +KG RG IGE G++G+ G KGD GEP  RG +G  G             ++G KG  G                           P   AL+     L TRH Q+ E  P C  G  +++ GYS +  +GN   +  +LG+  SC+  F+ +P   C ++  C    R D+++WL + A +   M+ V+N+E  +YISRCV CE+PA   A HSQT  + D  CP  W  LW GYSF+MHT  GN GGGQ+L SPGSCL  FR +P +ECN     C+ +    S+++ +++S   FE P+ + IKA + +S      +SRC+VCMK
Sbjct:   71 KNCTAGYAGCVPKCIA------EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGW---------------RGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGP---PGSTGQKGDRGEPGLNGLPG---------------NPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKG------------GAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK---MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPG-ISRPGPMGPPGLNGLQGEKGDRGPTGP--IGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKG------------------------ETGPVGLQGFTG---------------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL--QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG-----------------------------EKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIG-------------LIGQKGEPG--------------------------APAPAALDYLTGILITRHSQS-ETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIP--MMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPD--CPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQS-----HVSRCQVCMK 1776          
BLAST of Collagen alpha-2(IV) chain vs. UniProt/SwissProt
Match: sp|P08572|CO4A2_HUMAN (Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4)

HSP 1 Score: 299.286 bits (765), Expect = 1.516e-80
Identity = 359/1111 (32.31%), Postives = 472/1111 (42.48%), Query Frame = 1
Query: 2443 FDGVPGIPGKRGQSGLDGEKGD---------------IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI---KGIKGDSGEPG---VQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGD---RGETGKPG-----------PIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNM-GVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGP---KGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-------------------------------------------PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGE---MGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEP---AV----------RGPKGVKGE------------QGLSGYSGQE--------QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV-DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            F G PG  G RG  G  G  G                 G +G+ G++    + G +GD G  G PG+  KG  G RG  G  G +G+PG+ G  G  G  G  G  G +GP G  G  G  G+ GP+G   I   +G+ GD G+PG     G  G  G SGD+G+    GE G  G  G KG  G+ G  G+ GD+G  GM G  G  G KG  G  G KG  G  G    +G  G+PG              P    G K I G KG++G MG+KG  G KG QG  G+       G  G  G++ GV G++G  G  G PG  G  G  G TG    IG +G+ G+ G  G  G+ G  G                        D G+IG    +                     G  G+ GE+G +GI  LKG  G                            +G EGDIG  G  GV G  GP   KG  G  G  GP G+ G  G  G  G  G+DG  G  G  G  GL G                                           P   G  G +G+ GAPG+ G  G  GL+G PG        G PG+  +G  G  G KG  G  G  G +   G  G++G  GA G  G  G  G                        ++GP+G  G+ G+ G +G +GE   MG+TG  GA                 +     KG +G+ G PG  G VG+ G  G P   AV          RGP G  GE            +G  G +G +         G  GD+G IG QG        G +G  G  G  G  G  G+++   +L  +H Q  +E P+CP+G NK++ GYS +   G  + +  +LG   SCL  F+ MPF  C+    C    R D+SYWL++ AP+    +    ++ YISRC  CE+PA   A HSQ  ++S   CP  W  LW GYSF+MHT  G+ GGGQSL SPGSCL  FR +P +ECN G   C+++ +  S++L  + +  F+        A+  K+  +   +SRC+VCMK
Sbjct:  730 FPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEV-LGAQPGPRGDAGVPGQPGL--KGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATG------------------------DFGDIGDTINL--------------------PGRPGLKGERGTTGIPGLKGFFG---------------------------EKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGD--KGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAG------------------------DSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGA-----------------VGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGP------IGQEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQE-PMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQ--DVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQ----GSPSADTLKAGLIRTHISRCQVCMK 1710          

HSP 2 Score: 189.119 bits (479), Expect = 1.299e-46
Identity = 309/865 (35.72%), Postives = 387/865 (44.74%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERG-PSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREET--------FPSIKGEKGDNGPDG------KEGPKGIKGSPGLNGKPGISGDMGKM-GVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNC--TINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPG---------------------------ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKG-------EQGMMGVKGNNGPKGDQGEKGLETKGQRGE-KGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKG 3387
            PG  GA G  G +G  G+ G  G PGP   PG  G +G +G+ G+ G  G  G  G+ G  G  G RG  GEV         +G   GP+G   D G  G  G+ G  G+ G  GF+G  G  G         +PG +G  G  G +G+ G +GP G  GF                     G  G EG  G  GI G +G+ G+RG P      G VG KG  G++G +G  G+ G  G  G KG+ G                 G  G KG  G  G DG  G+ G +GRPG  G+ G  G +G  G +GL G+ G KG++GD                IKGEKGD GP G       +G +G+ G PGL+G PG+ G  G + GVKGD G PG+ GL G  G  G  GI   P   G RG +G  G   + GE G  GD G+   TIN   P      G+RG TG PGL+G  G+ G +GD G  G  G                       GV G PG +GQ+G  G  G  G+QG   ++G  G  G KGD G  G PG+ G  G  G RG  G  G +G PG                           + G +G  G+ G+QG  G  GP G  G++G    PG      I G  GD G PG+ GLKG+ G  G  G  +  G  G+ G+ G  G  G KG  G +G +G  G+ G  GE G +G+QG  G  G  G +GDRG  G  G  G  GA G  G  GI G       + G +G +G  GP G  GE G +        +G  G  G  G  G    PG RG +G  G  G IGQ+G  G  G  G  G  G
Sbjct:  707 PGFAGADGGPGPRGLPGDAGREGFPGP---PGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEV---------LGAQPGPRG---DAGVPGQPGLKGLPGDRGPPGFRGSQGMPG---------MPGLKGQPGLPGPSGQPGLYGPPGLHGF--------------------PGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGIDGMP---------------GTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINL--PGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITG---------------------VTGVQGPPGLKGQTGFPGLTGPPGSQG---ELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGF---PGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPG 1483          

HSP 3 Score: 155.606 bits (392), Expect = 2.390e-36
Identity = 280/855 (32.75%), Postives = 356/855 (41.64%), Query Frame = 1
Query: 1507 GDSGDEGLQGEKGISGSKGVKGERGPSG-RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNF-GPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGD-----------RGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAKGELG---EPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNG-PTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGEL------------GPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEM 3954
            G  GD G+ G+ G+   KG+ G+RGP G R + G+ G  G KG+ GL G  G+ G  GP G+ G  G                    G++G  GL G  G  G+ GDRG PG+ GA G  G  G  GDR   GD G  G      E+  P   G KG +G  G  G KG +GSPG++G  G+ G  G+ G  G                           +GE G  G  G+K + GE G KG  G+       P+    M D    GE G +GP+G   +KG  GAKG                          G+PGIPG  G  GL G  G I  +G+KGDIG  G  G  G  G  G PGI G  G  GSRG++G  G  GL    G+IG  G+ G+ GD  N  G  G KG +G TG PG  G    KG +GD G PG+ G+ G  G  G KG+    G  G  G  G  G  G+ G +G +G  G  G+ G  G  G +G  GL G KG  G  G             GE G PG    +   GP G+ G KG+QG  G +G  G  G QG  G+       G  G+KG  G+ G  G +G  G      + GSKGD G  G     G KG +G +G  G  G  G+ G                                                   + GP+G  G  G  G +G +  +G  GP GD G P     +         + +  + G  G  G +G  G  GE+            G  G  GPQG  G     G +G+ GP G  G  G +G  G  G+ GL G    GRS + G +
Sbjct:  782 GPRGDAGVPGQPGL---KGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAP------------------GQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDR---GDAGFTG------EQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGS--------------------------KGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKD--IKGEKGDEGPMG---LKGYLGAKG------------------------IQGMPGIPGLSGIPGLPGRPGHI--KGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL---YGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEA--NTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPG---------------------------------------------------EKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPG--MPGRSVSIGYL 1491          

HSP 4 Score: 131.339 bits (329), Expect = 5.428e-29
Identity = 230/665 (34.59%), Postives = 290/665 (43.61%), Query Frame = 1
Query: 2278 TEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGE-----------------QGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGE-------PGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQG---------------DQGPKGNTGSKGE------------TGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
             + G RGD G PG  G  G  G +G  G +GS                         G+PG+PG +GQ GL G  G     G+ G  G  G  GA G  G +G PGI    G+ G+ G  G+ G  G  G+ G++GD G+ G +GEQG  G+    GFKGI G  G PG  GD+   G+ G  G PG++G  GF G  G+ G       FG  G  G  GE G KG                  + I G+KG+ G +G  G  G KG QG+ G  G  G+    G  G+PG I      G KG  G+ G  G+ G  G  GP G  G  G   ++G +G  G  G+ G +GA G+ G+       PG  G KG+ G TGI    G  GE G+ G+ G  G  G+ G +G  G  G  G  GL G  G +G++G IG  G  G  G  G           G  G  G+ G +GL G+   KG  G  G +                        G  G  G+KG++G  GE GP G+ G QG               D+G  G  G KG              G KGD G  G  G  G KG  G SGP  QGR    G  G PG+ G +GEQG  G  G  G +GD+G      +GP GD G  G
Sbjct:  779 AQPGPRGDAGVPGQPGLKGLPGDRGPPGFRGSQ------------------------GMPGMPGLKGQPGLPGPSG---QPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGS---PGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGF------FGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGI---PGLPGRPGHI-----KGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPG---------APGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGP--QGRP---GVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGP-----KGPKGDPGFPG 1380          

HSP 5 Score: 105.531 bits (262), Expect = 4.320e-21
Identity = 247/698 (35.39%), Postives = 301/698 (43.12%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPG---CNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPG----DFFQAKKGEKGF--------AXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGK-----TP-----PDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNR----GTPGPKGQ------PGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGY---------QGNLGEKGFKXXXXXXXXXXXXX------------XSCLPGKRGDIGDKGENGESGAHGPRGDFGF----------NXXXXXXXXXXXXXKTVKG------------IKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAG-------RDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVK 2079
            G+PGP G       PG  GP G  G  G  G  G +G  G  G++GLPGDRG+ GD G PG  G  G   L GDRGD G  G     G+ G KG DG+ G  GL GD+G  G  G+ G PG      F   KGE GF           E                     G K I+G+ GD+GP+G+ G  G   KGI  +G  G PG  G  G   +   +KG       P     P   G +G  G  G  G  G +G  G PG  G  G+ G  GD G++G+     G PG KG+      PG KG  G +G++G IGF G+ G  G+QG  G  G  G  G  G  G  G+ +G I  P G  GD G  G  G+PG+          G  G KGF G PG +                    + LPG  G  G KG+ G  G  GP G  G           N               +KG            + G  GD G  G  G  G+KG  G+ GP GRP   GL G KGP+GE+G  G  G  G VG +G KG  G              G  G  G  G  G+AG       + G  G +G RG PG  G +G +G  G+ G RG PG  G +G  G S    F   +G  G  GP G+EG  G  GSPGL G PG S  +G + VK
Sbjct:  824 GLPGPSG------QPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKG---LSGDRGDAGFTGEQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGA--KGI--QGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGE-LGRIGLPGG-KGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDP------------GFPGAPGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSVSIGYLLVK 1494          

HSP 6 Score: 100.523 bits (249), Expect = 1.430e-19
Identity = 212/589 (35.99%), Postives = 262/589 (44.48%), Query Frame = 1
Query: 2476 GQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAI---------GNPGIGIKGNEGSRGEEG---ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL------------------ETKGQRGEKGNMGVIGNVGAKGELGEPG----------------MRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEK------GLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGE-----TGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKI------GRMGDKGKPG 4047
            G+ G  G  G IG +G KG +G  G  G+ G  G           G PG  +    G RG+ G   + G++GLP   GD G  G  G QG  G  G KG  G+ G +G+PG  G   + G  G  G+ G  GL G  G  G           G+RGD G  G  G  G +G++GD+G++G  G  G  G  G +G++G  G  G+ GDRG  G  G  G  G  G  G  G KGE G  G+ G  G  G+ G KG                   + KG++G++G MG+ G +GAKG  G PG                ++G KGD G  GI G  G  G  G  G  G  G  G +GD G  G  G  G  G  G+ GDIG+             G+ G +G  G  G  GL G  GEK      G  GIT + G  GP G  G TG  GL G  G +G  G  G  G +GD G  G  G+ G  G +G  G  G  G KG  GS G       G  G  GE GD G         L GP   G  G +G+ GAPG+ G  G  GL+G PG        G  GDKG PG
Sbjct:  726 GREGFPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQPGPRGDAGVPGQPGLKGLP---GDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAPGQEGPLGLPGIPGREGLP---------GDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGHPGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGATGDFGDIGDT--------INLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEA-----NTLPGPV--GVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGAPG 1287          

HSP 7 Score: 79.7221 bits (195), Expect = 2.389e-13
Identity = 182/556 (32.73%), Postives = 234/556 (42.09%), Query Frame = 1
Query: 1816 RGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGL---QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVG-------DKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGN-----------VGVIGDRGETGKPGPIGPDGATGPKGING-------IKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAK---GELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKG 3387
            +G RG+PG    +G +G  G  G +G PG +G KG KG+         +G  G  GP G  G +G+ G PG +G PG  G  G  G  G +G                        QG+ G QG  G +   G  G +G  G     +  P    +   RG+ GEPGL   QGP G+ G  G Q              P  P  +      GF GV G  G  GQ G +G   D  +  +            KG+ G+ G PGI     +G  G  G  G+RG PG++G+ G+ G+ G +G  G  GP G +G KG  G PGP G           KG +GD G PG QG  G  GE GD G     G     GD      RG+ GE G  G  G+ G+    G       +                    G+ G +G  G PG  G  GA GPKG  G        +G++ + G+ G  GPKG  G  G    KG RG+ G  G+ G  G K   G +G PG +G+KGD+    I  KGE G  G  G  G KG
Sbjct:   57 KGGRGQPG---PVGPQGYNGPPGLQGFPGLQGRKGDKGE---------RGAPGVTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDG--------------------CNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERDR-YRGEPGEPGLVGFQGPPGRPGHVG-QMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKGEKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGFPGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSLAKGARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQ----RRGLPGEMGPKGFIGDPGIPALYGGPPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAKGRAGFPGLPGSPGARGPKGWKGDAGECRCTEGDEAIKGLPGLPGPKGFAGINGEPGRKGDRGDPGQHGLPGFPGLKGVPGNIGAPGPKGAKGDS--RTITTKGERGQPGVPGVPGMKG 572          

HSP 8 Score: 57.7658 bits (138), Expect = 1.296e-6
Identity = 107/324 (33.02%), Postives = 130/324 (40.12%), Query Frame = 1
Query: 2638 ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQG------------------------INGDKGESGMIGRTGENGEKGDQG-----------------------LNGPKGNVGVIGDRGETGKPGP-----------IGPDGAT-------------GPKGINGI--KGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKG 3387
            E G RG PG  G  G  G  G QG  G    +G KG KG  G PG  G K   G +G SG PG  G+ G  G+ G +G     G  G +GD GP+G  G +G  G                          G+ GE G++G  G  G  G  G                        N   G  GV G++G+ G+PGP           I P G T             G  GI GI  KGE+G+MG  G  G  G  GEKG    KG RG  G  G  G  G KGE G+PG  G    +    +  KG  G  G  G++G+ G
Sbjct:   56 EKGGRGQPGPVGPQGYNGPPGLQGFPGL---QGRKGDKGERGAPGVTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERDRYRGEPGEPGLVGFQGPPGRPGHVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKGEKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGFPGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSL-AKGARGDPGFPGAQGEPG 375          
BLAST of Collagen alpha-2(IV) chain vs. UniProt/SwissProt
Match: sp|Q5UQ13|COLL2_MIMIV (Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R196 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.713e-73
Identity = 416/1107 (37.58%), Postives = 551/1107 (49.77%), Query Frame = 1
Query:  241 VGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGL------LGTACKLCXXXXXXXXXXXXN---------QGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDI------------------GDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPG---LNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATE--------------MGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-------GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKG 3387
            VG+ G +GD G  G+ G  G KG  G  G  G +G  GD G  G+ G  GD+G+ G+                G++GD G+ G  G+ G KG++G+ G  G  GD G KGD G  G+ GD      G+ G  GD+G  G+ G KG  G +G +GD+G+KG +GD+GD+G  G  G+ GD+   I  KG KG  G IGD G       +KG      +GD                         G  G +G KGD G  G++G  G KG  G  G KG +G +G+ G                 G++G+KG+ G+           +G +G  GDKG KG+ GI GY+G++G+KG KG  G          +   G +G  GDKG+ G  G  G +GD G+NG+               G KGD+G++G  GEKG +G KG KGE+G  G    G  G KG  GEKG  G  G  G++G   + G       LG    +    + G    K N         +GEKG  G +G+  N G +GD+G  G  G  G +GS GDI                  GD+G  GDKG KG KGD  +E     KG KGD G  G  G +GIKG  G     G  G  GD G  G KG++G+ G  G KG  G+        K  +G++G +G+KGIK   G+KG+KG  GN      K                     GD+GD G  G +G  G  G+KG+ G+KG  G  G KG+                G  G  G++G+ G  GEKG  G +G KG+ GDKG  G KGD G  GN G+       GIKG  G +G+ G+ G++G  G  GD G++G  GE+G+ G+ G KG KG KG+ G  G  GDK IKG  G  G+ G +G KG+ G+ GDKG    +G+ G++G  G KG +G KG +G+ G KG+ G  G  G+ G+KG +G NG KGN G+ GD+G  G  G  G  G  G KG  G KG  G  G KG+ G +G +GE GL  KG +G+KG  G+      KG+ G  G +G KGD G+ GI G KG+ G  G+ G KG KG
Sbjct:  176 VGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDK-GNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDI-----GDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGD-IGDKGMKGDKGDIGDKG-------MKGDNST--KGDK------------------------GDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKG---------------DKGDKGTKGDKGD-----------KGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGA---------NADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEI--------------GQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEK--GDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGD--------KGSKGDKGTKGDKGIK---GDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEK---------------GSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLSIKGDKGDKGEFGLS----IKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKG 1161          

HSP 2 Score: 274.633 bits (701), Expect = 5.193e-73
Identity = 459/1236 (37.14%), Postives = 598/1236 (48.38%), Query Frame = 1
Query:  454 LFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGD---KGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDS---GDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDS---------------GNCTIN-----FVKPLNATEM------GDRGDTGEPGLQG---------PIGKVGVKGDQGAKGS------------DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDI------GDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGE---------------------------QGDIGNFGPKGF------KGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGD---RGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGE---KGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETG 3843
            + G +G+ G  G  G  G KG+DGL G   L G +G+   + Y GE GD +  K    G    + +     + G  G +G  G +GD+G +GD G +G  G +G  GD+   + QKGE G  G  GD G   K                                        G+ GD G KGD GN G++G  G KG  G KG  GI+G +G  G           G +G +G +G KG++G+ G        I+G +G  GD   KGDKGN+G  G +GN G+KG            DIGD  + G +GDIGDKG+ G+ G  G +GD G                  KG+KGD+   GD+G  G KG  G  G+KG++G +G  T G  G  G KG+KG +G+ G  G  G KG KG  GT                     KG +G  G  G+ GI+G +G  G+ G  G  G+  D GD+G+ GDKG KG KGD          G KGD G +G+ G KG  G  G NG+ G +G+ G  G KGD G                     K   GE+G  GEKG K   G+KGE G S               G+  I+       K LN   +      G++GD GE G              G++G KGD+G+KG              GI G KG  G  G+KG KG KG  G  GI G +G  G  G+KGDIG+QG+KG+       GDKG  G KG+ G  GN G     G KGN+G +G +G+ G +G  GI GD G++G  G                            +GD G+ G KG+      KGIKGNTG  G  G K  KG KG  G  G +G KGF GE G KGE   +G  G++GD G KG+ GIKG  G+ GDKG+SG+ G  G  G+ GD+G+ G KGN G  GD   +GE G  G  G  G  G KG  GIKG +G  G+KG +G KGD+GEKG   KG +G+KG+ G +G  G KG+ G  G++G+KGD G  G+    G KG+ G+NG+ G KG KG                 G KG KG +GD G IG +G  G  G  G KG++G+ G +G KG  G  G+   KG +G+++KG+ G  G+ G +                    +G +GD G KG+KG KG  G KG+ G +GDQG KGN G KG+ G
Sbjct:  109 IMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFG-QGLP--RPYEGENGDVYIDK--NTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGD-MGQKGETGAKGDKGDKGEGSK----------------------------------------GSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKG---------DNGTKGDNGTKGDKGDIGDNG--------IKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKG------------DIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIG-----------------DKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNG--TKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGT---------------------KGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDD---------GSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIG--------------------EKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKG--NKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGT---------------NGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLSIKGDKGDKGEFGLSIKGD----------------KGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKGDKG 1167          

HSP 3 Score: 258.07 bits (658), Expect = 6.866e-68
Identity = 430/1178 (36.50%), Postives = 560/1178 (47.54%), Query Frame = 1
Query:  988 RGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGP-FGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDK---GIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDI---GNQGMKGDIGDKGRSGAKGDTGAIGN-------------------------------------PGIGIKGNEGSRGEEG---------------ETGMRGLPGITGDI---------------------GNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDS------GEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGR---------------------------------TGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQG------------PKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAP--GKVGIKGEQGLEGLPGKIGRMGDKGKPG----NGIEGPDGDIGNKG 4089
            RG+KG+ G +G  G  G KG+ GS+G KG++GSDG+ G         + G+       G  G+V     +G     I G   P  G KG +G+QG  G QG+ G+KG K         G+ G +   G +GD+G KGE G  G  G +G+                 K  KGIKGD G EG++G+ GI G  G KG+ G     T G  G KG KG+ G +G+ G  G +G  G+KG                     ++G KG +G  G  G+ G  GD+G  G+ G IG +   GDIGD+G+ GDK   G KG KGD+      S KG+KGDNG  G +G  GIKG  G NG  G +GD G  G KGD G                       ++G++G +G KG K   G KG+ GD G    N +K     ++GD+G  GE G     G  G+KGD+G KG  G  G KG  G  G  G KG  G  G  G  G  G+ G  GEKGDI   G+ G KGDIG+KG  G+KGD G IG+                                     P   IKG +G +GE G               E G +G  G  GDI                     G++G+ G +GD G+ G +G KG KGN G  G  GD   +GIKG+S      G+ G +G KG  G+ G+KG+    G+ G +GD G KG++G KG++GI GDKG+ G  G                                   G  G KGD+G  G KGN G  GD+G  G  G  G  G  G KG  G KGE+G  G KG+ G KGD+G+KG +         G +G+KG+ G+ G  G KG++G+ G++G KG+ G+   G KG  G  G  G +G KG++G KGD G  G +G  G+KG  G KGD GE G++G  G  G  G  G +G+ G  G KG+ G  G+KG  G+  KG  G  GD G                             G+KG+KG+KG  G KGN G +GD+G             KG+ G KG+ G  GD G  GDKG+ G KG  GLS    +G  G++GE G    G  G+KG+QG +G  G  G  GDKG  G     GI+G  GD G+KG
Sbjct:   98 RGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNG------STILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQK---------GEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNG-----TKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKG---------------------DKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDK---GDIGDKGMKGDKGDIGDKGMKGDN------STKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNG-----------------------IKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKG-DIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDK--GDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGV--KGTKGDKGDKGTN---------------------------GDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLS---IKGDKGDKGEFGLSIKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKGDKG 1167          

HSP 4 Score: 211.075 bits (536), Expect = 1.951e-53
Identity = 437/1126 (38.81%), Postives = 551/1126 (48.93%), Query Frame = 1
Query: 1498 GIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVG--PKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD---IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGI---SGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGK--------PGP---------VGDKT----------------IKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI---NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN----------GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKG------------------------VQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEP--------GDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSI 4599
            G+KG  GD+G +G++G  G KG KGE G     + G  G KG  G+KG +G  G  G  G   KG KG +G                 G++G KG  G+ G  G+ GI+GD G  G++G  G  G+ GD    GD+G  GD GIKG KGD  +      KG KGDNG  G +G KG  G  G+ G  G     GD+G  G+KGD+G+                        G++G++G+   K   G+ G KGD G+  I   K  N T+ GD GD G  G +G  G  G KGD+G KG  G  G KG  G  G KG  G KG+ G  G  G +G+SG + +KGD G +G KGD G KG  G+KGD G  G  G  G  G +G  GE+G+ G +G  G  GDIG +G++GE+GDIG  G KG KG KG  G         P P         + D T                IKG KGD GE G    KG  G+ G+ GE   +G+ G +GD+G KG +G KG+ GI    GDKG  G  G  G+ G+KGD+G+ G KGN G  GD+G+ G  G               IKGE G    KG+ G KGD+G      KG +G KG+ G  G+ G KG+ G  G +G+KGD        KG  G  G+ GSKG KG +G+KGD G  G KG  G KG KG KGD G+                         G KG  G  G+KG+ G T  KG+ G  GD G                      +G++G+ GEKG KG KGE G KG  G +G++G KG+ G KG+ G KG+ G  GDKG+ G KG  GL G       +G  GN G+ G  G  G KG +G EG  G  G  GDKG  G+          G +G  G+ GNKG +G +G KG  G KG+ G+ G +G KG KG+ G KG  G  G  G KG  GD GDKGIKG NG +G+ GL G KG                        V G KG  G  G  G KG  G    G             KG++GE G          GD G  G KGD G    +G KG+KG+QG+ G  G +    GDKG++
Sbjct:  177 GLKGSQGDQGYKGDQGSKGDKGQKGEFG-----SAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNK---------------GDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDI-----------------------GDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTK-GDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQG---------------IKGESGSAVFKGDKGTKGDKG-----NKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGD--------KGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDK------------------------GSKGYKGDKGDKGIKGNTGSKGDKGSKGDKG---------------------EKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLSIKGD------------KGDKGEFGLSIKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDK----GDKGNL 1169          

HSP 5 Score: 191.815 bits (486), Expect = 1.876e-47
Identity = 342/938 (36.46%), Postives = 440/938 (46.91%), Query Frame = 1
Query:  241 VGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDS------GSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGD---KGYIGEPGDF-------FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ-PKG-IAQKGEKGFPGPIGDAGTD----------CKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEG------------------------------LQGEKGISGSKGVKGERGPSG-RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIG---------------------------DKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIK 2796
            +G  G KGD G IG+ G IG KG  G+ G++G +G+ GD+      G NG  G  GD G  GD G  G  GD GD G  GD+GD G+ G  G  G KG+ G  G  G +GDKG KGD   KGY G+ GD          A KG+KG  GD+G  G KG+ G  G +G +G+ G KG  G+ GD G  G +GE GD+  KG I +KG+ G  G IG+ G              +   +G   PD   D     +               P  D   G++G KG++G   N+G  G KG  G  G KG +GS G IG KG +G KG  G +G  G++GSKG+ G  G         +G +G  G KGDKGN+G  G +G++G +G KG  G     GD G     G +GD G+KG+ G +G  G +GD G               K  KGIKGD GD+G                               +G+KG  GSKG KG++G  G +  TG  G KG KG+KG  G  G  G+ G KG KG                        EKG  G  G  GN G +GD+G  G++G  G  G  GD GD G+ G+ G+KG  GD        IKG+KG+ G  G +G KG KG+ G  G  GI G+ G  G+KG EG+                    K ++GE G +G+KG K   G KG+KGD GN  I           GD+GD G  G++G  G  G KG +G KG                          G  G  G +G  G+ G  GD GN+G++GD G                           DKG  G KGD G  G  G+ IKG++G +GE G + ++G  G+ GD   QG  G++GD G  G KG KGIKG+ G  G  GDK  K
Sbjct:  334 IGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTD-IKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKG--------DKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKG--------SKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKG------------------------EKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGD------KGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGD--------------------KGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGI----------KGDKGDKGIKGVKGTKGDKGTKGVKGTKGDK------------------------GDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLSIKGDKGDKGEFGLS-IKGDKGVKGD---QGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKGDK 1166          

HSP 6 Score: 182.185 bits (461), Expect = 1.702e-44
Identity = 213/550 (38.73%), Postives = 282/550 (51.27%), Query Frame = 1
Query: 1606 LVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGL---QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMG 3246
            L G KG KG+ G+ G  G+ G++G +G+KG+ G+          G+   +  +GE G   +   D N GI     +  N   I + G  G  GD+G  GD+G KG KG   E      KG+KGD G  G+ G KG KG  G     G  G  G +G KGD+GN                       +G++G++G+KG + I G+ G KGD+G    N  K  N T+ GD+GD G+ G+   +G IG  G+KGD+G K                                          G+ GD GN+G KGDIGDKG  G KGD G  G+  IG KG +G +G+ G+ GM+G     GD G+ G  G++GD G  G KG  G KG+ G  G  GDK   GIKGD G+ G +G KG  G  GD G+   +G+ G +G  G  G++GIKGE G N DKG+ G+ G  G+ G KGD G  G KG  G IG +G+ G+ G  G  G  G K   G KGE+G +G KG+NG KGD GEKG   KG +G+KG +G
Sbjct:   97 LRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYI---DKNTGIMY---KKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKG----EGSKGSKGDVGNKGDKGN-----------------------KGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTK-GDKGDIGDNGIKGDKGDIGDNGIKGDKGNK------------------------------------------GDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGD--IGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEK---GDKGEKGDIGEKGDNGEKGDIGEKG--NKGSKGDKGEIG 563          

HSP 7 Score: 155.221 bits (391), Expect = 2.756e-36
Identity = 315/745 (42.28%), Postives = 398/745 (53.42%), Query Frame = 1
Query: 2479 QSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVK---GELG---------PKGNVGPQGDQGPKGNTG-----SKGETGPKGDF-GEDGDKGNVGPKGNKGLSGPCQQGRS-GNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDK----------KGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGAR 4617
            Q GL G +GD   QG KGD G KG  G KG+ G+ G      KG++G  G++GETG +G  G  G    +G  G +GD+GN G KG KG KG  G  G  G K   GIKGD+G  G  G KG  G  GDKG+    G  G++GD+G  G +G KG +G NGDKG  G  G  G+ G KGD+G  G KG+   IGD+G  G  G IG  G  G     G KG+ G  G KG+NG KGD+G+ G  TKG  G+ G  G  G+ G KG+ G+ G +G KGD G  G    G+ G+ G+ G KG KG                           DIG+ G +G+ G     G KG +G+ G  G KG  G  G+KG +G I  KG++G  GDNG  GD G  GDKG+KG  G  G  G +GDIGEKGNKG K   GE+G         P  ++G  GD     NTG       G   P+ D  GE GDKG  G   NKG  G    G   GN+G+ G+ G +G KG +G +G  G  G  GDKG  G+  +G  GD G+KG EG +G KG  G+KG+ G+ G QG KG  G    KG+ G  G  G+KG KG+ GDKG  G+ G +GD G  G KG +G KG  G  G  G+KG +G +G  G KG  G  G+            KG++G  G  GD G  G KG+ G    +G KG KGE+G  G  G+  E+G  G+KGS G +G++
Sbjct:  175 QVGLKGSQGD---QGYKGDQGSKGDKGQKGEFGSAG-----FKGDKGDMGQKGETGAKGDKGDKG----EGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGD---IGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNG--TKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKG--DNGDKGTKGDNGIKGYKG---------------------------DIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGD--KGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSK 871          

HSP 8 Score: 80.8777 bits (198), Expect = 1.300e-13
Identity = 117/290 (40.34%), Postives = 150/290 (51.72%), Query Frame = 1
Query: 3748 KGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGAR 4617
            KG KG+ G KG  G +GD+G KGNTGSKG+ G KGD GE G KGN G KG KG      +G  G++GE G+ G  G KG++G +G  G  G +G        ++G  GD G KG  G +G  G+ G KG+ G  G +G KG KG                              E G RGD G  GIKG +G KG  GS G  G KG  G +G  G           +KGN+G  G+ GD G +G KGD G+  ++G KG KG++G  G  G  +G  GDKG+ G +G +
Sbjct:  805 KGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGF-----KGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIG--------VKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKG------------------------------EKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKG-----------EKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGT-KGDKGDKGTNGDKGDK 1039          

HSP 9 Score: 55.4546 bits (132), Expect = 6.139e-6
Identity = 122/305 (40.00%), Postives = 161/305 (52.79%), Query Frame = 1
Query: 3733 GEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGE------DGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGAR 4617
            GEKG KG  G +G KG  G  G QG KG  GS G  G    FG+      +G+ G+V    N G+      G       +  P +VG+KG QG +G  G  G  GDKG+ G     G +G  GD+G KG  G +G KG+ GE         +G+KG  G  G+KGN G+ G  G KG +G  GD GIKG+NG +GD G  G  G +G KG++G  GI G KG  GD G+              KG++G  G+ GD G  G KGD+G+  ++G KG  G++G  G    ++GM GDKG IG +G +
Sbjct:   99 GEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKING-------IWIP-QVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEG-------SKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGI--------------KGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIG----DKGMKGDKGDIGDKGMK 370          
BLAST of Collagen alpha-2(IV) chain vs. UniProt/SwissProt
Match: sp|A0MSJ1|CRA1B_DANRE (Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 3.016e-62
Identity = 385/1040 (37.02%), Postives = 485/1040 (46.63%), Query Frame = 1
Query:  973 GAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKG---VKGERGPSG----RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGR---DGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKG---SPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-------IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGI---NGDKGESGMIGRTGENG------------EKGDQGLNG-------PKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-ITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGA 3960
            G VG  GQ G  G  G +G PGP G PG +G +G  GS G  G+ G +G  G  G  G  G RG  G  G  G  G       G +G  G  G KG  G PG+ G+ GE+G  G  G  G IG  G   +PG  GD+G  G  G  G  GP+G  G               K   G+ G+ G+ G QG+KGI GS G   V+G+ GP G    R   GL GP GP+G  G  G  G+NG  GPKG  G+ G        G  G++G  G  G  G +G  GR    GNPG  G +G PG  G  G  G  G +G  G  G+ G+ G KGD  E   P   GEKG  G  G  G +G+ G   +PG +G  G+SG  G  G +G  G                      PV GE+G+ G KG    +G  G++G SG             +MG  G+TGE    GP G  GV+G  G  G+                         G+ G PG +G  G+ G  G+IG  G+ G  GD+G  G  G+ GA+G+PG       IG +G+ G  GE G +G  G  G  GD+G +GESGE+G IG      FKG +G TG PG +G K  +G  G  GE G  G KG  G  G  GE    GE G+ G +GPKG RG  G  G     G +GE G++G  G  G            EKG+QG +G       P G++G +G+RG+ G+PG     G  G +G+ G +G++G  GV GN+GP+G  G KG +  KG +G+    G  GN G+ G +G PG RG  G  G      +GE G +G  G  G KGM G                        D+G                 G+ G  GK GP+G +G  G  G+ G    KGE G  G +GP G  GL G  G  G +G  G +G  GD GE+G  GV G  GP+G   P GD GP G  G KG  G  G  G  G  G +GP GN G      QG  GN+GEMG 
Sbjct:  493 GLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYPGRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGA-----DGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPG-----NPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARG-------------------PDGPV-GEKGMMGMKGP---EGPPGKQGLSG-------------QMGKIGETGE---AGPTGFTGVQGPTGPPGAK------------------------GILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIG------FKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGD---PGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGF-----EGEPGLDGAAGKDGAKGMPG------------------------DLGR---------------DGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQG---PPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPG-----PQGDKGNKGEMGV 1398          

HSP 2 Score: 232.261 bits (591), Expect = 7.999e-60
Identity = 390/1063 (36.69%), Postives = 480/1063 (45.16%), Query Frame = 1
Query:  259 KGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNI----QGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERG---PSGRP----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVK-----PLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAI-GNPG----IGIKGNEGSRGEEGETGMRGL------------PGITGDIGNQGESGEQGDIGNFGPKG---FKGIKGNTGKPGPVGDKTIKGI---KGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI 3330
            KGD G +G PG  G  G  G  G  G  G  GD G  G DG PG +G                       G  GLPG  G  G KG  G  G  G+ G  G  G++G  G PG     KKG+ G  G  G  GE+G  G  G  G  G  G  GI G +GD GP+GM G PG         G KG PG  G+ G       LKG      +G+                      GL G  G+ G +GD G  G+ G PG +G+PG +G  G RG DG+ G  G EG  G  G  G++G  G KG  G  G  G          QGP GP G  G +G  G  G  GN GE+G KG                PG  G+ G  GE G  G  GP G+ G  G+              KG +G++G  G  GEKG  G  G  GERG   P+G P    + GL G +GPKG +G  G DG  G+ G  GMKG  G   K    G +G+ G  G  G  G  G+ G  G PG +G  G PG  G+ G  G  G+IG  GLPG  G +G  G+          GEKG  G  G  G +G+ G     G PG+ G+ G  G  G +G                        QG+ GL+GE G K + G KG +G +G+  +  VK     P    E G  G+ G  G QG +G++G  G+QG  G              G KG +GT GF G PG  G++G+ GL G +G  G QG  G  G KG  G +GD G + G PG    IG  GN G RGE G+ G  GL            PG+ G+ G +G  G +G  GN GPKG    +G  GN G PGPVG    +G+   +G  GEPG+ G  G  G  G  G+    G+ G  G  GP+G  G  G  G+ G  G  G  G TG +G  G +GLNG  G  G  GD+G  G+PG  G  G  G  GI G +G  G  G  G  GPKG QG  G++           G IG VG  G  G PG +G KG+ GE G+
Sbjct:  489 KGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYP---------------------GRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGADGERGLPGVPG-----KKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPG-------LIGPKGVPGNPGEPG-------LKG-----DKGEL---------------------GLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGE---------------PGMTGNPGMLGERGPVGFVGPFGEMGLAGE--------------KGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEP---------GEKGAVGSPGNIGEQGLIGP---RGDPGVDGEAGPSGPDGAKGE-----------------------QGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGF------------IGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQ-----------GAIGPVGIIGPSGNPGPQGDKGNKGEMGV 1398          

HSP 3 Score: 225.328 bits (573), Expect = 9.892e-58
Identity = 337/944 (35.70%), Postives = 432/944 (45.76%), Query Frame = 1
Query: 1486 KTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGL---SGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDR------------GLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGF---KGIKGNTGKPGPVGDKTI---------KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGD------QGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM---------------------------MGVKGNNGP------KGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPK---GNKGLSGPC----QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
            +   GIKGD G  GL G+ G  G KG KG  GPSG P   G+ GP G  G KG     GL G  G +GPKG++G +G                       G  GL G DG    RG  G PG  G +GR G  GD G+R            G PG  GI G  GD          G  G  GP G  GPKG+ G+PG   +PG+ GD G++G+ G+ G PG                     QG++G+QG  G+  + G+ G +G                ++GDRG  G PG  GP                                       +G PG  G  GQ+G++G KG+ G +G+ G  G  G  G +G  G  G PG+ G  G +G  G  GE GM+G PG+TG+ G  GE G  G +G FG  G    KG +G TG+PGP G+K           +G+ G +G PG  G +G +G  G KG    RG  G  G VG KG  G+KG +G  G +G SG +G+ GE GE G       QG  GP G  G++G+ G  G PG +GP G  G  G+ G  G+QG+                            GV G  GP      KG+QG+ GLE     GE G  GVIG  G +G  G+PG+ G KG  G+ G IG++G+ G  G  G +GQ G  G  G+ G  G  GP G +G  G  G  G++G +G+ G  G  G +G +G+ G  GPKG  G  G+ G     ++G  GP GD GP                      GN GD GE G+ G  G  G +G  G +G  G  GN+G +G  GPKG  G  G KG   P+   GN+G  GP      +G  G  G  G PG  G  G+ G +G+PG +GR GD G PG    GP G+ G  G
Sbjct:  483 RAPSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYPGRQGLPGPIGNMGPKGVRGFIGIP---------------------GIFGLPGADGE---RGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGD---------MGPVGMVGPPGLIGPKGVPGNPG---EPGLKGDKGELGLPGEPGEPG--------------------FQGDKGIQGSPGLPGVQGKPGPQG----------------KIGDRGPDGLPGPLGP---------------------------------------EGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGT---RGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLE-----GESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDG----KVEGPPGPSGDIGPV---------------------GNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGK--PGPQGNAGAPG 1280          

HSP 4 Score: 216.083 bits (549), Expect = 7.641e-55
Identity = 341/989 (34.48%), Postives = 437/989 (44.19%), Query Frame = 1
Query:  241 VGIPGPKGDYG---RIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF-FQAKKGEKGFAXXXXXXXXXXXXX------XXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ--PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGR---EGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGD---QGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM 3153
            VGIPG  GD G    +G PG IGPKG  GN GE G +G  G+ G  G+ G PG +G+                   G +G  GLPG  G  G +G  G  G  GL G  G +G  G IG PG    +  KG  G  G  G  G  G +G        G  G++G  G KGI G+ G++G   M GEPG    P  + ++G  GF GP G+ G       L G+     RG++                     G  G  G++G  G  G  G RG  GP G PG  G++G+ G+ G  G                 G RG  G VGE G  G     ++GP+GP G +G  G  G  G  G  G  GF G+ GP GP         PG +G +G+ G  G  G  GP G+ G                   G+ G +GD+GL GE G  G+ G  G  G       GL+GP+G        G+DG+ G  GP G KG                      QG+ G +G +G  G  G +G  GR G+ G IG    EG  G IG+RG PG+KG KG +G   E       G  G+ G  G  GPKG +G+ G  G PG  G  G+ G+ G EG+                       QG +G  G  G K   GEKGE+GD G          +   +G+RGD GEPG  G  G  GV+G++G +G+                           PG+PG  G  G  G KG  GN+G KG    +G SG +G  G +G PG         RG  G  G  G PG+ G  G  G  G  GD+G  G  G  G      KPGP G+    G+ G  G  G +G +G TG SG  G+   RG  G  G  G +G++G KG+ G  G++G  G++G  G  G  GD    G+ GPKG  G++G +G  G  G IGP G  GP+G  G KGE G+
Sbjct:  615 VGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDK------------------GIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEG---MKGEPGMTGNPGMLGERGPVGFVGPFGEMG-------LAGEK--GDRGET---------------------GQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKG---------------TRGARGPDGPVGEKGMMG-----MKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGP---------PGAKGILGEPGPQGSPGVLGPLGEIG-----------------AIGLPGKAGDQGLPGEPGEKGAVGSPGNIG-----EQGLIGPRGD------PGVDGEAGPSGPDGAKG---------------------EQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGE------MGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGH-----------------------QGPQGSLGSPGPK---GEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGA---------------------------PGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPG--------PRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPG------KPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGK---RGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGEMGV 1398          

HSP 5 Score: 190.66 bits (483), Expect = 4.354e-47
Identity = 375/1071 (35.01%), Postives = 477/1071 (44.54%), Query Frame = 1
Query:  523 GLAGKMGL------------------------------SGDKGVKGDKGYIGEPGDFFQA-KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCK--LFVLKGKT----PPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT----------------VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGN------------DGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGK----PGPVGDKTIKGIKGDSGE---PGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGES---------------GMIGRTGENGE------KGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGP---------------KGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKG 3387
            GL GK G                                   G+KGD G +G PG   Q  +KG+KG  G  G  G++G +G       DG  G KG  G  G  GPIG  G     PKG+  +G  G PG  G  G D +  L  + GK      P   GD GE+G  G  G  G  G  G  G+ G +GD    G  G VG  G  GPKG PG+ G  G++G  G +G              G+ G  G +G+ G  G  G  +  +QG  GP G  GD+G  G+P   G LG +GF                      GDIG  G+N   G  GP+G+ G  G  G  G  G EG                   KGI G+ G+EG++GE G++G+ G+ GERGP      G VGP G  G  G  G  G+ G+ GP G KG +G                  + G  G+ GL+G  G PG  G RG  G             DG +G +G  G  G  G PG +G+ G  G   E       G  G  GP G  G KGI G PG  G PG+ G +G++G  G  G                         G++GL GE       GEKG  G  GN     +       +G RGD G  G  GP G  G KG+QG  G +G SG+KG  G  G +G  G  G  GV G  GK G+ G  G+ G+ G++G +G +G+ G  G +GDTG IG    G +G  G  G  G+ G +G PG+   +G +G  G QG +G+ GPKG KG +G+ GK    PGP GD    G +GD GE   PG  GL+G  GE G +G     G  G RG  GPKG +G KG +G N  +GES               G+IGR G  GE       G  G  G  G++G  GD G  GKPGP G  GA G  G+ G  G +G  G+ G++GP               +GDQG KG     G++G  G +G+ G  G  G+ G  G++G KG  G  G       +G  G SG+ G  G KG KG
Sbjct:  445 GLPGKRGPRGPSGPHGKPGPPGTPGPKGKKGNPGISPGRAPSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGP------DGSPGAKGYPGRQGLPGPIGNMG-----PKGV--RGFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDM---GPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGL------------PGEPGEPGFQGDKGIQGSPG--LPGVQGKPGPQGKIGDRGPDGLP---GPLGPEGFP---------------------GDIGPPGQN---GVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGP-----VGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMG------------------HPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGK-----------------------AGDQGLPGEP------GEKGAVGSPGNIGEQGL-------IGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGP--KGSRGTTGFMGAPGKMGQQGEPGL---VGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKG 1394          

HSP 6 Score: 149.828 bits (377), Expect = 1.095e-34
Identity = 277/784 (35.33%), Postives = 347/784 (44.26%), Query Frame = 1
Query: 2017 GSPGLNGK---------------------------PGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQ------------GMKGDIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDI------GNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPK---------GERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVI---GDRGETGKPGP------------------IGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-----GIEGPDGDIGNKG 4089
            G PGL GK                           PGIS      G+KGD                           G  GL G+ G     G+KG  G SG+     ++  + +  G +G  G  GL GPIG +G KG +G  G  GI G  G  G+             G+PG+PGK+G+ G  G  GD G +            G  G +G  G  G  G  G +G PG+    G+ GN G  G +G+ G  GLPG  G+ G QG+ G QG        G  GP+G  G +G  G PGP+G +   G  G  G+ GV+G KG  G  G  G     G  G++G VGP          G +GI G  G  G KGE GM G  G  GE+G  G  GP G +G+    GDRGETG+PGP                   GP GA GP G  G+ G +G  G +G  GP G  GEKG+   KG  G  G  G+ G +G  GE GE G  G  G  G TG       +G+ G  GS G  G  G+ G  G  G  G  G  G  G KG  G  G+IGE                      G  GP+G  G+ GE G SG    KGE G +G  G            + G KG+ G +G EG  G+ G  GVKG  G  G +G +G  G KG+ G +G+ G  G  GE GD G +GPKG++G +G    G  G  G+ G PG VG +G QG +G  G  G  G+KG+ G+     G  GP GDIG  G
Sbjct:  442 GQPGLPGKRGPRGPSGPHGKPGPPGTPGPKGKKGNPGISPGRAPSGIKGDP--------------------------GLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSP-GAKGYPGRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGADGE------------RGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGE---------------------QGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEG------------ESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTG--FMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVG 1151          

HSP 7 Score: 77.7962 bits (190), Expect = 1.136e-12
Identity = 214/565 (37.88%), Postives = 278/565 (49.20%), Query Frame = 1
Query: 2938 KGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKG---NVGPQGD---QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQG 4611
            +   GI GD G  G+ G+ G+ G KG +G  GP G+ G  G RG         PDG+ G KG     G QG+ G  GN GPKG                           +G +G PG+ G  G +GE G+ G  G+ G  G  G  G  G  G  G  G  G  G  G  G+ G  GD+G +G  G  G                 GPKG+ G  GE GL G   KGE G  G+ G  G  G  G +G  G  G+ G+ G +G IG++G  G+ G LGP+G   ++GP G    +GPKGN G +G  GP G  G +GD+G VGP G  GL     +GR G +G  G PG+ G+KGE G+ G PG +G  G  G       GP G++G  G +G +G  G+ G  GE G  G  GA G +G  G  G  G  G  G  G +G  G +G +G +GP G+ G+ G+KG +G  G+ G +G +G  G  G+ G  G  G +G  G    G +G +GEPG  G  G  G +GE    G  G  G+QGL G  G E+G VG  G+IG QG
Sbjct:  483 RAPSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRG---------PDGSPGAKGY---PGRQGLPGPIGNMGPKG--------------------------VRGFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLI---------------GPKGVPGNPGEPGLKGD--KGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGL-----EGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVG-----FVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTG--PPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPG-EKGAVGSPGNIGEQG 979          
BLAST of Collagen alpha-2(IV) chain vs. UniProt/SwissProt
Match: sp|Q17RW2|COOA1_HUMAN (Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 2.730e-60
Identity = 374/1133 (33.01%), Postives = 478/1133 (42.19%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKG---------YTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQA-KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPG-----DQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGK--CIGN-----------IQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSK---------------GVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKG------DIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-------GIKGNEGSRGEEGETGM----------------------------------------------RGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGK---PGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGET 3324
            GIPGP G+ G  G PGP GPKG           G  G+ G  GL+G  G  G  GL G  G                  L G  G+ G+PG  G  G  G  G  G  G  G+ G KG +G+IG PG+  Q   +GE+G  G  G                 G +G +G  GD GD+GP G+ G PG       P     +G  G  GPIG AG    + +   K                              GL G  GD+G++G  G +G  G PG KG  G  G  G+RG  G  G  G  G +G  G  G +G  G  G  G+ G  G    +GN            QG +GP G  G+ G +G PG +G  GE G +G               L G+ GD G+ G+ GE+G  G  G+ G  G  G+           KG +G  G  G QGEKG+ G                 G  G RGP G       GPKG +G +G  GL G+ G  G KG KG                     +QG++G  GL G+ GNPG RG +G+PG       +G  G  GDRGLPG+ G++G +GD          GE G  GP G EG  G++G PG  G  G +G +G  G  G  G PG                      GE GLQG+ G+K + G +G  G                E G++G+ G PG+ GP+G+ G  G  G                            +G+ GIPG+RG+ G  G+KG      ++G++G  G IG  G  GA+G  GA+G+ G+       GI G  G +G+ G +G+                                               G+PG+ G  G QG  GE GD G  G KG +G +GN GK   PGP G   I G++G  G  G+QG  G  G SG+ G+    G+ G  G  G  G  G+ G  G  G KG SG+ G  G  G KG+QGL G  G  G  G RG  G  GP G  G  G  G  G++G  G  G  G  GP+GD G  G+   KG  G +GN G +G  G  G  G  G RG KG  GET
Sbjct:  516 GIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPG------------------LPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGK---------------KGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNK------------------------------GLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEG---------------LKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGE-----------KGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGS-----QGPKGQRGSRGPDGLLGEQGIQGAKGEKG---------------------DQGKRGPHGLIGKTGNPGERGFQGKPG------LQGLPGSTGDRGLPGEPGLRGLQGDV------GPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPG--------------------APGEEGLQGKDGLKGVPGGRGLPG----------------EDGEKGEMGLPGIIGPLGRSGQTGLPGP---------------------------EGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGET 1458          

HSP 2 Score: 216.468 bits (550), Expect = 5.194e-55
Identity = 386/1059 (36.45%), Postives = 493/1059 (46.55%), Query Frame = 1
Query: 1018 GNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREE------------TFPSIKGEKGDNGPDGKEGPKGIKGS------PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-------LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGV------KGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
            G RG PGP G PG  G  G +G  G  GF                  +   GE G+ G SG     + GP G  GDKG KG+ G+PG  G  G                     +PG  G+IG  G  G  G  GP G+ G               +   G  G++G  G +GE+GI G +G KG +G  G P  G  G +GP G  G  GL G  G  G  G++G +G    +            G  G  G  GL+G  G PGI+GD+G  G  G +G  G  GD G  GLPG  G++G  G S +                   G+ G  G +G EGPKG+ G+      PGL G  G  G +G  G  G  G P                       G++G  GE G    +G KGE GD GN            ++G+ G  G PG  G  G +G KG++G+ G  G  G+KG  G PG  GV G  G  G+PG  G RG  G  G KG  G++G  G +G++G  GAKG+ G  G  G    IG  GN G RG +G+ G++GLPG TGD G  GE G             +G++G+ G PG +G   ++G  G  GE G+QG  G  G+ G  G   G GE G RG+ G  GE G++G+ G+ G  G  G+    GE+GEKG+ GL    G +G +G  G+TG PGP G  G  G +G  G KG++G +G  G  G +G  G+ G    G +G +G  G +G++G  G  GEPG+ G +G  G     Q G SG  G  G KG  G              GP G +G  G  GD GE G  G  G  G +G  G RG TG+ GP G  G  GE+GL G          KG  GP G  G  G  GL G KG +G  G  G  GN G IG  G +G+       G  G  G  GP G +G  G  GS G  GPKG+ G  G  G  G +G++G  G   QG  G+ G  G PG+ G++G  G +G PG  G  GD G    GI GP G IG++G
Sbjct:  513 GPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPG---------------QPVPGEKGDQGLSG-----LMGPPGMQGDKGLKGHPGLPGLPGEQG---------------------IPGFAGNIGSPGYPGRQGLAGPEGNPG-----------PKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFP--GDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPI------------GPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKP-----------------------GQKGYAGEPGP---EGLKGEVGDQGNIG----------KIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPG------------LRGLQGDVGPPGEMG---MEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGL---PGEDGEKGEMGL---PGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIG--KSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQG-----QPGPSGLPGPKGEKGYPG--------EDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQG--DQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGI--VGISGPKGPIGHRG 1429          

HSP 3 Score: 201.06 bits (510), Expect = 3.027e-50
Identity = 355/1013 (35.04%), Postives = 464/1013 (45.80%), Query Frame = 1
Query:  736 GDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEK------------GISGSKGVKGERGPSGRP-------------------TTGLVGPKGPKGEKGLSG---------LDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGL---AGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKG---------DSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPI---------GKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNF------GPKGFKGIKGNTGKPGPVG-------------DKTIKGI------------KGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGIN---------------GIKGEQGMMGVKGNNGPKGDQ---GEKGLE-TKGQRGEKGNMGVIGNVGAKGELGE------------PGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            G +GP G+ G  G+        G  G PGP G  G         G+  P ++GD G  G  G  G  G KG+ G PGL G  G++G  G  GN+G+ G PG +G  G +G  G +G+ G I                     GS GE G+ G  G+     +G  G  G KG KG QG PG  G+ G  G  G PG  G  G  G   L   RG +G  G  G +G  GP G  G               K + GIKGD G++G  GE             G+ G  G++G+ GPSG+                      G+ G  GP+G KGL G         L G  G+ GP G  G LG   K          G KG  GE G +GL    G  GN G  G+ G  G  G +G  GS G+ G+RG PG  G +G KG                  + G  G  GP G +GPKG +GS G +G  G  G  G  G KGD+G           G  G  G    P  GERG QG+ G++ + G  G++G  G   +  ++       GD G  GE G++GP          G+ G KGD G  GS G +G+ G  G+PG  G +G +G DG+ G+PG RG  G DGEKG++G  G+ G +G  G++G  G  G +G PG     G KG++G  G  GE G RG PG  G  G +G  G +G +G+       G  G  G +G+ G+PGP G             D T+ G             +G+ GEPG +G KG  G  G +G    +G  GE GD   +GE+G+KGE+G  G+KG+ G  G +G+ G  G QGL GPKG  G  G  G +G PG IGP G  G  GI                G+KG  G+ G  G  GPKG+Q   G+ G++  +G RG +G+ G  G+ G KG+ GE            PG +G +GD G  GI G KG  G  G  G  G++G+
Sbjct:  510 GKRGPRGIPGPHGN-------PGLPGLPGPKGPKGDPG---FSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFI---------------------GSPGEAGQLGPEGE-----RGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL---RGSVGPVGPIGPAGIPGPMGLSG--------------NKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGK---------PGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGK---------RGPHGLIGKTGNP--GERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQ-------GDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGD---QGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGI 1439          

HSP 4 Score: 186.037 bits (471), Expect = 1.157e-45
Identity = 298/831 (35.86%), Postives = 386/831 (46.45%), Query Frame = 1
Query:  988 RGQKGDTGNV---------------GNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREE------------TFPSIKGEKGDNGPDGKEGPKGIKGS------PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGE 3363
            RG KGDTG                 G RG PGP G PG  G  G +G  G  GF                  +   GE G+ G SG     + GP G  GDKG KG+ G+PG  G  G                     +PG  G+IG  G  G  G  GP G+ G               +   G  G++G  G +GE+GI G +G KG +G  G P  G  G +GP G  G  GL G  G  G  G++G +G    +            G  G  G  GL+G  G PGI+GD+G  G  G +G  G  GD G  GLPG  G++G  G S +                   G+ G  G +G EGPKG+ G+      PGL G  G  G +G  G  G  G P                       G++G  GE G    +G KGE GD GN            ++G+ G  G PG  G  G +G KG++G+ G  G  G+KG  G PG  GV G  G  G+PG  G RG  G  G KG  G++G  G +G++G  GAKG+ G  G  G    IG  GN G RG +G+ G++GLPG TGD G  GE             G +G++G+ G PG +G   ++G  G  GE G+QG  G  G+ G  G   G GE G RG+ G  GE G++G+ G+ G  G  G+    GE+GEKG+ GL    G +G +G  G+TG PGP G  G  G +G  G KG++G +G  G  G +G  G+ G    KG RG +G +G +G +G  GE G PG RG +G  G +G+ G KGE G  GE
Sbjct:  488 RGPKGDTGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPG---------------QPVPGEKGDQGLSG-----LMGPPGMQGDKGLKGHPGLPGLPGEQG---------------------IPGFAGNIGSPGYPGRQGLAGPEGNPG-----------PKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFP--GDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPI------------GPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKP-----------------------GQKGYAGEPG---PEGLKGEVGDQGNI----------GKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEP------------GLRGLQGDVGPPGEMG---MEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGL---PGEDGEKGEMGL---PGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGE 1195          

HSP 5 Score: 150.214 bits (378), Expect = 8.835e-35
Identity = 288/812 (35.47%), Postives = 378/812 (46.55%), Query Frame = 1
Query: 1957 IKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGK---RGQSGLDGEKGDI------------GNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGM------RGLPGITGDIGNQGESGEQGDI---------------------GNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKP------------GPIGPDGATGPKGINGIKGEQGMM---GVKGNNGPKGDQGEKGLE----------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSG-------ITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSG-------------------NRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKGR 4092
            I G  G+ G  G  GPKG KG PG +    + G+ G  G+ G  G PG                    +QG++GL+G  G+  + GE+G  G +GN             +G  G  G  GL GP G  G KG QG  GS G +G+ G  G+ G  G++G KGF G  G PG    RG +GLDG  G +            G+ G  G IG  G  G  G +G  G PGI G KG +G+ GE GE G        GLPG  G  G  G SG+ GD                      G  GP+G KG+ GN G     G   +KG +G+ G  G  G  G  G+ G KG     G  G +G+VG +G  G  GE G  G  GE GM G  GE GE+G  G  GP+G  GV+G  G  G P            G  GP G+ GPKG  G +G  G++   G++G  G KGDQG++G             +G +G+ G  G+ G+ G +G  GEPG+RG +GD G  G +G +G  G+ GE G +G+ G                         KGD+G  GS G  G+ G  G+ G  G  G  G  GL G+ G +GL G       + L G  GP+G +G TG  G  G  G  G +G PG++G++G IG  G  G +G  G  G  GP+G +G +G  G  G  GP G+ G  G +G+ G  G  GL GP  ++G  G                   ++GE G PG  G KG  G+ GL G  G+ G  G+PG+    G++G  G  GNKG+
Sbjct:  517 IPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPG--------------------MQGDKGLKGHPGLPGLPGEQGIPGFAGN-------------IGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGP---PGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPG------------------------AKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGK 1268          

HSP 6 Score: 135.191 bits (339), Expect = 3.898e-30
Identity = 306/846 (36.17%), Postives = 385/846 (45.51%), Query Frame = 1
Query:  223 QNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGAR------------------GLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQA----KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ----PKGIAQKGEKGFPGPIGDAGTDCKL--FVLKGKT-PPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQ---GEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGK---DGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGS------PGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGE 2631
            Q T   +G PG  GD G +G PGP G +G +G  G+ G                    G+ G +G  G  GL G+RG  G  G+ G  G+ G IG FG+ G  G PG  G  GE G +GL G++G  G+ G  G+ G +G PG+        +KGE+G  G  G  GEKG  G+ G  G+ G  G  G+ G VG +GP G  G  G +    P G+   GE+G  G  G+ G   K     L GKT  P +RG  G+ G  G  G TG +G+ GEPGL G  GD G  G+ G  G  GT G  G  G  GAKG  G+ G +G              G+ G RG  G  GE G  GK  +  + G +G  G+ G+KG  G+PG  G LG  G  G+PGP G +G  G    PGK+GD G  G  GE G+ GP G  G               K  +G +G  G  GL    GE GI G +G +G+ GPSG P        GPKGEKG  G D                 +  L   G  GE G  G+QGE+G+   +G  G  G PG+RG  G+ G  G  G +G  G  G+RG  G+KG KGA G S +   P ++G  G  G  G  G  GI G+      PG  G PGI G  G+ G+ G  G PG                    V+G  GL G  GI+   G KGE+G  G   I           G RG  G  G QGP G  G+KG  G  G                          G+ G  G  G  G +G+ G +G  G KG IG +G +G  G  G IG  G  G +G +G RGE
Sbjct:  719 QGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLL--GEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVG------------GTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIG-----------KSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLP--------GPKGEKGYPGED-----------------STVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPG--------------------VKGSSGLPGSPGIQ---GPKGEQGLPGQPGIQ----------GKRGHRGAQGDQGPCGDPGLKGQPGEYG------------------------VQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          

HSP 7 Score: 58.151 bits (139), Expect = 8.802e-7
Identity = 59/150 (39.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query: 3718 NEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGN------------------VGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGI------KGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGR 4092
            ++G+ GE G +G KG +G  G  G  G QGP G  G +GE G KG+ G +G+KG                   +GPKG +G  G    G SGN G++G PGK G+       G  GL G PG  G  G  G PG+ GI+GP G+ G  G+
Sbjct: 1214 DQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHG--ADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQ 1361          
BLAST of Collagen alpha-2(IV) chain vs. TrEMBL
Match: A0A4E0RFF2 (Collagen alpha-1(IV) chain OS=Fasciola hepatica OX=6192 GN=D915_002897 PE=4 SV=1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 812/1832 (44.32%), Postives = 1005/1832 (54.86%), Query Frame = 1
Query:  184 QWTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGP---------IGMSGEPGDQPKGIAQ-----KGEKGFPGPIGDAGTDCKLFVLKGKT-----PPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKG---------AKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISG-----------------------SKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGI--KP-IDGEKGEKGDSGNCTINFVKPLNAT-EMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRG------LPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPK---------GDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKV-----------------GIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVD--SEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQPLLY 5412
            Q+    NC+  C +N C C G  GP GD G  G PGP GPKGY G  G +G +G  GD G++G DG  GDRG  GD+G PGIHG+ G  G  G++G  G+PGC G  G+ G+ G  G  G+ G++G  G+ G  G+ GD    ++G  G             +G  G  GM GD G  G RGD G  GP          G  GEPGD  + I +     KG +G PG  GD G +C + +L  +      PP  RG  G KG                PG  GA GDRG  G  G+ GN+G PG  G PG KG          KGI G DG+IG +G+ G KG  G  G+DG RG  GE GE GGS +C G + G  GP G  G  G++G PG  G  G++G KG  GP GP+GD G  C  G  G  G KG  GE G  G                       + G  G  GD+GL GEKG SG                        KGV+GERGP G    GL GP G KGEKG++GL GK GK G  G +G  G  C  C++G  G+KG KG+QG  G  G  GRDG+ G RGDRG PGN G +G  G  G  G+RG+PG KG KG  G++R E    +KG KG  G DG +G KGIKG   + G  G  GD G  G  GD G  G+ G KG  G  G KG   +P +   GL+G+KG   +P + GE G  G  GNCT+N ++  N T E GDRG+ GEPG +G  GK G +G  G  G DGI G KG PG+PG  G KG  G+ G PG  G  G  GL G  G  G++G  G +GD+G  GAKG+ G  G PG+G KG+ G  G  G  G++G      LPG  GD G  G  G  GD G+ GPKGF+G  G +G         IKG+KGDSG+PG  GL G  GE G +G+C G  E G  G  GP+G  G KGE G+ G KGE G  G  G  GEKGD G  G  G  G +GD G +G+PG +GP G  G  G  G++GE G  GV G  G KG+ G+ G  + G++G+ G++G+ G  G KG  G PGMRG KG+ G       GE G  G+ G KG  G+ G+ G  GP G  G  G  G KG +G+ G+ G RG+ GK G  G+ G  G  G  G KG  G+ G +G  G TL G  G  GDNG                      +G  G  G KGN+G+ G++GPKG  G  G  G  G  G  GE G           G  GE GD G+ GP G+ G+      G  G +G  GAPG+                  G  GE+GL G+PGK G++G  G PG G  G  G+ G+ G  G  G KG+ GE G+ GE    GAKG +G  G  G  G+ G  G  G  G  GD G  GE G  G+ G  G+ G+ G KG  G  G  G  G +G  G  G  G  G+ G+D  G  G+ G+ GD G  G KG  G PA RGPKG KGE GL G  G+E GM G KG  G +G  G  G +G  G +GP G +G  GP GQAL ST+LFTRHFQN + +  CP+GSNKI EGYSFVMANGN E+  M+LG+HSSC++ F+IMPF QC RDG+C+  +RADRSYWLA+  P+    ++V  V + ++RCV CE+P +PYAFH+Q N L DV CP  W+ELWNGYSFVMHT G  GGGQ LSSPGSCL YFR+SPLLECNNGM  C++W DAK+Y+LRHV   +EF+ P GKY+  +      V +E+SRC+VC+K++ Q  + 
Sbjct: 1859 QFRREINCSERCDENFCSCYGPMGPMGDPGPRGFPGPAGPKGYPGEPGPVGLKGEKGDPGADGPDGPVGDRGPPGDFGQPGIHGEHGTSGEPGEKGAKGIPGCPGNKGDPGDAGDMGHRGVDGERGPPGEDGERGDVGDSGPGRRGAPG------------PRGDPGMPGMKGDMGPIGPRGDPGLPGPEGDRGEDGSSGPMGEPGDPGESIIESQTPVKGVRGEPGDPGDPGQNCTVTMLDPERKALIGPPGDRGKPGPKGY---------------PGPKGAQGDRGHDGTIGDPGNKGEPGRDGAPGPKGFQGNMGQPGLKGIAGRDGLIGERGLPGPKGNPGDPGEDGLRGPYGEPGEPGGSKECTGILPGRPGPRGMPGLPGSKGQPGLPGVDGDRGLKGAIGPQGPMGDTGPDCPIGPPGRPGPKGSPGEPGRPG-----------------------LAGFPGRPGDDGLPGEKGESGRGIRGMPGDPGDRGPDGPPGPKGPKGVQGERGPPGTKGAGLPGPMGEKGEKGIAGLMGKRGKPGSPGPEGEPGDRCSPCRQGIPGQKGDKGDQGIPGTPGPRGRDGSKGERGDRGAPGNPGRMGPPGYEGVAGERGIPGPKGFKGEPGETRTEYQGVVKGPKGYPGVDGVKGQKGIKG---IFGDAGEKGDRGLEGPPGDLGMRGLPGQKGPKGMSGEKGFKGQPAEVMMGLKGDKGTPGRPGLPGEPGVPGIPGNCTVNVIRSDNITVEKGDRGEKGEPGPRGDKGKPGGEGPPGKPGDDGIRGAKGIPGRPGPPGPKGATGYPGEPGERGDSGDPGLPGPVGPKGDRGAPGPVGDRGILGAKGEKGPAGLPGLGEKGDRGIPGRPGFAGLKGERGEPGLPGAQGDPGPDGLPGLPGDRGDMGPKGFEGDPGPSGG------SGIKGVKGDSGKPGEPGLSGRPGEKGIQGQCLGPAEKGNTGLPGPRGPDGRKGEMGLKGMKGERGPAGEVGVPGEKGDTGPTGFPGLNGEVGDPGPSGRPGAVGPKGFEGMPGPKGLQGEPGAPGVDGLPGEKGEMGQPGQASIGEKGDVGDVGMPGEPGEKGATGRPGMRGDKGEPGLVADAIPGEVGDPGDMGEKGFPGLPGDPGQAGPRGDPGTPGPIGPKGLQGEPGQPGVRGRPGKPGLDGRPGATGPKGFPGEKGARGVKGSRGEPGPTLVGRDGEPGDNG---------------------DRGASGIPGPKGNRGLPGDMGPKGVAGIPGRMGEVGQPGLPGEKGETGPSGPGGFPGPTGEKGDVGDSGPPGDVGI-----MGTMGVKGFAGAPGQCLPAPTSPAGDPGPQGPPGPVGEKGLPGIPGKPGKIGQSGPPGRGRPGSRGEPGDDGVRGLPGEKGQPGEVGDPGEQAHPGAKGERGRPGPVGEKGDVGMAGDPGPMGPQGDPGSIGEIGYPGESGDPGLPGLPGDKGNTGWVGPPGPTGDRGLPGDPGEVGQPGLPGDDSTGVPGQKGDKGDKGFPGPKGGPGLPAGRGPKGSKGEMGLPGPQGREPGMPGAKGEPGVRGPPGDVGPRGMPGDRGPTGPMGPGGPPGQALLSTYLFTRHFQNPDAELTCPLGSNKIGEGYSFVMANGNGELVTMDLGSHSSCISMFSIMPFFQCLRDGTCQLGVRADRSYWLATTEPLPMMPLDVAEVRRRVARCVICEAPTQPYAFHAQGNQLHDVYCPNGWSELWNGYSFVMHTAGSTGGGQQLSSPGSCLEYFRYSPLLECNNGMSLCHYWSDAKAYYLRHVSNGTEFQKPIGKYMTEDARDDTTVLREISRCRVCLKRRFQSYIV 3605          

HSP 2 Score: 285.034 bits (728), Expect = 2.901e-73
Identity = 168/423 (39.72%), Postives = 232/423 (54.85%), Query Frame = 1
Query: 4270 ENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKG----VKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVD---SEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQPLLYI*G*Q*F*ELLFLTQV*CIEYYFC-----EMICCT 5502
            E G +GDVG  G +G  G  GE G  GI G KG+ G    G            + G RG+ GEPG+ GK G  G+ GE   +G KG    V+G +G+ G    E G  G++G IGPQG  G+PG  G +G +G  G+            ST LF RH+Q  +   VCP G++ +F GYS+VM  G  ++  M+LGT SSCL  F+ +P  QC RD  C+  +R +RSYWLA+  P +   + V      I+RCV CE+P   +AFHSQ   +    CP  W ELW G S ++HT+G +GGGQ LSSPGSC+  FR+SP++ECNN +  C++W DAK Y+LR +D   ++FE P G  +KA +     V   +S+C+VCMK     +++      F  L  +T      Y  C     ++IC  
Sbjct: 1429 EPGLKGDVGPEGERGSDGAPGETGPAGIDGPKGVAGVATKGEKGELA------EDGERGDTGEPGEDGKDGEPGEDGETGEKGEKGQPGIVEGPRGIEG----EPGERGEQGHIGPQGLVGEPGPPGPEGKKGEPGETNY---------STVLFARHYQTPDVDLVCPEGTSMLFTGYSYVMGGGVDDLVSMDLGTPSSCLIKFSSLPLTQCERDTMCQSNMRHERSYWLATSVPRSEKPLPVNETSDRIARCVVCEAPTHVFAFHSQAETME--PCPNTWKELWTGVSLILHTSGKHGGGQQLSSPGSCMEQFRYSPVIECNNNVGMCHYWSDAKVYYLRALDPSRTQFEKPLGFTMKATEGP---VLNNVSKCRVCMKNV---VIH------FGLLSNVTGTKITVYALCYSLTTDIICIA 1818          

HSP 3 Score: 256.914 bits (655), Expect = 1.163e-64
Identity = 514/1482 (34.68%), Postives = 657/1482 (44.33%), Query Frame = 1
Query:  184 QWTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIG---------------------------PKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKT---------PPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNI-QGPQGPFGD---KGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDK------------GENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGIS-----GSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLS------GLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGR--EGSY-GDIGDRGLPGDK------GIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAK--------PVQGER------------------GLQGEKGIKPIDGEK---------GEKGDSGNCTIN-FVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA------KGDTGAIGNPGI----------GIKGNEGSRGEEGETGMRGLPG---ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG-----KPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGEN-----GEKGDQGLNGPKGNVGVIGD---RGETGKPGPIGPDGAT-----GPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEF--GSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVG---PQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGK---------------------VGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
            Q    + C+ +CT + C+CV      G  G+ G PG +G                           P+G  G  G+ G  GL G +G +G  G PG+ G                  L G++GD G  G  G  G KG+ G  G  GL G +G+KG KG+    GD  Q   GEKG  G+ GS G +G+ G  G  G  G +G  G+ G  G  G +G  G PG     I +KG+ G PGP G+ G  C   ++             P  + G+ G+KG  G  G  G  G  G PGL G  G  G  G  G+VG+ G PG  G+ G  G  G RG  G  G          +G  G  G  G +G  G  G  GK    I Q P+G  G+   KG+KG  G PG +G +GEKG  G  GP G  G  G  C  G  G+ G K            GE GE G  G RG  G +          D  +  +G KG  GD G QGEKG+S     G+ G  GE G  G P      GL G  GPKGE+  +      GLDG  G  G  G+ G  G A      GD G  G  G  GE G  G  G  G PG  G++G PG    + R  EG   GD G+ G PG        G  G  G++ +E     +GE G+ GP G+ G  G  GSPGL G+  I+  +G++G KG+ G  G KG+ G  G      +D K         + GER                  G +GE G  P+  E+         GEKGD G   I   V P     +G++G+TG+PG +GP G  G KG+QG  G +GI G   +                   G  G+ G  G DGE+GD+G  G+KGD+G+KG  G       KGD G  G+PG           G  G +G +G +G  G+ G PG   I  +IG +G+ G QG+ G  GP+G +G +G+ G      PGP     + G KGD+   G +GL G  GE G KGE    G  GE+GD+GP GE G  G  G  G  GE G+ G  G +     GE+GD G+ GPKGN G  G+    GETG+PG  G + A      GP G +      G  G  G  GPKG+ GE G E      G RG+ G  G  G  G KG++GEPG  G  G  G+  +G+ GE G   E   G+ G+ G  G KG +G  G  G  G  G +GE GD GE+                        GP G  G +G  G       G+ GP+G  GP G+ G  G             QG  GD GE+G KG  GE G +G +    P G  G  G  G+ GE GP+G+ G  G+ G +G KG  G  G    G  G  G  G PG+                      G  GE+G  G PG++G  G       G+ GPDG  G KG 
Sbjct:   44 QTQQSERCSLICTPDKCQCV------GKTGKPGRPGAMGTYGPEGPPGEPGKPGPPGPTGDKGDPSPRGKEGQKGQAGEPGLPGFAGVHGMQGYPGEPG------------------LPGEKGDNGCDGEPGDIGLKGDRGEPGTKGLPGFEGLKGMKGFA---GDTRQGLMGEKGEIGEPGSVGIEGDPGPKGPEGYPGPRGPDGMPGARGLPGDVGPPGRPGTYIVTIVEKGDMGLPGPRGEPGYPCDEGMVNRTIEELARIAFGPTGEMGEKGDKGATGLPGDDGEPGHPGLPGLKGEKGYPGSPGREGDVGDIGPPGEPGEAGDSGVDGPRGDPGDFG---------EKGDPGPYGRDGQRGPKGRQGPPGKYECPIDQMPKGVIGEKGYKGEKGEHGEPGERGKMGEKGLPGAEGPKGTQGYAGKQCQAGPVGEPGQKGNYGSSGDPGWPGEPGEPGKTGERGPPGDDAVVEVGEVGRDGVQGFRGPKGAPGDPGEQGEKGLSGDHDIGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPLCPDGLDGPRGDPGDDGVAGYKGAAGLDGDSGDPGPMGEDGPTGETGIKGAKGSIGEPGHEGEKGDPGEAAIVTRDVEGVIPGDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGE-NITDIVGELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENETDIDGERGEKGEPGEVGEEGPKGERGRKGETGKAPLPAERGDRGPPGPQGEKGDLGPMGIEGSVGPDGPEGVGEQGETGDPGERGPEGLKGYKGEQGDFGDNGIGGPLSE-------------------GDKGEAGPKGDDGEQGDLGEDGLKGDVGEKGLPGVDGGPGEKGDVGETGDPGPKGQPSVDMEDGEPGEKGEQGPDGPAGLVGEPGDEAICIEIGLRGDDGPQGEPGEAGPEGDQGEEGDVGDAGEDAPGPA----MNGTKGDT---GAEGLPGLEGEDGPKGEPGAVGPEGEKGDIGPAGEVGDPGPDGPVGKDGEPGVDGDPGPDGESIKGEQGDTGIQGPKGNDGEAGEPGVAGETGEPGEAGEESAMVKGEQGPPGEDAEPAVPGEPGPDGEPGPKGEAGEAGPEGEKGDPGVRGKPGKAGQRGPQGEKGKIGEPGEDGPVGPKGD--VGEPGEPGEPSELIPGASGKPGHPGLKGFVGEPGEVGDKGETGTEGEPGDEGEV------------------------GPLGPEGTAGPVGPD-----GDQGPVGPEGPVGEPGEDGA------------QGPSGDYGERGLKGSAGEKGDRGPIASDCPPGSPGEPGMIGNVGEPGPRGEPGSKGETGRIGNKGKPGSVGIGSWGEPGESGLPGLPGEQGLPGEQGPPGPPGQEAPEGDAGEPGERGPTGQPGEVGEQGVA-----GLRGPDGPKGFKGE 1414          

HSP 4 Score: 248.825 bits (634), Expect = 3.508e-62
Identity = 497/1477 (33.65%), Postives = 633/1477 (42.86%), Query Frame = 1
Query:  262 GDYGRIGNPGPIGPKGYTGNMGE---LGARGLVGDSGSNGQDG-------------LPGDRGE------------SXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGE---------------PGDQ-PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGV---------KGERGPSGRP----------------TTGLVGPKGPKGEKGLSGLDGKNGKV-----------------------------GPKGMKGLLGTA--CKLCXXXXXXXXXXXXN-----------------QGEKGKDGLAGRDGNPGIRGDRGRPGNDGA--------------------IGREGSYGDIGDRGLPGDKGIKGAKGDSREETF--PSIKGEKGDNGP------------DGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGS-----RGEEGETGMRGL---------PGITGDIGNQGESGEQGDI--GNFGPKG------FKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERG-----------IKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVI---------GNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNG--EFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGP-----------------KGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKV----GIKGE------------QGLE 3999
            G  G  G+PGP GP+GY G  G     GARGL GD G  G+ G             LPG RGE            + +       G  G++G  GD+G  GLPG +G  G  G  GL G+ G  G  G +GD G IG PG+  +A  G+ G                     +DG +GD G  G+ GD GP G  G+               P DQ PKG+   GEKG+ G  G+ G             P +RG  GEKG  G +G  G +G  G+    G VG+ GQKG+ G+ G+ G PG  G+PG  G +G  G D V+    V        +  K    G  GE GE G SG       G  G  GD GD G  G+PG  G  G KG +    P  P G      L G RGD GD G  G  GA G  GD G         D       +KG KG  G+ G +GEKG  G   +          G++G  G+P                 TG  GPKGP+GE G  G  G++G++                             G KGM G  G +  C L KK  + E     +                 +GE+G+ G  G+   P  RGDRG PG  G                     +G +G  GD G+RG  G KG KG +GD  +     P  +G+KG+ GP            DG +G  G KG PG++G PG  GD+G+ G  G +G P                     V  E G  GEKG +  DG  G  G+ G+  I     L     GD G  GEPG  GP G  G +GD G  G D                        G  G+PG  G+ G  GE G +G +G KGDIG  G  G  G  G +G  G  G+ G+ G      +GE+G+TG++G          PG+ G+ G  GE+GE+  +  G  GP G        G  G  G+PGP G+    G +G+ G+PGV+G  G  G+ G +GE    GE GE G VGPKG+ G           I G  G  G  G  G +G  GE G+KG+ G  G  G+ G +G  G  G  GP+GPDG  GP G  G  GE G  G +G   P GD GE+GL  KG  GEKG+ G I         G  G  G +GEPG RG  G  GETG IG KG+ GS G   +G  G+ G+ G  G+ G  G +GP G  G +  +GD GE                      G+ GP G  G  GE+G++G  L+G  GP G                         +G  G  G  G  G  GE G KG+VGP+G+   +G+ G+ GETGP                 KG+  EDG++G+ G  G  G  G P + G +G +GE G PG V    GI+GE            QGL 
Sbjct:  198 GSVGIEGDPGPKGPEGYPGPRGPDGMPGARGLPGDVGPPGRPGTYIVTIVEKGDMGLPGPRGEPGYPCDEGMVNRTIEELARIAFGPTGEMGEKGDKGATGLPGDDGEPGHPGLPGLKGEKGYPGSPGREGDVGDIGPPGEPGEA--GDSG---------------------VDGPRGDPGDFGEKGDPGPYGRDGQRGPKGRQGPPGKYECPIDQMPKGVI--GEKGYKGEKGEHGE------------PGERGKMGEKGLPGAEGPKGTQGYAGKQCQAGPVGEPGQKGNYGSSGDPGWPGEPGEPGKTGERGPPGDDAVVEVGEVGRDGVQGFRGPKGAP-GDPGEQGEKGLSGDHDIGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPLCPDG------LDGPRGDPGDDGVAGYKGAAGLDGDSG--DPGPMGEDGPTGETGIKGAKGSIGEPGHEGEKGDPGEAAIVTRDVEGVIPGDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGENITDIVGELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENETDIDGERGEKGEPGEVGEEGPKGERGRKGETGKAPLPAERGDRGPPGPQGEKGDLGPMGIEGSVGPDGPEGVGEQGETGDPGERGPEGLKGYKGEQGDFGDNGIGGPLSEGDKGEAGPKGDDGEQGDLGEDGLKGDVGEKGLPGVDGGPGEKGDVGETGDPGPKGQPS--------------------VDMEDGEPGEKGEQGPDGPAGLVGEPGDEAICIEIGLR----GDDGPQGEPGEAGPEGDQGEEGDVGDAGEDAPGPAMNGTKGDT-----------GAEGLPGLEGEDGPKGEPGAVGPEGEKGDIGPAGEVGDPGPDGPVGKDGEPGVDGDPGPDGESIKGEQGDTGIQGPKGNDGEAGEPGVAGETGEPGEAGEESAMVKGEQGPPGEDAEPAVPGEPGPDGEPGPKGEAGEAGPEGEKGDPGVRGKPGKAGQRGPQGEKGKIGEPGEDGPVGPKGDVGEPGEPGEPSELIPGASGKPGHPGLKGFVGEPGEVGDKGETGTEGEPGDEGEVGPLGPEGTAGPVGPDGDQGPVGPEGPVGEPGEDGAQG---PSGDYGERGL--KGSAGEKGDRGPIASDCPPGSPGEPGMIGNVGEPGPRGEPGSKGETGRIGNKGKPGSVGIGSWGEPGESGLPGLPGEQGLPGEQGPPGPPGQEAPEGDAGE---------------------PGERGPTGQPGEVGEQGVAG--LRGPDGPKG------------------------FKGEVGSPGPDGQDGADGEPGLKGDVGPEGE---RGSDGAPGETGPAGIDGPKGVAGVATKGEKGELAEDGERGDTGEPGEDGKDGEPGEDGETGEKGEKGQPGIVEGPRGIEGEPGERGEQGHIGPQGLV 1538          

HSP 5 Score: 213.386 bits (542), Expect = 2.255e-51
Identity = 403/1170 (34.44%), Postives = 537/1170 (45.90%), Query Frame = 1
Query:  241 VGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARG--LVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDK------------GYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSG------EPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPG--------------PKGQPGSKGAKGIRGSDG-------------------VIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKG-ERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGA-IGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMG--VKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQG---PIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGES------GEQGDIGNFGPKGFKGI------KGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG---------RGEFGERGDVGPKGERGIKGEQGINGDKGESGM--IGRTGENGEKGDQGLNG------------------PKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----------TKGQRGEKGNMGV--------IGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            VG PG KG+YG  G+PG  G  G  G  GE G  G   V + G  G+DG+ G RG  G  G PG  G+ G   L GD  D+G PG  G  G+ G+ G  G  GL G  G KG++            G  G+PGD   A  G KG AG                  +DGD GD G  G+ G  G  G+ G      EPG        +GEKG PG       D +  +   +    + G +G+ G+ G  G  G  G  G  G +G +G+ G  G+ G +G+ G+PG               KG+PG +GAKG+ G  G                   + G +G +G+ G  G++G  G RG KGE G+A    +     +GP GP G+KGD G  GI G  G  G +G                    G+ GD G++G  G  G  G +GDFG NG  G   +        KG  G+ GD G  G KG  G KG+ G + GP  +   G  G  GPKG+  +   DG+ G+ G +G  G  G   +   +    E G++G+ G +G+ G AG +G+ G  GD G  G D       G+ GD G  GLPG +G  G KG   E      +GEKGD GP G+ G  G  G  G +G+PG+ GD G  G  +KG++G+ G                    +QG +G  GE G   + GE GE G++G  +      +   E G  G+  EP + G   P G+ G KG+ G  G +G  G                    GV G PGK GQ G  GEKG IG  G  G +G       KGD G  G PG   +   G+ G+ G  G++G  G  G++G++GE+      G++G++G  GP+G  G       +G  G  GPVG+    G +G SG+ G +GLKG  GE GD+G  +           G  G  G+ GP+GE G KGE G  G+KG+ G   IG  GE GE G  GL G                  P+G+ G  G+RG TG+PG +G  G  G +G +G KG +G +G  G +G  G  GE GL+          + G  GE G  G+        +   G KGEL E G RG  G+ GE G  G+ GE G  GE G KGQ G+
Sbjct:  444 VGEPGQKGNYGSSGDPGWPGEPGEPGKTGERGPPGDDAVVEVGEVGRDGVQGFRGPKGAPGDPGEQGEKG---LSGDH-DIGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPLCPDGLDGPRGDPGDDGVA--GYKGAAG------------------LDGDSGDPGPMGEDGPTGETGIKGAKGSIGEPG-------HEGEKGDPGEAAIVTRDVEGVIPGDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGENITDIVGELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENETDIDGERGEKGEPGEVGEEGPKGERGRKGETGKAPLPAER--GDRGPPGPQGEKGDLGPMGIEGSVGPDGPEGVGEQ----------------GETGDPGERGPEGLKGYKGEQGDFGDNGIGGPLSEGDKGEAGPKGDDGEQGDLGEDGLKGDVGEKGLPGVDGGPGEKGDVGETGDPGPKGQPSVDMEDGEPGEKGEQGPDGPAGLVGEPGDEAICIEIGLRGDDGPQGEPGEAGPEGDQGEEGDVGDAGEDAPGPAMNGTKGDTGAEGLPGLEGEDGPKG---EPGAVGPEGEKGDIGPAGEVGDPGPDGPVGKDGEPGVDGDPGPDGESIKGEQGDTG--------------------IQGPKGNDGEAGEPGVAGETGEPGEAGEESA-----MVKGEQGPPGEDAEPAVPGEPGPDGEPGPKGEAGEAGPEGEKGDP------------------GVRGKPGKAGQRGPQGEKGKIGEPGEDGPVG------PKGDVGEPGEPGEPSELIPGASGKPGHPGLKGFVGEPGEVGDKGETGTEGEPGDEGEVGPLGPEGTAGPVGPDGDQGPVGPEGPVGEPGEDGAQGPSGDYGERGLKGSAGEKGDRGPIASDCPPGSPGEPGMIGNVGEPGPRGEPGSKGETGRIGNKGKPGSVGIGSWGEPGESGLPGLPGEQGLPGEQGPPGPPGQEAPEGDAGEPGERGPTGQPGEVGEQGVAGLRGPDGPKGFKGEVGSPGPDGQDGADGEPGLKGDVGPEGERGSDGAPGETGPAGIDGPKGVAGVATKGEKGELAEDGERGDTGEPGEDGKDGEPGEDGETGEKGEKGQPGI 1512          

HSP 6 Score: 202.216 bits (513), Expect = 5.648e-48
Identity = 385/1094 (35.19%), Postives = 523/1094 (47.81%), Query Frame = 1
Query:  241 VGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAK----------KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGD----------------------QPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNV------GNRGTPGPKGQPGSKGAKGIRGSDGV-----IGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRG------DIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGR--PTTGLVGPKGPKGEKGLSGLDGKNG------KVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGD-----------------RGRPGNDGAIGREGSYGDIGDRGLPGDKG--IKGAKGDSREETFPSIKGEKGDNGPDG------KEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP---VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGD---KGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGI------KGEQGINGDKGESGMI-----GRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKG------------D 3189
            +G PG  G+ G +G+PGPIG  G  G  G  G R        +G DG  GD G+ G               + G +G  GL G +G  G  G DG  G+ G+ G KG  G+ G+ GE GD  +A            G++G  G  G++G+ G++G  G  G  GD+G KG  G++G+ GPIG  GE GD                      +P     KG  G PG   +   D K F+++ +T  D  G+ GEKGE G+ G+ G              G+RG+KG+TG        G+RG PGP+G+ G  G  GI GS G      +G +G  G  G +G +G  G +G +G+ G+ G  G      +G  GP GD G++G+ G  G +G++GEKG  G+ G  G  GD+G++  PG +G      + G+ GE GE G  GP G  G            +      G++GD G +G  GE G  G +G +G+ G +G   P   + G KG  G +GL GL+G++G       VGP+G KG +G A ++               G+ G DG  G+DG PG+ GD                 +G  GNDG  G  G  G+ G+ G  G++   +KG +G   E+  P++ GE G +G  G      + GP+G KG PG+ GKPG +G  G  G KG  G PG  G  G  G+ G  G   +P   + G  G  G  G+K   GE GE GD G             E GD G+ G  G +G  G VG  GDQG  G +G  G+ G+ G  G  G  G +G  G  G  G RG    D   G  G  GM G++G+   +G  G+KG+TG IGN G       GS GE GE+G+ GLPG  G  G QG  G  G     G  G  G +G TG+PG VG++ + G++G  G    +G KG  G  G  G+    GE G +GDVGP+GERG        G  GI+G KG +G+      G   E+GE+GD G  G  G  G  G+ GETG+ G  G  G    +G  GI+GE G  G +G+ GP+G             
Sbjct:  520 IGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPLCPDGLDGPRGDPGDDG---------------VAGYKGAAGLDGDSGDPGPMGEDGPTGETGIKGAKGSIGEPGHEGEKGDPGEAAIVTRDVEGVIPGDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGENITDIVGELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENET--DIDGERGEKGEPGEVGEEG------------PKGERGRKGETGKAPLPAERGDRGPPGPQGEKGDLGPMGIEGSVGPDGPEGVGEQGETGDPGERGPEGLKGYKGEQGDFGDNGIGGPLSEGDKGEAGPKGDDGEQGDLGEDGLKGDVGEKGLPGVDGGPGEKGDVGETGDPGPKGQPSVDMEDGEPGEKGEQGPDGPAGLVG--------EPGDEAICIEIGLRGDDGPQGEPGEAGPEGDQGEEGDVGDAGEDAPGPAMNGTKGDTGAEGLPGLEGEDGPKGEPGAVGPEGEKGDIGPAGEV---------------GDPGPDGPVGKDGEPGVDGDPGPDGESIKGEQGDTGIQGPKGNDGEAGEPGVAGETGEPGEAGEESAMVKGEQGPPGEDAEPAVPGEPGPDGEPGPKGEAGEAGPEGEKGDPGVRGKPGKAGQRGPQGEKGKIGEPGEDGPVGPKGDVGEPGEPGEPSELIPGASGKPGHPGLKGFVGEPGEVGDKGETGTE-------GEPGDEGEVGPLGPEGTAGPVGPDGDQGPVGPEGPVGEPGEDGAQGPSGDYGERGLKGSAGEKGDRGPIASDCPPGSPGEPGMIGNVGEPGPRGEPGSKGETGRIGNKGKPGSVGIGSWGEPGESGLPGLPGEQGLPGEQGPPGPPGQEAPEGDAGEPGERGPTGQPGEVGEQGVAGLRGPDGP---KGFKGEVGSPGPDGQDGADGEPGLKGDVGPEGERGSDGAPGETGPAGIDGPKGVAGVATKGEKGELAEDGERGDTGEPGEDGKDGEPGEDGETGEKGEKGQPGIV--EGPRGIEGEPGERGEQGHIGPQGLVGEPGPPGPEGK 1549          

HSP 7 Score: 97.4413 bits (241), Expect = 3.857e-16
Identity = 270/741 (36.44%), Postives = 349/741 (47.10%), Query Frame = 1
Query: 2605 KGNEGSRGEEGETGMRGLPGITGDIGNQGESG---EQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGES-----GDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENG----------EKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKG-ESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEG--------DIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSK--GETGPKGDFGEDGDKGNVGPKGNKGLSGP----------CQQGRSGNRGEMGAPGKVGIK---------GEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKG-----VQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXX-----XXXEDKKGNRGEIGEP---------GDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGAR 4617
            +G EG +G+ GE G+ G  G+ G  G  GE G   E+GD G  G  G  G+KG+ G+PG          KG  G  G++G+KGF G++     G+KGE    G  G  GD GPKG  G  G +G +G  G  G+ G  G  G          EKGD GL GP+G  G   D G   +        A GP G  G KG++G  G+ G++G  G  G  GL+  KG  G  G  G +G++G  GE GE G  G  G  G+ G  G+KG+ G  G  G +G KG +G  G       + P G+ G KG KG+ GE                GE G  GK G KGL G  G KG  G   K  ++GP+G+ G  G+ G  GD G  G  G PG+ G  G        ++GE G  GV+G  GPKG  G  G+QG KG +G    G  G  G+ G+ GD G +G  G  G+ GP          C  G  G RG+ G  G  G K         G+ G  G  G  G  G KG  G+ G  G +G+ G+ G         E    G+ GE G+ GA G  G+ G+ G  GETG  G KG +G+IG+ G  GE+G  GDVG  G+ G     + G  G+ G  G+ GAKG+ G  G+                 D  G RGE GEP         G+ G+ G  G    PA RG +G  G QG  G    + G +G +GS+GP G  
Sbjct:  105 RGKEGQKGQAGEPGLPGFAGVHGMQGYPGEPGLPGEKGDNGCDGEPGDIGLKGDRGEPG---------TKGLPGFEGLKGMKGFAGDTRQGLMGEKGEIGEPGSVGIEGDPGPKGPEGYPGPRGPDGMPGARGLPGDVGPPGRPGTYIVTIVEKGDMGLPGPRGEPGYPCDEGMVNRTIEELARIAFGPTGEMGEKGDKGATGLPGDDGEPGHPGLPGLKGEKGYPGSPGREGDVGDIGPPGEPGEAGDSGVDGPRGDPGDFGEKGDPGPYGRDGQRGPKGRQGPPGKYECPIDQMPKGVIGEKGYKGEKGE---------------HGEPGERGKMGEKGLPGAEGPKGTQGYAGKQCQAGPVGEPGQKGNYGSSGDPGWPGEPGEPGKTGERGPPGDDAVVEVGEVGRDGVQGFRGPKGAPGDPGEQGEKGLSGDHDIGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPLCPDGLDGPRGDPGDDGVAGYKGAAGLDGDSGDPGPMGEDGPTGETGIKGAKGSIGEPGHEGEKGDPGEAAIVTRDVEGVIPGDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGENITDIVGELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENETDIDGERGEKGEPGEVGEEGPKGERGRKGETGKAPLPAERGDRGPPGPQGEKG----DLGPMGIEGSVGPDGPE 817          

HSP 8 Score: 87.8113 bits (216), Expect = 3.232e-13
Identity = 223/628 (35.51%), Postives = 299/628 (47.61%), Query Frame = 1
Query:  220 TQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKG-----VKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHG---------------------PRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACK--LCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPG-NDGAIGREGSYGDIGDRGLPGDKGI---------KGAKGDSREETFPSIKGEKGDNGPD 1989
            T+      G+PG +G+ G  G PG +GP+G  G++G  G  G  G  G  G+DG PG  G+ G  G            + G++GD G+ G  G +GE G  G+AG+ G  G+ G     VKG++G  GE  D   A  GE G        GE G KG  G+ G +G++GD G+RG  G  G  G  GE G     I + GE G  GP GD G             P + G+  E   G              PGL G VG+ G+ GD G  G  G PG +G+ G  G +G  G  G  G +G  G +G  G+ G+DG +G  G+ GE G  G      +G +GP       G+ G PG  GN+GE G +G PG  G  G IG+   PG  G IG  GE GESG  G                     P GD G  G+ G  G  G+ G+  +G+ G  G +G +G KG  GS G  G+ G  G P  GL G  GP+GE+G  G  G+ G  G  G KG+ G A K    +  + GE+G  G  GE GKDG  G DG  G +G++G+PG  +G  G EG  G+ G++G  G +G+         +G KG+  E  + ++   +    PD
Sbjct:  992 TKGDTGAEGLPGLEGEDGPKGEPGAVGPEGEKGDIGPAGEVGDPGPDGPVGKDGEPGVDGDPGPDGES----------IKGEQGDTGIQGPKGNDGEAGEPGVAGETGEPGEAGEESAMVKGEQGPPGE--DAEPAVPGEPG------PDGEPGPKGEAGEAGPEGEKGDPGVRGKPGKAGQRGPQGEKGK----IGEPGEDGPVGPKGDVGE------------PGEPGEPSELIPGASGKPGH-------PGLKGFVGEPGEVGDKGETGTEGEPGDEGEVGPLGPEGTAGPVGPDGDQGPVGPEGPVGEPGEDGAQGPSGDYGERGLKGSA--GEKGDRGPIASDCPPGSPGEPGMIGNVGEPGPRGEPGSKGETGRIGNKGKPGSVG-IGSWGEPGESGLPGLPGEQGLPGEQGPPGPPGQEAPEGDAGEPGERGPTGQPGEVGE--QGVAGLRGPDGPKGFKGEVGSPGPDGQDGADGEP--GLKGDVGPEGERGSDGAPGETGPAGIDGPKGVAGVATKGEKGELAEDGERGDTGEPGEDGKDGEPGEDGETGEKGEKGQPGIVEGPRGIEGEPGERGEQGHIGPQGLVGEPGPPGPEGKKGEPGETNYSTVLFARHYQTPD 1571          
BLAST of Collagen alpha-2(IV) chain vs. TrEMBL
Match: A0A267FWC6 (Collagen IV NC1 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014361g2 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 6.044e-158
Identity = 714/1821 (39.21%), Postives = 942/1821 (51.73%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGS------------KGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKL--CXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGE------PGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRG--LPGITGDIGNQGESGEQGDIGNFGPKGFKG---IKGNTGKPGPVGDKTIKGIKGDSGEPGVQG---------LKGFTGESGDKGECSGRGEFGERG---DVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGM---------MGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELG------EPGMRGSKGD-----NGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGE--KGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPK------GNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-------GIEGPDGDIGN---KGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXX---XXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQN--VEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV--DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            +NC  VC    CRCV   G  G  G +G+PG IG  G  G  G +G+RG  G  G  G  G  G +G+ G  G PG  G+ G  G+ G +G+ G  GC G  G+ G  GL+G  G  GD G  G KG  G+        KGE+G  G +G +G +G +G  G  G  GD+GD G +G  G QG  G  G PGD+ +GI  +G+ G  G  G  G  C    L   + P  +  + ++   G KG  G KG  G+PG+ G  G +G  G  G VG +G PGP G PGSKG  G +G  G  G +G +G+ G  G  G +G+RG             KG  G+ G SG C   ++GP G  G  G +G  G  G  G  G +G KG  G  G  G  GD+C  G +G+ G++G  G  G  G  GD G  G +G++G  G +G  VKG +G +GD G +G+KG  G +G KG +G + R   G  G  G  G+KG+ G  G  G+ G KG  G  G  C++  C +G+ G+ G KG +G+KG+ G  G  G  G +G  G  GN G++G  G  G+ G +G+ GD+G++G   D  +    +IKG KG+ G  G  G KG KG  G+NGK G  GD G+ G KG +G P                       G+ G  GEKG     GEKG+KG  G      V     T  GD+GD GE      PG +G  G+ G  GD+G  G DG  G                    G PG+PGKRG+ G  G+ G  G +G KG +GDKG +G +GD G  GN G     G+KG++G +G+EG  G+ G    G+ GD G++GE+GE+GD G  G KG+ G     G  G  G  GDK +KG+KGD G  GVQG          +G+ G++G+KG+  G GE G  G    VGP+G +G KG  G  G KG+ G +G  G  G+KG +G  GP+G  GV G+ G  G  G +GP G TGP G  G  G QG          +G KG  GP G +GE G   +G RG+KG++G  G VG +G +G      + G RG KGD      G+ G +G  GE G  G  G KG KG+ G  G  G  G KG  G KG      + GE+G +G +G  G  G+ G  G+ G+ G KG +G  G+  KG+ G+      KGE GP G+ GP G                   +G  G +G++G KG KG  G KG  G +G++G KG+ G KG+TG KGD G +G KG++GPK      G+KG +  C     G  GE G+ G  G KG+ GL+GL G+IG  G  G  G+       G  GP GD G    KGR+   GI G  G+ G  GE G+QG KG +G  G+KG  G  G  G+KG +G  G  G KGE G  G  GL G KG  G  G+ G  GI G+K         G  G  G  GE+ KG++G  GE G  G  G KG  G+P  RG KG  G QG  G     +G VG KG  GP+G RGK G  G +   G +G  G+ G  GP G       L T H  + +  P CP  + K+  GYSFV A  N +    +LG+  SC   F  MPF  C    +C    R++RSYWL++   +  + + V +  V   ISRC  C+SP +  A HSQ+N   D  CP  W ++W GYSF+M+TTGG+G GQ L+SPGSCL +F F+P++ECNN   +CNHW D+ SY+L  V  D  F+ P           + ++Y  +SRC VC +
Sbjct:   30 RNCTKVCRDFDCRCV--KGEMGPRGALGDPGLIGQSGMPGAPGSVGSRGEPGLQGPKGDQGDRGLQGQIGQPGYPGTSGEAGIPGMPGRKGNKGERGCEGKAGQPGLKGLSGSRGYRGDPGPDGIKGEKGDSSASAMGVKGERGPTGTDGRNGSRGVEGPRGVDGPPGDRGDPGEQGQKGYQGTKGYIGLPGDKGEGI--RGDNGTTGDPGAPGDQCSTVTL---SVPRNKLLNMDQTMQGPKGIRGPKGEKGDPGMPGDRGIKGDMGRDGTVGQKGDPGPIGDPGSKGQPGEKGDKGPKGKEGKQGRDGGIGIDGNEGDRGPPGDPGMDGTEGVKGVKGDPGPSGVCQA-LEGPAGIKGATGQRGGVGEKGLTGPAGPQGAKGFLGEAGAKGQQGDTCRNGSKGEKGNRGPEGPRGQKGDEGDQGPKGASGNKGAKGYQGAGVKGDQGPTGDRGYKGDKGERGYRGNKGVKGGAIR---GDPGSTGQMGDKGIHGPAGSRGRKGDKGDAGQNG-ECRVINCTQGEKGDMGPKGWKGDKGQPGPGGPQGEKGYKGYLGPQGNKGSMGPRGLKGETGYKGVTGDRGLQG---DDAKVNVTTIKGHKGEFGYKGTNGEKGEKGVAGINGKIGRKGDRGEKGDKGLDGIP-----------------------GKNGTDGEKGDTGEVGEKGQKGLRGEEITGSVGVKGDT--GDKGDKGEKAASGGPGDKGQKGETGYAGDKGEGGQDGNKG------------------VKGEPGMPGKRGEKGPRGDIGPRGFKGFKGFVGDKGSNGTRGDRGEKGNTGDLGDKGVKGDKGIKGDEGPVGIPGDARTGVKGDNGSRGETGEKGDKGYQGEKGYSGRPGTNGTIGDTGTKGDKGLKGLKGDKGSQGVQGDRPVKGVKGQQGYIGDTGEKGDKGGSGEAGRLGVCKGVGPEGRQGEKGLPGPQGPKGDKGTVGEKGYQGDKGVKGEIGPEGPRGVKGELGPQGLNGSLGPQGPTGPNGEKGNLGPQGTQGEVGPKGELGQKGQRGPLGAKGETGPPARGPRGDKGDVGPRGPVGPEGPVGPRGPAGDVGPRGPKGDGLPGPQGDKGDVGPLGEKGEIGPLGPKGDKGISGPSGATGRKGIKGNLGYKG------EKGELGPKGDLGPKGDKGENGTTGDEGEKGDKGFTGDKGDFLKGMPGLMGPKGNKGEVGPKGEVGPRGV------------------KGVSGQMGKQGRKGDKGGTGYKGETGQKGEKGVKGDVGEKGDTGFKGDKGGNGTKGDLGPKGTKGDLGDKGFAQNCST-VIGPEGEKGSNGTKGEKGDTGLKGLKGEIGPRGPNGTKGSKGDMGDKGDTGPKGDAGQKGEKGRDASHGIDGVKGDVGLKGEKGQQGDKGRRGPTGDKGIGGPPGSRGAKGERGPQGRVGPKGELGETGPNGLRGEKGENGTAGDTGPKGIKGSK---------GENGTLGQKGEEVKGDKGVKGEKGTRGGTGEKGQAGQPGKRGQKGDTGPQGDVG----PKGNVGPKGDRGPRGDRGKKGSLGPKGIIGHKGRSGEKGIPGPGGPMSPGGSLLTLHSMS-DNAPDCPPDTKKVRMGYSFVAAFSNGKTWAQDLGSMGSCPEKFTSMPFIYCDSALNCHYSSRSERSYWLSTRTAMLANPMPVADPQVMSRISRCTVCDSPTDLIAVHSQSNTHPD--CPTGWGQIWIGYSFLMYTTGGSGSGQDLNSPGSCLQHFSFAPMMECNNNGGKCNHWKDSISYWLTVVADDGMFKRPVSSSTSFPG--TTDIYSRISRCTVCRR 1749          
BLAST of Collagen alpha-2(IV) chain vs. TrEMBL
Match: A0A1I8FWC8 (Collagen IV NC1 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 3.749e-147
Identity = 669/1855 (36.06%), Postives = 850/1855 (45.82%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSG--RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKG---------IKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEM----------GDRGDTGE------PGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGE------------------------------KGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG---IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDS---GEPGVQGLKGFTGESGDKGECSG------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGD---QGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----------LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDI-----GEKGNKGVKGELGPKGNVGP------------QGDQGPKGNTGSKGETGP---KGDFGEDGDKGNVGPK------GNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-------GIEGPDGDIGN---KGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXX---XXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQN--VEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHV--DSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            +NC  VC    CRCV                           GE+G RG +GD G  GQ G+PG  G                    G RG+ GL G  G  G++G  G+ G  G  G+KG +G +G  G+P        G KG +                           G RG  GD GP G+ GE GD     +  G KG  GP G  G +    V   +                              G+DG  GDRG  G+ G  G +GT G  G PG KG +GIRG +G  G  G  G +          N+    +             +QGP+G  G KG+KG+ G+PG +G  G+ G  G  G  G          PG  GD G KG+ GE G  GP+G  G  G  G  G  G+     +G +G  GD G+ G +G+   KGVKG+ GPSG  +   G  G KG  G++G  G  G  G  GP+G KG LG                  ++GE+G  G  G  G   IRGD   PG+ G +G +G +G  G RG  GDKG  G  G+ R       +GEKGD GP G +G KG          KG+ G  G+ G++G  GK+G KGD                          +GE+G +G  GI   +G  GEKGD+G       K L   E+          GD+GD GE      PG +G  G+ G  GD+G  G DG  G                    G PG+PGKRG+ G  G+                               GD+G++G+KGD       G KGD G +G PG    G+KG+ GSRGE GE G +G  G  G  G  G +G  GD G  G KG KG+KG+ G  G  GD+ +KG+KG     G+ G +G KG +GE+G  G C G      +GE G  G  GPKG++G  GE+G  GDKG  G IG  G  G KG+   QGLNG  G  G  G  GE G  GP G  G  GPKG  G KG++G +G KG  GP           +G RG+KG++G  G VG +G +G  G  G  G  G  G G  G  G  G+ G  G+KG                           +IG +                        GPKG  GISG  G +G             KGE GP GD GP GD G  G  GD+G KG  G  G++GD      G  G KG KGE+GPKG VGP            QG +G KG TG KGETG    KGD GE+G KG++GPK      G+KG +  C     G  GE G+ G  G KG+ GL+GL G+IG  G  G  G+       G  GP GD G    KGR+   GI G  G+ G  GE G+QG KG +G  G+KG  G  G  G+KG +G  G  G KGE G  G  GL G KG  G  G+ G  GI G+K         G  G  G  GE+ KG++G  GE G  G  G KG  G+P  RG KG  G QG  G     +G VG KG  GP+G RGK G  G +   G +G  G+ G  GP G       L T H  + +  P CP  + K+  GYSFV A  N +    +LG+  SC   F  MPF  C    +C    R++RSYWL++   +  + + V +  V   ISRC  C+SP +  A HSQ+N   D  CP  W ++W GYSF+M+TTGG+G GQ L+SPGSCL +F F+P++ECNN   +CNHW D+ SY+L  V  D  F+ P           + ++Y  +SRC VC +
Sbjct:   30 RNCTKVCRDFDCRCV--------------------------KGEMGPRGALGDPGLIGQSGMPGAPGS------------------VGSRGEPGLQGPKGDQGDRGLQGIPGMPGRKGNKGERGCEGKAGQP--------GLKGLS---------------------------GSRGYRGDPGPDGIKGEKGDSS--ASAMGVKGERGPTGTDGRNGSRGVEGPR------------------------------GVDGPPGDRGDPGEQGQKGYQGTKGYIGLPGDKG-EGIRGDNGTTGDPGAPGDQCSTVTLSVPRNKLLNMDQ-----------TMQGPKGIRGPKGEKGDPGMPGDRGIKGDMGRDGTVGQKGD---------PGPIGDPGSKGQPGEKGDKGPKGKEGKQGRDGGIGIDGN-----EGDRGPPGDPGMDGTEGV---KGVKGDPGPSGVCQALEGPAGIKGATGQRGGVGEKGLTGPAGPQGAKGFLG------------------DKGERGYRGNKGVKGG-AIRGD---PGSTGQMGDKGIHGPAGSRGRKGDKGDAGQNGECR--VINCTQGEKGDMGPKGWKGDKGQPGHKGEFGYKGTNGEKGEKGVAGINGKIGRKGD--------------------------RGEKGDKGLDGIPGKNGTDGEKGDTGEVGEKGQKGLRGEEITGSVGVKGDTGDKGDRGEKAASGGPGDKGQKGETGYAGDKGEGGQDGNKG------------------VKGEPGMPGKRGEKGPRGDVGPRGFKGFKGFVGDKGSNGTRGDRGEKGNTGDLGDKGVKGD------KGIKGDEGPVGIPGDARTGVKGDNGSRGETGEKGDKGYQGEKGYSGRPGTNGTIGDTGTKGDKGLKGLKGDKGSQGVQGDRPVKGVKGQQGYIGDTGEKGDKGGSGEAGRPGVCKGVGPEGRQGEKGLPGPQGPKGDKGTVGEKGYQGDKGVKGEIGPEGPRGVKGELGPQGLNGSLGPQGPTGPNGEKGNLGPQGTQGEVGPKGELGQKGQRGPLGAKGETGP---------PARGPRGDKGDVGPRGPVGPEGPIGPRGPTGDVGPRGPKGDGLPGPQGDKGDVGPLGEKG---------------------------EIGPL------------------------GPKGYKGISGPSGATGRKGIKGNLGYKGEKGELGPKGDLGPKGDKGENGTTGDEGEKGDKGFTGDKGDFLKGMPGLMGPKGNKGEVGPKGEVGPRGVKGVSGQMGKQGRKGDKGGTGYKGETGRHGFKGDKGENGTKGDLGPKGTKGDLGDKGFAQNCST-VIGPEGEKGSNGTKGEKGDTGLKGLKGEIGPRGPNGTKGSKGDMGDKGDTGPKGDAGQKGEKGRDASHGIDGVKGDVGLKGEKGQQGDKGRRGPTGDKGIGGPPGSRGAKGERGPQGRVGPKGELGETGPNGLRGEKGENGTAGDTGPKGIKGSK---------GENGTLGQKGEEVKGDKGAKGEKGTRGGTGEKGQAGQPGKRGQKGDTGPQGDVG----PKGNVGPKGDTGPRGDRGKKGSLGPKGIIGHKGRSGEKGIPGPGGPMSPGGSLLTLHSMS-DNAPDCPPDTKKVRTGYSFVAAFSNGKTWAQDLGSMGSCPEKFTSMPFIYCDSALNCHYSSRSERSYWLSTRTAMLANPMPVADPQVMSRISRCTVCDSPTDLIAVHSQSNTHPD--CPTGWGQIWIGYSFLMYTTGGSGSGQDLNSPGSCLQHFSFAPMMECNNNGGKCNHWKDSISYWLTVVADDGMFKRPVSSSTSFPG--TTDIYSRISRCTVCRR 1591          
BLAST of Collagen alpha-2(IV) chain vs. TrEMBL
Match: A0A0M4E8D6 (Cg25C (Fragment) OS=Drosophila busckii OX=30019 GN=Dbus_chr2Lg336 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 6.339e-144
Identity = 681/1879 (36.24%), Postives = 859/1879 (45.72%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCV------GIPGP------KGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNG---------------------------TNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF----------FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMD------------GDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP---------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGI---RGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETF------PSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGE------KGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGD---KGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRG------LPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKG------INGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNV-------------GPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGK------IGRMGDKGK------PGN-GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGP---RGDVGLNGIKGVQGYKGEMGSTGILGAK-------------XXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVD--SEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            KNC         +C+      G+PGP      KG  G  G  GP G KG  G+ G  GARG  G+ G+ G  GLPG  G  G  G PG  G PG  G  G  G  GL G +G                             GEKG  G  G+ G  G  GV+GDKG  GE G +           + +KG   FA           +       +             GD G  G  GD G++G +G SGEPG       QKGEKG PG  GD G                                         G  G  G +G +G+TG  G  G PG KG+PG  G  G RG   V       G +G  G  G  G RG  G  G  G SG     + G  GP G  G KG  G+ G  G  G  G K                        G+KG  G +G+ GP G  G+NG  G EG  G+ G    GI+G  GD+GL G  G+ G+KG +G +G  G P         T G  G  GP+G+ G  G  G  G +GPKG  G     C LC  G          +G+KG  GL G  GNPG    +G+RG PG  G  G  G  G  G++GL G  G+ GA+G + +  F        IKG+KG  G  G  G KG +G  G++G PG+ GDMG   +KGD G PG  GL G  G  G  G D  P Q  +G  G  G   + G+KG       KG+ G C  + +K       GDRG TG PG  GP G  G  G +G KG                       G  G PGI G RG +G  GEKG+ G  G  G+ G    +G  G  GD G  G  GI + G  G +G +G TG +G       PG  G  GN G  G++GD G  G  G  G  G  G+PGPVG   + G  G  G  GVQG  G  GE G  G     G  G+RG  G  G +G  G  G  G +G  G+ G +G  G+KG +GL G   N G+ G RG  G PG +GP G  GP G      +NG+ GE+G  G+ G +GP+G+ G+     KGQ+GE G+ G+      +G+ G PG  G  GD G  GI   G  G+ GE   KG  G +G  G+ G  G KG  G  G  G KGD G +G  G  G  G  GK G  G  G  G  G  GI GE+GL+G   +KG +G  G                        RQG  G  GEKG+KG +G  GPK  V             G  G  GPKGN   KG+ GP G  GE GD+G  GP G  GLSG P  +G  G RGEMG PG V +KGE+GL G  GK      IGR G KG+      PGN G+ G  G IG  G +G +G  G  G  G  G +G QG KG  G  G KG+ G  G+ G KG KG+ G  G  G NG    +GDVGL G+ G  G  G MG  G  G K                    +             + G +GEIG PG+ G +G +GD GE   RG  G+ G  G  G  G+  EQG++G +G++G  G +G+PG+                        +  L TRH QN E+ P C  G  +++ GYS +  +GN   +  +LG+  SC+  F+ +P   C ++  C    R D+S+WLA+ AP+    +  Q + KYISRCV CE+PA   A HSQ+  L+   CP  W  LW GYSF+MHT  GN GGGQ+L SPGSCL  FR +P +ECN     C+ +    S+++  ++   +F  P+ + IKA      N+   +SRC+VC+K
Sbjct:   50 KNCTAGYAGCVPKCIAEKGNRGLPGPEGPTGLKGVMGYSGQDGPPGDKGQKGDPGPYGARGDKGERGTRGIPGLPGVSGIQGPAGNPGFPGTPGKDGCDGTDGMPGLQGLSGLAGPRGYPGGPGGKGEKGEPAKENGDYAKGEKGEPGFGGRSGYPGPDGVRGDKGERGETGPYGPPGPRGDRGIKGEKGASCFAIAMPGQKGGKGEKGEPAPKLPAIGKPTSFMGGKGDVGQPGEPGDQGEKGGLGPSGEPGHD----GQKGEKGLPGGAGDRGRQGNF------------------------------------GPPGPSGQKGDRGETGLNGLPGQPGMKGEPGRFGDAGERGL--VGPPGPPGGGRGQPGAPGPKGPRGYTGRPGPQGLSG-----VDGQPGPVGIIGLKGGPGLAGQPGREGPAGPK------------------------GEKGNAGRTGSQGPIGPIGYNGPPGHEGQKGEAGLPGYGIQGPKGDDGLNGINGMKGAKGERGYKGNVGVPGDSKLGRPGTPGQAGIPGPQGDAGRPGTPGDKGDMGPKGDAG---GKCSLCPPGL---------KGDKGDHGLNGIPGNPGAIGPQGERGFPGERGDDGINGPMGPPGEKGLDGLPGVPGAEGQAGQNAFVDWSRIEPIKGDKGMPGFPGAAGLKGERGESGISGAPGLKGDMG---LKGDRGYPGPPGLDGTDGSPGRAGADGFPGQSIKGEPGRPGYDGLKGDKGSAGFVGIKGEPGTCAASELKIPPKGNKGDRGSTGMPGPNGPTGVTGDIGQKGEKGD---------------------MGPQGPPGIVGPRGITGPRGEKGNSGQFGAPGNDGKDGARGPPGRYGDRGQKGEQGITVAGPPGPQGRDGMTGEKGDHGPVGAPGALGPDGNPGYPGDKGDSGFPGQPGSTGDLGQKGEPGPVGPMGMSGPPGTPGIDGVQGRDGAKGEPGSPGLVGMPGNKGDRGAPGIDGPKGFTGPAGAPGKRGPIGLAGVSGMKGDKGPRGLTG---NDGMPGARGPQGPPGLMGPKGDVGPAGFPGQDGVNGMDGEKGNQGLPGFDGPQGEPGDA--SEKGQKGEPGSSGL------RGQDGMPGAPGLTGDKGLPGIAVHGRPGAPGE---KGDAGRDGIYGNDGAPGEKGERGYPGQTGPKGDKGAMGMNGAPGAPGIDGKPGTAGQPGPIGYPGPKGIKGERGLAGEHGIKGVAGLAG------------------------RQGYPGLHGEKGDKGDRGYPGPKAVVDVQLGEKGMRGLDGAPGMPGPKGN---KGDQGPMGFAGEKGDRGMTGPAGAPGLSGSPGLKGDMGLRGEMGYPGPV-VKGEKGLPGRAGKNGREGAIGRPGQKGERGLPGLPGNDGLVGLPGPIGPMGMKGDRGETGMPGIDGSAGLNGAQGMKGDMGYPGAKGDRGLNGFEGQKGDKGEQGVSGPPGLNGLPGLKGDVGLPGMDGHPGSAGPMGEKGFTGPKGHDGRDGMPGLRGQKGEPGLVPPPGPKGEPGHPGRDGQKGEIGMPGERGLIGMQGDRGEKGERGQIGLTGAPGRMGIKGERGEQGLIGVEGAVGAMGFKGEPGQPCSTAQD---------------YLTGILVTRHSQN-EQVPQCAPGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVMSCGQNNVCNYASRNDKSFWLATSAPIPMMPVNNQEISKYISRCVVCEAPANVIAVHSQS--LAIPNCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGHCHFYETMTSFWMVTLEDGDQFSRPEQQTIKA-----GNLLSRVSRCQVCVK 1756          
BLAST of Collagen alpha-2(IV) chain vs. TrEMBL
Match: A0A1W4UI59 (collagen alpha-1(IV) chain OS=Drosophila ficusphila OX=30025 GN=LOC108089897 PE=4 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.895e-140
Identity = 683/1838 (37.16%), Postives = 889/1838 (48.37%), Query Frame = 1
Query:  199 KNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKG------VKGDKGYIGEP----GDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAG--------------GSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGD------IGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP------TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAG---RDGNPGIRGDRGRPG---NDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP---VQGERGLQGEKGIK----PIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGD---IGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGN---------EGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKG---------------NVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGE-----LGEPGMRGSKGDNGETGI-------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSG--NRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQG---LSGYSGQ-----EQGMVGDKGSIG---PQGARXXXXXXXXXXXXXXXXXXXXXXXXXXA---LESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            +NC         +C+       + G  G PGP+GP G  G  G  G  G +GD G  G  G  G RG  G+ G  GI G  G  G+ G  G  G PG NG +G  G DG+ G  GLSG  G      + G KG  GEP    GD+ + +KGE GFAG  G +G +G         + G++GD+G  G  G +GP G  G  G++        + G PG  G+ G       + G     ++G  G+KGE G  G  G  G  G PG+ G  G +G+KG  G  G+RG  G  G PG  G KG RGS G+ G  G               N G KGE G  G              G G+      GP+GP G  G  G +G+ G  G  G +G+ G  G          S LPG+ G+       G+KG  G  G+ GP G  G+ G  G EG  GD G    GI+G  GDEG+ G  G  G+KG +G +G +G P        G  G  G  GEKG +G  G  G+ G +G KG +G  C  CK G          +GEKG  GLAG   +DG  G  G+RG PG    DG  GR G  G+ G+ G+ G  G  G  G      +  ++  KGD G  G  G  GI+G  G  G+PG  G  G +G+KGD+G  G  G+ G  G  G  G    P   ++GE G  G  GIK    PI G  GE+G+ G+C     +       G +G+ GEPG  GP G VG +G+QG KGS G +G                    G  GI G RG +G  GEKG+   IG  G  G  G +G  G  G+ G  G PGI + G          +G +G  G  G  GLPG  G +G  G+ G+ G  G  GP G  G KG+TG  GP G      I+G  G PG+ G++G  G  GD+G+    G  G +G+ G  G  G KG  G+ G  G+ G +G  G  G KGD+G  G  G                +GV GD+G  G PG  G DG  G KG  G+ G  G  G+ G+   KG +GE G+   G RG+ G  G  G  G KG+      G PG +G KGD G  GI       G+KGE G  G +G  G+K                              G +G+ G  G  G  G  G  G  G  G  G  G  GE GL G+T LKG  GP G  G  G  G  GD+G +G  GLP         G+KG++G +G  G KG+ G +G+QG  G TG+KG+ G +G  G  G  G  G KG+ GL G  +QG  G   +GE G PG+ G  G QGL G PG I   G++G P  G+ G  G +G  G  G  G KGE G  G  G+ G+ G  G  G  G+ G  G  G  G+ G +G  GDKG +G  GP G  GLNGIKG  GY G  G+ G  G +G +G  G  G  G      +   G  G+ GEPG +   G KG+ G+P   G KG  G QG   L G  GQ     E+G++G+ G +G   P+G RG  G++G +G  G  G+ GE G    A     +  L TRH Q+    P C  G  +++ GYS +  +GN   +   LG+  SC+  F+ +P   C ++  C    R DR++WL + A +    +E  ++++YISRCV CE+PA   A HSQT  + D  CP  W  LW G+SFVMHT  GN GGGQ+L SPGSCL  FR +P +ECN     C+ +    S++L ++DS   FE P+ + IKA + +S+     +SRC+VCMK
Sbjct:   71 RNCTAGYAGCVPKCIA------EKGNRGLPGPLGPTGPKGETGFPGLEGPLGDKGQKGDPGPYGPRGYKGERGSQGIPGQAGVPGVQGSAGAPGAPGLNGKDGCDGEDGMPGLAGLSGMAGPRGFAGIAGSKGEKGEPAKENGDYAKGEKGEPGFAGTAGFAGPQG---------LPGEKGDRGDTGPYGAKGPRGEYGLKGEKGSSCYGPMKPGAPGLKGEKGEPASSVPVNGGV--SKQGAPGDKGEKGVPGPEGQAGAIGSPGVQGNDGQKGEKGLPGGPGDRGRQGNFGPPGPAGQKGDRGSTGLNGLPG---------------NPGQKGEPGRDGETGKPGLLGPPGPPGGGRGTPGPSGPKGPRGYAGAPGPRGLSGADGETGPQGYAGQKGG---------SGLPGRPGNEGPAGRKGEKGVAGRDGSPGPVGPIGYQGPPGREGQKGDAGIPGIGIQGPKGDEGIPGTPGQKGNKGERGFKGNAGVPGDSKLGRPGTPGTAGAPGEKGDAGRPGNPGQKGDQGPKGEIGGKCSSCKSGA---------KGEKGAIGLAGIPGKDGARGPPGERGYPGERGQDGINGRTGPPGERGEDGMTGAPGATGLPGLPATINWSLVEPIKGDKGNAGLTGAPGIQGLQGAKGEPGAKGPPGLLGLKGDKGLSGAPGVDGTPGRAGRDGFPGLPGISIKGEPGFNGLNGIKGDKGPI-GRTGERGEPGSCAAGEQR---LPPKGSKGERGEPGAPGPTGDVGPRGEQGFKGSKGDTGP------------------KGQAGIEGPRGLNGPRGEKGNQGGIGAPGNPGHDGLRGLPGRNGEPGLRGEPGISVAGPPGPPGLTGLQGEKGNRGPIGAPGLPGADGSVGYPGDRGDAGMPGAAGPPGLVGEKGDTGPVGPAG------IQGPPGVPGISGVRGLDGNKGDQGQPGLVGMPGSKGERGAPGNDGPKGFAGVTGAPGKRGPVGIPGIPGAKGDKGHIGMTGIDGPIGGRGPPGPPGLMGVKGDQGFAGAPGQRGLDGLNGEKGAQGLPGVDGAPGLPGDASEKGQKGEPGI--PGLRGDTGLTGEPGWPGDKGQPGLAVHGRPGPQGEKGDTGRAGIDGRDGLAGEKGEQGLQGVWGQPGEK------------------------------GSVGAPGIPGAPGMDGLNGAPGAPGAVGYHGAKGDKGEAGLIGLTGLKGAVGPQGPQGYVGAPGEKGDRGIRGQPGLPAIIDEAALRGDKGSQGERGLTGAKGDKGARGEQGLTGFTGAKGDRGFQGPPGAAGLNGAPGQKGDIGLQG--EQGYPGRPTKGEKGLPGRSGRNGRQGLTGAPGLI---GERGLP--GLPGEPGLVGLPGPIGAPGAKGERGIAGSPGQPGQDGFTGAPGAKGDVGLQGFKGERGANGFEGQKGDKGNQGYQGPPGQPGLNGIKGDIGYPGLNGADGPPGPQGERGPTGPKGRDGV-----DGYPGLAGQKGEPGLVSPPGPKGEPGQPGYNGQKGEPGRQGDRGLVGIQGQRGEKGERGLIGETGLVGRPGPKGDRGLQGERGFEGAIGLIGEKGEPGAPCSAALDYLTGILVTRHSQS-TSVPTCFAGQTELWSGYSLLYVDGNDYAHNQELGSAGSCVPRFSTLPVMSCGQNNVCNYASRNDRTFWLTTNADLPMMPVENNDIQQYISRCVVCEAPANVIAVHSQTIEVPD--CPNGWESLWIGFSFVMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWLFNLDSTPSFEKPQMQTIKAGERQSR-----VSRCQVCMK 1778          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Cavefish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 318.161 bits (814), Expect = 1.795e-88
Identity = 446/1253 (35.59%), Postives = 584/1253 (46.61%), Query Frame = 1
Query: 1867 SYGDIGDRGLPGDKGIKGAKGDSREETF-PSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPG---ISGDMGKMGVK---GDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS--DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGP--------------------VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENG---EKGDQGLNGPKGNVGVIG---DRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITL------KGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGD------------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGI------KGEQGL---EGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGY---KGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQG----ARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQ--NVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            +Y   G  G PG  G KGA+G+  +    P++KGEKG  G  G  G  GI G PG +G+PG     GD  ++G+K   G+ G+PG+ G  GE G  G  GI      GE+G QG  G+    G  G KG+ G    +          G RG++G PGLQG   + G  GDQG  G   D         G PG  G KG  G  G PG+PG+ GQ G DG  G  G  G KG+                  PGIG+      RG +G  G  G+PG  G+ GN G  G  G  G  GP G +G+KG  G PG                     +G     G  G +GE G +GL G+ G S                  GP+GE+G  G  GI G KG  G  GR G++G   E+G+  L  PKG++G++G    +G  G PG  GP G  G +G+ G +GEQG  G  GN      +  KG   KG  G++G+ G  G  GA G  G+PG+ G  G  G  G  G+KG+ G  GE G  GQ G++G                         IGE+G  G  G  G  G  G  G+ G  G +G+ G  GE GL GI        KG++G  G  G +G  G+ G  G  G  G PG++G+ G  G  G+ GV GE G  G  G  GD            QGP G TG KGE+G  G  G  G++G+ G  G +GL G P + G  G+RG  G PG  GI      KGE+GL   EG+ G+ G  G  G    G +G  G  G  G  G+ G+ G +G  G  G  G +G KG  G  G  G                          G +G +GL G  G+ GY   KGEMG+ G+ G +G +G  G  G   +                  GDIG  G +G  G P  +G  G KG+QGL G  G   E G  G  G  G +G          +     P           P   +++  FL TRH Q+  + P CP G+  I++GYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL S  P+   M  V   +++ +ISRC  CE+PA   A HSQT  +    CP  WT LW GYSFVMHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  ++ E  F  P    +KA      N+   +SRC+VCMK+
Sbjct:  133 TYRKYGRDGPPGLMGAKGAQGEPGDIFLAPNVKGEKGTPGFPGTRGLPGIDGLPGKDGRPGQPGPKGDPARVGIKGDRGEVGDPGLSGPPGERGPPGLPGIGKPGEPGEKGTQGTAGMPGRPGLPGPKGEPGKGVSSPG---PQGPPGPRGESGRPGLQG---ESGTPGDQGLPGFPGDKGDPGLPGIGFPGPPGPKGYSGIPGTPGVPGEPGQPGQDGLPGRPGEPGKKGE------------------PGIGL------RGPKGTIGQPGVPGFPGEKGNVGMPGVPGPEGRTGPPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPGPS----------------TPGPQGEKGSPGFPGIPGPKGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMGAPGSQGYQGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTDVDMEHMKG--EKGDSGDRGDPGPTGPTGATGIDGDPGLAGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKG------------------------SIGEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGVKGTMGIPGSPGTPGQKGDVGQTGYPGSPGVPGEKGVTGLPGSPGDPGLSGRPGEPGLQGPPGPTGQKGESGVDGIPGASGERGDPGVPG-RGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGERGLPGPSMEGPKGNTGPQGEPGEPGQTGVPGPAGVPGSPGAKGERGEKGFTGPQGAVGL------------------------KGDKGFIGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIK----------------GDIGFPGPRGPPGLPGAQGFPGAKGQQGLMGIQGMKGEDGAPGYNGHPGAKGEPGLIGPSGPRGYPGPPGPDGLPGPAGSPGPSSMDHGFLVTRHSQSI-DVPYCPQGTTLIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTSPEPMPMSMAPVTGDSIKPFISRCAVCEAPAMVIAVHSQTVAIPP--CPLGWTSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATIEDEEMFRKPIPTTLKA-----GNLRTHISRCQVCMKR 1263          

HSP 2 Score: 189.889 bits (481), Expect = 5.313e-48
Identity = 324/950 (34.11%), Postives = 412/950 (43.37%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQ------GPQGPFGDKGDKGNQGIPGYQGNLGEKGFK----XXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYG-----------------------DIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISG------------DMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGD------------------------KGRSGAKGDTGAIGNPGIGI------KGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGI---KGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGE--------------CSGRG------EFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGL-----NGPKGNVGVIGDRGE---TGKPGPIG---PDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVG-------------AKGEL---------------GEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            PGL GA G +G+ GD     N    G KG PG  G +G+ G DG+ G  G  GQ G +G   + G +G +GEVG+ G SG             G  G  G+KG +G  G+PG  G  G KG        PGP GP G  G+S  PG +G+ G  G+ G  G  G +GD G  G              + G  G  G+ G  G+ G+ G  G  G++G    P  GL GPKG  G+ G+ G  G+ G VG   M G+                         G +G  G  G  G++G+RG PG  G  G  G  G                       + GD+GLPG  G           + P  +GEKG  G  G  GPKG+ G PG  G+ G  G            DMG MG  G +G                      P + G RG  GE+G+K   GE+GE+G  GN T   ++ +   E GD GD G+PG  GP G  G+ GD G  G DG                       G+PG PG++G  G+ GE G  G  G+KG IG+                        KG  G KG+ G  G PGIG       KG  G+ G  GE+G +G+ G  G  G+ G  G++GD+G  G  G  G+   KG TG PG  GD    G+ G  GEPG+QG  G TG+ G+ G                 GRG      E G +GD G  G  G  G  GI G KGE G+ G  G  G  G++GL      GPKGN G  G+ GE   TG PGP G     GA G +G  G  G QG +G+KG+ G  G QGE GL    G +GE GN GV G  G              KG++               G PG +G +G  G  G+ G+ G  G NG  G+KG+ G+
Sbjct:  143 PGLMGAKGAQGEPGDIFLAPN--VKGEKGTPGFPGTRGLPGIDGLPGKDGRPGQPGPKGDPARVGIKGDRGEVGDPGLSGPPGERGPPGLPGIGKPGEPGEKGTQGTAGMPGRPGLPGPKGEPGKGVSSPGPQGPPGPRGESGRPGLQGESGTPGDQGLPGFPGDKGDPGLPGIGFPGPPGPKGYSGIPGTPGVPGEPGQPGQDGLPGRPGEPGKKG---EPGIGLRGPKGTIGQPGVPGFPGEKGNVG---MPGV------------------------PGPEGRTGPPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPG----------PSTPGPQGEKGSPGFPGIPGPKGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMGAPGSQGY------------------QGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTDVDMEHMKG-EKGDSGDRGDPGPTGPTGATGIDGDPGLAGKDG---------------------MPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSIGEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGVKGTMGIPGSPGTPGQKGDVGQTGYPGSPGVPGEKGVTGLPGSPGDP---GLSGRPGEPGLQGPPGPTGQKGESGVDGIPGASGERGDPGVPGRGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGERGLPGPSMEGPKGNTGPQGEPGEPGQTGVPGPAGVPGSPGAKGERGEKGFTGPQGAVGLKGDKGFIGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIKGDIGFPGPRGPPGLPGAQGFPGAKGQQGLMGIQGMKGEDGAPGYNGHPGAKGEPGL 1007          

HSP 3 Score: 178.333 bits (451), Expect = 2.172e-44
Identity = 335/1002 (33.43%), Postives = 434/1002 (43.31%), Query Frame = 1
Query:  466 RGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKG---------EKGFPGPIGDAGT--DCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVG------PKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGR------PGNDGAIGRE---GSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLET--------------------KGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI 3330
            +G+ G PG  GT G  G DGL GK G  G  G KGD   +G  GD  + + G+ G +G  G  G  G  G        G+ G+KG +G  G  G  G+ G  G+  KG++  G         E G PG  G++GT  D  L        P  +GD G  G G              PG  G  G+ GQ G  G  G  G PG KG+PG             IG                   RG KG +G+ G  G                G+KGN G+PG  G  G  G                   PG +G  G++G  G  G  GP G  G                   G  G+ GD+GL G  G S + G +GE+G  G P  G+ GPKG  G+ G  G DG  G+ G      PKG  G++G              G +G QG+ G  G  G  G  G++G+RG       PGN   +  E   G  GD GDRG PG  G  GA G   +       G  G  G  G++G  G+ G PG+ G+PGI G +G+MG+ G  G  G KG  G                G RG +G++GIK      GEKG+ G   I F         G++G TG PG  G  G+ GVKG  G                              +PG PG  GQ G  G+ G  G+ G+ G+ G  G  G+ GD G  G PG  G++G  G  G++GE+G+ G+PG +G+ G+ G  G +G  G  G  G KG +G+ G PG  G   I G KG+ G PG +G++G  GE G      G    G +G+ GP+GE G  G+ G+    G +G+ G  G  GE+G++G  GP+G VG+ GD+G       IG  G  G  G NG KGE G  GV G  G +G  G  G  T                    +G  G KG  G++G  G KGE G PG  G  G  GE G+
Sbjct:  165 KGEKGTPGFPGTRGLPGIDGLPGKDGRPGQPGPKGDPARVGIKGD--RGEVGDPGLSGPPGERGPPGLPGIGK----PGEPGEKGTQGTAGMPGRPGLPGPKGEPGKGVSSPGPQGPPGPRGESGRPGLQGESGTPGDQGLPGF-----PGDKGDPGLPGIGFPGPPGPKGYSGI-PGTPGVPGEPGQPGQDGLPGRPGEPGKKGEPG-------------IGL------------------RGPKGTIGQPGVPGF--------------PGEKGNVGMPGVPGPEGRTG------------------PPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPGPS-TPGPQGEKGSPGFP--GIPGPKGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMGAP------------GSQGYQGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTDVDMEHMKGEKGDSGDRGDPGPTGPTGATGIDGDPGLAGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSIGEMGIPGTGGLKGTKGTIG--------------TPGHRGFKGDEGIK------GEKGEHGLPGIGF-----PGVPGEKGQTGTPGFPGESGQKGVKGTMG------------------------------IPGSPGTPGQKGDVGQTGYPGSPGVPGEKGVTGLPGSPGDPGLSGRPGEPGLQGPPGPTGQKGESGVDGIPGASGERGDPGVPG-RGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGERG----LPGPSMEGPKGNTGPQGEPGEPGQTGV---PGPAGVPGSPGAKGERGEKGFTGPQGAVGLKGDKGF------IGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIKGDIGFPGPRGPPGLPGAQGFPGAKGQQGLMGIQGMKGEDGAPGYNGHPGAKGEPGL 1007          

HSP 4 Score: 163.696 bits (413), Expect = 6.175e-40
Identity = 339/954 (35.53%), Postives = 429/954 (44.97%), Query Frame = 1
Query: 1495 KGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKV------GPKGMKGLLGTACKLCXX-XXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETF-PSIKGEKGDNGPDGKEGPKGIKGSPGLNGK---PGISGDMGKMGVKGDE---GNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS--DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGI---TGDIGNQGESGEQGDIGNFGPKGF-----------------------------KGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGM------IGRTGENGEKGDQGLNGPKGNVGVI---------GDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMG---------------VIGNVGAKGELGEPGMRGSKGDNGETGI------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKG 4089
            K I+G  GD GL GE G       KG++GP G     L GP+G  G  G  G  G+   +            G  G  C  C   G  G  G  G +G +GK  L G+              N   +    +Y   G  G PG  G KGA+G+  +    P++KGEKG  G  G  G  GI G PG +G+   PG  GD  ++G+KGD    G+PG+ G  GE G  G  GI      GE+G QG  G+    G  G KG+ G    +          G RG++G PGLQ   G+ G  GDQG  G   D         G PG  G KG  G  G PG+PG+ GQ G DG  G  G  G KG+ G     G +G  G IG PG+      G  GE+G  GM G+PG    TG  G QG  GE+G  G  G  G                              KG KG  G PGP      +G KG  G PG+ G KG  G+ G  G+    GE GE   + PKG+ GI G  G  G +G+ G+      IG  G  GE+G+QG  GP GN+  +         GD G+ G PGP GP GATG  G  G+ G+ GM G+ G  G KGD G  G     GQ G KG++G                IG  G +G  G+ G++G KG++G  GI      G+KG++G+ G  G  GQKG+          G  G  G  G  G+KGD+G+             G  G  G  G+ G  GL G  G+ GLSG      L+G  GP G  G            + G  G+PG  G  GD G  G +G+ G  G  G+ G +G  G  G  G  G  G KG+ G  G +G  G  G +GL GP  +G  GN G  G PG+ G  G  G  G+PG  G  G++G+   G  GP G +G KG
Sbjct:   24 KNIQGPPGDRGLPGEIG------QKGDQGPRGE---SLRGPQGANGTAGPPGPPGQLSNIYIFFFYLALFFLGDRGDTCTECSSFGPPGLPGAPGPKGNQGKVLLRGKK-------------NKTLLHICSTYRKYGRDGPPGLMGAKGAQGEPGDIFLAPNVKGEKGTPGFPGTRGLPGIDGLPGKDGRPGQPGPKGDPARVGIKGDRGEVGDPGLSGPPGERGPPGLPGIGKPGEPGEKGTQGTAGMPGRPGLPGPKGEPGKGVSSPG---PQGPPGPRGESGRPGLQ---GESGTPGDQGLPGFPGDKGDPGLPGIGFPGPPGPKGYSGIPGTPGVPGEPGQPGQDGLPGRPGEPGKKGEPG----IGLRGPKGTIGQPGV-----PGFPGEKGNVGMPGVPGPEGRTGPPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPGPS-TPGPQGEKGSPGFPGIPGPKGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMGAPGSQGYQGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTDVDMEHMKGEKGDSGDRGDPGPTGPTGATGIDGDPGLAGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSIGEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGV---------KGTMGIPGSPGTPGQKGDVGQT------------GYPGSPGVPGEKGVTGLPGSPGDPGLSGRPGEPGLQGPPGPTGQKG------------ESGVDGIPGASGERGDPGVPG-RGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGERGLPGPSMEGPKGNTGPQGEPGEPGQTGVPGPAGVPGSPGAKGERGE--KGFTGPQGAVGLKG 903          

HSP 5 Score: 153.295 bits (386), Expect = 8.941e-37
Identity = 373/1159 (32.18%), Postives = 461/1159 (39.78%), Query Frame = 1
Query:  187 WTGRKNCNTVCTQNTCRCVGI-------PGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQ------------DGLPGDRGES-XXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGL-----AGKMGLSGDKGVKGDKGYIGEPGDFFQA-----KKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGD------KGIRGDVGDQG--------------PIGMSGEPGDQ-PKGIA-QKGEKGFPGPIGDAGTDCKLFV---------------LKGK--TPPDQ--------RGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQP--GSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKG-----------------------------------------DKGNQGIPGY--------QGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGF-NXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLP---------------------GDKGIKGAKGDSREE--TFPSIKGEKGDNGP---DGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGD-------------KGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMM 3156
            W       + C  +    + I       PG +G  G IG  G  GP+G +   G  GA G  G  G  GQ                GDRG++  +    G  G PG  G  G++G V L       G+K    L       K G  G  G+ G KG  GEPGD F A     +KG  GF G  G  G  G  G  G+ G  G +GD      KG RG+VGD G               IG  GEPG++  +G A   G  G PGP G+ G                      L+G+  TP DQ        +GD       G  G  G KG +G PG  G  G+ GQ G  G  G  G PG KG+P  G +G KG  G  GV GF                   G KG VG  G  G       GP GP G KG                                         +KG++G+PGY        QG  G  GF G               +PG +G  GD G  G+ G  G RG+F   +             +  +G  G +G  G  GE+G+ G +G +GERGP G  T   V  +  KGEKG SG  G  G  GP G  G+ G                  + G  GKDG+ G  G PG +GD G PG  G  G+ G  G IG+ G+P                     GD+GIKG KG+       FP + GEKG  G     G+ G KG+KG+ G+ G PG  G  G +G  G  G+P                          G+ GEKG+  + G  G+ G SG                     GEPGLQGP G  G KG+ G                            DG+PG  G+RG  G+ G          +G  G  G SG KGD G  G PG  GI G  G++GE+G  G  G+ G  G+ G  G S E G  GN GP+G  G  G TG PGP G     G KG+ GE G  G +G  G  GDKG    +GE G  G  GPKGE G +G  G  G+             KG+ G  G  G  G  G QG  G KG  G++G +G  G+      DGA G  G  G KGE G++
Sbjct:    2 WYKFCTSPSACVLSLHLLLPIGKNIQGPPGDRGLPGEIGQKGDQGPRGES-LRGPQGANGTAGPPGPPGQLSNIYIFFFYLALFFLGDRGDTCTECSSFGPPGLPGAPGPKGNQGKVLL------RGKKNKTLLHICSTYRKYGRDGPPGLMGAKGAQGEPGDIFLAPNVKGEKGTPGFPGTRGLPGIDGLPGKDGRPGQPGPKGDPARVGIKGDRGEVGDPGLSGPPGERGPPGLPGIGKPGEPGEKGTQGTAGMPGRPGLPGPKGEPGKGVSSPGPQGPPGPRGESGRPGLQGESGTPGDQGLPGFPGDKGDP-GLPGIGFPGPPGPKGYSGIPGTPGVPGEPGQPGQDGLPGRPGEPGKKGEPGIGLRGPKGTIGQPGVPGFP------------------GEKGNVGMPGVPGP--EGRTGPPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPGPSTPGPQGEKGSPGFPG---------------IPGPKGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMGAPGSQGYQGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTD--VDMEHMKGEKGDSGDRGDPGPTGPTGATGIDG------------------DPGLAGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSIGEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGVKGTMGIPGSPGTPGQKGDVGQTGYPGSP--------------------------GVPGEKGVTGLPGSPGDPGLSGR-------------------PGEPGLQGPPGPTGQKGESGV---------------------------DGIPGASGERGDPGVPG----------RGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGERGLPGPSME-GPKGNTGPQGEPGEPGQTGVPGPAGVPGSPGAKGERGEKGFTGPQGAVGLKGDKGFIGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIKGDIGFPGPRGPPGLPGAQGFPGAKGQQGLMGIQGMKGE------DGAPGYNGHPGAKGEPGLI 1008          

HSP 6 Score: 152.91 bits (385), Expect = 1.235e-36
Identity = 316/920 (34.35%), Postives = 392/920 (42.61%), Query Frame = 1
Query: 1501 IKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPG-------------------NDGAIGREGSYGDIGDRGLPGDKG--------------------------IKGAKGDSREETFPSIKGEKGDNGPDG--KEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQG-EKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEEGETGMRGLPGITGDI------GNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFG---------ERGDVGPKGERGIKGEQGINGDKGESGM--IGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGE---PGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGN----TGSKGETGPKGDFGEDGD---------KGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGL 4005
            +KG+ G  G  G +G+ G  G+ G+ G  G+P        GPKG+    G+ G  G+VG  G    L           +   G  G  GEKG  G AG  G PG+ G +G PG                     G  G  G+ GD G  G PGDKG                          + G  G   ++  P   GE G  G  G    GPKG  G PG+ G PG  G++G  GV G EG               T     + V+GERG  G      P       +  +         P      G++GD G PG  GP       G QG KGS G  G  G                 G+PG PG+ GQ G  GE+G+      KGD+G  G   A G  G  G+PG+    G  G +G +GE GE G RG PG   D+      G +G+SG++GD G  GP G  GI G+ G  G  G   + G  G+ G+PGV G  G  G+ G KG     GE G          +G +G  G RG KG++GI G+KGE G+  IG  G  GEKG  G  G  G  G  G +G  G PG  G  G  G  G  G  G  G+ G KG  G  G  G+ GL   G+ GE G  G  G  G KGE G    PG  G +GD G  G G  G  G +G  G +G  G+ G  G  G  G KG  GL G +G +G  GE                        +GPKG +G  GE G  G T  G  GP G  G  G  G  G+KG  G +G  G +G++G IG +G  G+ G  GPKG +G QG  G +GN          T  KGD G  G          +G  G KG +GL      G  G +GE GAPG  G  G +G  GL
Sbjct:  164 VKGEKGTPGFPGTRGLPGIDGLPGKDGRPGQP--------GPKGDPARVGIKGDRGEVGDPG----LSGPPGERGPPGLPGIGKPGEPGEKGTQGTAGMPGRPGLPGPKGEPGKGVSSPGPQGPPGPRGESGRPGLQGESGTPGDQGLPGFPGDKGDPGLPGIGFPGPPGPKGYSGIPGTPGVPGEPGQPGQDGLPGRPGEPGKKGEPGIGLRGPKGTIGQPGVPGFPGEKGNVGMPGVPGPEGR--------------TGPPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPGP----STPGPQGEKGSPGFPGIPGP---------------KGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMG---APGSQGYQGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTDVDMEHMKGEKGDSGDRGDPGPTGPTGATGIDGDPGLAGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSI---GEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGVKGTMGIPGSPGTPGQKGDVGQTGYPGSPGVPGEKGVTGLPGSPGDPGLS--GRPGEPGLQGPPGPTGQKGESGVDGIPGASGERGDPGVPGRGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGE----------------RGLPGPSMEGPKGNTGPQGEPGEPGQT--GVPGPAGVPGSPGAKGERGEKGFTGPQGAVGLKGDKGFIGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIKGDIGFPGPRGPPGLPGAQGFPGAKGQQGL-----MGIQGMKGEDGAPGYNGHPGAKGEPGL 1007          

HSP 7 Score: 126.716 bits (317), Expect = 1.365e-28
Identity = 308/877 (35.12%), Postives = 400/877 (45.61%), Query Frame = 1
Query: 1762 QGEKGKDGLA----GRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDN-----GPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEM-GDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGL------DGEKGDIGNQGMKGDIGDKGRSGA--------------------------------KGDTGAIGNPGIGIKGNEGSRGEEGETGM---RGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG---------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGP---KGNVGVIGDRGETGKP---------GPIGPDGATGPKGINGIKGEQGMMGVKGNNGP-----KGDQGEKGLE-TKGQRGEKGNMGVIGNVGA---KGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-------------LKGES--GPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGN---VGPQGDQGPKGNTGSKGETGPKGDFGEDGD-------------KGNV-GPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG 4047
            QGE G   LA    G  G PG  G RG PG DG  G++G  G  G +G P   GIKG +G+  +       GE+G       G  G+ G KG +G+ G+ G+PG+ G  G+ G              G  G  G +G   +P +QGE G  G++G+    G+KG+ G  G        P   + + G  G  GEPG  G  G  G  G+ G KG  GI  +  +                GVPG PG++G  G+      +G  G  G QG+KG+ G  G  G                                 KGD G  G PG    G +G +G  G  G+   +GLPG  G  G  G  GE+G+     PKG  GI G  G  G  GD  + G +G+ GE GV+G +G  GE G  G  +          +G+ G+RGD GP G  G  G  G  G  G+ GM G  G+ GEKGD G+ G     G  G+ G  GE G P         G IG  G  G KG  GIKGE+G  G+ G   P     KG  G  G     GQ+G KG MG+ G+ G    KG++G+ G  GS G  GE G+ G  G  G  G  G  G+ G++G  G  G  G  G  G+ G  GE+GD G +  RG  G  G  G KG+RG+ G  G  G+ GI G KG  G+              L G S  GP G+ GP G+ G PG  G  G  G+PG  G +G+ GEKG  G +G +G KG+   +G QG+ G  G  G KGE G +G  G  G+             KG++  P        P  QG  G +G+ G    +GI+G +G +G PG  G  G KG+PG
Sbjct:  152 QGEPGDIFLAPNVKGEKGTPGFPGTRGLPGIDGLPGKDGRPGQPGPKGDPARVGIKGDRGEVGDPGLSGPPGERGPPGLPGIGKPGEPGEKGTQGTAGMPGRPGLPGPKGEPG--------KGVSSPGPQGPPGPRGESGRPGLQGESGTPGDQGLPGFPGDKGDPGLPGIGFPGPPGPKGYSGIPGTPGVPGEPGQPGQDGLPGRPGEPGKKGEPGIGLRGPKGTIGQ----------PGVPGFPGEKGNVGMPGVPGPEGRTGPPGPQGVKGERGPPGTHGLAGPPGPPGPGEPGATGPMGPPGPPGPFGRTGEKGDKGLPGYPGPSTPGPQGEKGSPGFPGIPGPKGLPGDPGRPGQDGFPGERGEFCLMSPKGDMGIMGAPGSQGYQGDPGLTGPRGEIGEQGVKGERGEQGERGPPGNMTDVDMEHMKGEKGDSGDRGDPGPTGPTGATGIDGDPGLAGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSIGEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGVKGTMGIPGSPGTPGQKGDVGQTGYPGSPGVPGEKGVTGLPGSPGDPGLSGRPGEPGLQGPPGPTGQKGESGVDGIPGASGERGDPG-VPGRGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGIQGRPGERGLPGPSMEGPKGNTGPQGEPGEPGQTGVPGPAGVPGSPGAKGERGEKGFTGPQGAVGLKGDKGFIGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIKGDIGFPGPRGPPGLPGAQGFPGAKGQQGL---MGIQGMKGEDGAPGYNGHPGAKGEPG 1006          

HSP 8 Score: 83.9593 bits (206), Expect = 1.327e-15
Identity = 196/518 (37.84%), Postives = 242/518 (46.72%), Query Frame = 1
Query:  259 KGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPG--LDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKG--IKGD---------------SGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGL---------------SGLDGKNGKVGPKGM-KGLLGT 1707
            KGD G  G+PGP GP G TG  G+ G       +G +G  GLPG  GE GD G+PG  G PG  G+ G  G++G+PG  G  G KG  G  G  G  GD+G+KG+KG  G PG  F    GEKG  G  G  GE G+KG  G  G+ G  G  G +GDVG  G  G  G PG+       KG  G PG  GD G   +      + PP   G  GE G  G  G +G +G  G PG  L G  G+ G KGD G+ G  GTPG  G PG+KG KG+ G +G+                        +G  GE G  G  +   +G  GP G+ G+ G  G+PG  G  G  G KG  G  G  G  G   L G +G IG +GE G  G +GP+G+ G  G +G +G+ G  G       IKGD                G  G +G++G+ G +G+KGE G       G  G  G KGE GL                GL G  G  GP  M  G L T
Sbjct:  569 KGDSGDRGDPGPTGPTGATGIDGDPGL------AGKDGMPGLPGQPGEKGDPGVPGEPGVPGQPGIKGSIGEMGIPGTGGLKGTKGTIGTPGHRGFKGDEGIKGEKGEHGLPGIGFPGVPGEKGQTGTPGFPGESGQKGVKGTMGIPGSPGTPGQKGDVGQTGYPGSPGVPGE-------KGVTGLPGSPGDPGLSGRPGEPGLQGPPGPTGQKGESGVDGIPGASGERGDPGVPGRGLPGTPGESGHKGDRGHPGLPGTPGIPGIPGTKGEKGLPGYEGI------------------------QGRPGERGLPGPSMEGPKGNTGPQGEPGEPGQTGVPGPAGVPGSPGAKGERGEKGFTGPQGAVGLKGDKGFIGLQGEPGLPGYNGPKGEMGNQGVSGFQGNEGPPGPPGPHTFIKGDIGFPGPRGPPGLPGAQGFPGAKGQQGLMGIQGMKGEDG-----APGYNGHPGAKGEPGLIGPSGPRGYPGPPGPDGLPGPAGSPGPSSMDHGFLVT 1044          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Cavefish
Match: ENSAMXT00000052948.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001200.1:50842:55553:-1 gene:ENSAMXG00000040953.1 transcript:ENSAMXT00000052948.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.929 bits (681), Expect = 1.623e-72
Identity = 261/817 (31.95%), Postives = 322/817 (39.41%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD---IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATE--MGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
             G  GA G RG  G  G  G RG  G +G  G++GA G RG+ G  G                 G RG+ G  G  G  G       G +G +G +G  G +G  G +G  G +G  G  G  G  G  G     G RG  G +G  G  GA G RG +G  G                G +G  G  G  G +G  G++G  G RG  G  T G  G +G  G +G  G  G  G  G  G +G  GT               +G  G +G  G  G  G  G  G RG  G  GA G  G++G     G RG  G +G  G +G          +G  G  G  G  G  G +G+ G  G  G  G  G  G  G  G                     +   G RG  G +G     G  G +G  G       +    T    G RG  G  G  G  G  G +G  G +G+ G  G  G  G  G +G  GT+G  G  G  G RG  G  G  G  G  G +G  G +G  G +G  G  G  G  G  G  G+ G  G  G RG  G  G  G +G  G +G  G  G  G +G  G  G  G  G    +G  G  G  G +G  G  G  G +G    RG +G RG  G +G  G +G  G  G  G  G  G  G  G +G  G  G  G  G  G RG  G  G  G  GA G +G  G +G  G  G  G  G  G +G  G     G RG  G  G  G  GA G  G  G RG+ G  G    G +G  G+ G +G++G  G 
Sbjct:   36 WGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------AWGTRGAWGTRGAWGTRG-----AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG--------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG--TRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---------------RGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW-----------------GTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA--WGTRGAWGTRGAWGTRGAWGT 782          

HSP 2 Score: 265.388 bits (677), Expect = 4.616e-72
Identity = 260/813 (31.98%), Postives = 321/813 (39.48%), Query Frame = 1
Query:  973 GAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD---IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATE--MGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            GA G RG  G  G  G RG  G +G  G++GA G RG+ G  G                 G RG+ G  G  G  G       G +G +G +G  G +G  G +G  G +G  G  G  G  G  G     G RG  G +G  G  GA G RG +G  G                G +G  G  G  G +G  G++G  G RG  G  T G  G +G  G +G  G  G  G  G  G +G  GT               +G  G +G  G  G  G  G  G RG  G  GA G  G++G     G RG  G +G  G +G          +G  G  G  G  G  G +G+ G  G  G  G  G  G  G  G                     +   G RG  G +G     G  G +G  G       +    T    G RG  G  G  G  G  G +G  G +G+ G  G  G  G  G +G  GT+G  G  G  G RG  G  G  G  G  G +G  G +G  G +G  G  G  G  G  G  G+ G  G  G RG  G  G  G +G  G +G  G  G  G +G  G  G  G  G    +G  G  G  G +G  G  G  G +G    RG +G RG  G +G  G +G  G  G  G  G  G  G  G +G  G  G  G  G  G RG  G  G  G  GA G +G  G +G  G  G  G  G  G +G  G     G RG  G  G  G  GA G  G  G RG+ G  G    G +G  G+ G +G++G  G 
Sbjct:   34 GAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------AWGTRGAWGTRGAWGTRG-----AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG--------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG--TRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---------------RGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW-----------------GTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA--WGTRGAWGTRGAWGTRGAWGT 776          

HSP 3 Score: 262.692 bits (670), Expect = 3.596e-71
Identity = 258/810 (31.85%), Postives = 320/810 (39.51%), Query Frame = 1
Query:  982 GDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD---IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATE--MGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G+RG  G  G  G RG  G +G  G++GA G RG+ G  G                 G RG+ G  G  G  G       G +G +G +G  G +G  G +G  G +G  G  G  G  G  G     G RG  G +G  G  GA G RG +G  G                G +G  G  G  G +G  G++G  G RG  G  T G  G +G  G +G  G  G  G  G  G +G  GT               +G  G +G  G  G  G  G  G RG  G  GA G  G++G     G RG  G +G  G +G          +G  G  G  G  G  G +G+ G  G  G  G  G  G  G  G                     +   G RG  G +G     G  G +G  G       +    T    G RG  G  G  G  G  G +G  G +G+ G  G  G  G  G +G  GT+G  G  G  G RG  G  G  G  G  G +G  G +G  G +G  G  G  G  G  G  G+ G  G  G RG  G  G  G +G  G +G  G  G  G +G  G  G  G  G    +G  G  G  G +G  G  G  G +G    RG +G RG  G +G  G +G  G  G  G  G  G  G  G +G  G  G  G  G  G RG  G  G  G  GA G +G  G +G  G  G  G  G  G +G  G     G RG  G  G  G  GA G  G  G RG+ G  G    G +G  G+ G +G++G  G 
Sbjct:   31 GERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------AWGTRGAWGTRGAWGTRG-----AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG--------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG--TRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---------------RGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW-----------------GTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA--WGTRGAWGTRGAWGTRGAWGT 770          

HSP 4 Score: 260.381 bits (664), Expect = 2.297e-70
Identity = 257/807 (31.85%), Postives = 319/807 (39.53%), Query Frame = 1
Query:  991 GQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD---IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATE--MGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G KG+ G  G RG  G +G  G++GA G RG+ G  G                 G RG+ G  G  G  G       G +G +G +G  G +G  G +G  G +G  G  G  G  G  G     G RG  G +G  G  GA G RG +G  G                G +G  G  G  G +G  G++G  G RG  G  T G  G +G  G +G  G  G  G  G  G +G  GT               +G  G +G  G  G  G  G  G RG  G  GA G  G++G     G RG  G +G  G +G          +G  G  G  G  G  G +G+ G  G  G  G  G  G  G  G                     +   G RG  G +G     G  G +G  G       +    T    G RG  G  G  G  G  G +G  G +G+ G  G  G  G  G +G  GT+G  G  G  G RG  G  G  G  G  G +G  G +G  G +G  G  G  G  G  G  G+ G  G  G RG  G  G  G +G  G +G  G  G  G +G  G  G  G  G    +G  G  G  G +G  G  G  G +G    RG +G RG  G +G  G +G  G  G  G  G  G  G  G +G  G  G  G  G  G RG  G  G  G  GA G +G  G +G  G  G  G  G  G +G  G     G RG  G  G  G  GA G  G  G RG+ G  G    G +G  G+ G +G++G  G 
Sbjct:   28 GVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------AWGTRGAWGTRGAWGTRG-----AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG--------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG--TRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---------------RGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW-----------------GTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA--WGTRGAWGTRGAWGTRGAWGT 764          

HSP 5 Score: 120.939 bits (302), Expect = 7.089e-27
Identity = 142/529 (26.84%), Postives = 182/529 (34.40%), Query Frame = 1
Query:  454 LFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGK 2040
             +G RG  G  G  GT G  G  G  G  G  G +G  G +G  G  G +     G +G                       G +G  G RG  G +G  G  G  G +       G +G  G  G  GT    +  +G      RG                       G  GA G RG  G  G  G RG  G +G  G++GA G RG+ G                      RG+ G  G             G +G +G +G  G +G  G +G  G +G                    G RG  G +G  G  GA G RG +                    G +G  G  G  G +G  G++G  G RG  G  T G  G +G  G +G  G  G  G  G  G +G  GT               +G  G +G  G  G  G  G  G RG  G  GA G  G++G  G  G  G  G +GA G          +G  G  G  G  G  G +G+ G  G+
Sbjct:  641 AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW-----GTRG---------------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRG----AWGTRGAWGTRGAWGTR-GAWGTRG--AWGTRGA---------------------WGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---------------------RGAWGTRG-----------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRG------------------AWGTRGAWGTRGAWGTRGAWGTRGAW--------------------GTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG--TRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT---------------RGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG---------TRGAWGTRGAWGTRGAWGTRGAWGTRGR 1019          

HSP 6 Score: 112.849 bits (281), Expect = 1.791e-24
Identity = 73/200 (36.50%), Postives = 90/200 (45.00%), Query Frame = 1
Query: 2794 KGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            KG+KG+ G  G +G  G  G  G +G    RG +G RG  G +G  G +G  G  G  G  G  G  G  G +G  G  G  G  G  G RG  G  G  G  GA G +G  G +G  G  G  G  G  G +G  G     G RG  G  G  G  GA G  G  G RG+ G  G    G +G  G+ G +G++G  G 
Sbjct:   27 KGVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA--WGTRGAWGTRGAWGTRGAWGT 224          

HSP 7 Score: 107.071 bits (266), Expect = 1.330e-22
Identity = 141/479 (29.44%), Postives = 177/479 (36.95%), Query Frame = 1
Query:  454 LFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDR 1890
             +G RG  G  G  GT G  G  G  G  G  G +G  G +G  G  G +     G +G                       G +G  G RG  G +G  G  G  G +       G +G  G  G  GT    +  +G      RG                       G  GA G RG  G  G  G RG  G +G  G++GA G RG+ G  G                 G RG+ G  G  G  G       G +G +G +G  G +G  G +G  G +G  G  G  G  G  G     G RG  G +G  G  GA G RG +G  G                G +G  G  G  G +G  G++G  G RG  G  T G  G +G  G +G  G  G  G  G  G +G  GT      +G  G +G  G +G  G  G  G  G  G RG     G  GA G  G++G  G R
Sbjct:  635 AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW-----GTRG---------------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRG----AWGTRGAWGTRGAWGTR-GAWGTRG--AWGTRGA---------------------WGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------AWGTRGAWGTRGAWGTRG-----AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG--------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWG--TRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAW---GTRGAWGTRGAWGTRGRR 1020          

HSP 8 Score: 85.8853 bits (211), Expect = 3.423e-16
Identity = 56/156 (35.90%), Postives = 71/156 (45.51%), Query Frame = 1
Query: 2926 ERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            ++G+KGE+G  G +G  G     G  G +G  G  G  G  G  G RG  G  G  G  GA G +G  G +G  G  G  G  G  G +G  G     G RG  G  G  G  GA G  G  G RG+ G  G    G +G  G+ G +G++G  G 
Sbjct:   26 QKGVKGERGAWGTRGAWGTR---GAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGA--WGTRGAWGTRGAWGTRGAWGT 176          

HSP 9 Score: 64.6994 bits (156), Expect = 9.135e-10
Identity = 43/118 (36.44%), Postives = 55/118 (46.61%), Query Frame = 1
Query: 3748 KGVKGE---LGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKG 4089
            KGVKGE    G +G  G +G  G +G  G++G  G +G +G  G  G  G  G +G  G   +G  G RG  G  G  G +G  G  G  G  G  G +G  G  G  G  G  G +G
Sbjct:   27 KGVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGT--RGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG 142          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Cavefish
Match: ENSAMXT00000017587.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35732567:35767046:-1 gene:ENSAMXG00000015997.2 transcript:ENSAMXT00000017587.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 1.310e-58
Identity = 139/375 (37.07%), Postives = 189/375 (50.40%), Query Frame = 1
Query: 4273 NGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
             GP GD G  G KG +G +G+ GS G+ G                     +   G+ G  G  G  G  GS G  G P   GPKG  G  G  G SG     G+VGD GS G QG  G  G  G QG  G  G  G       ++   +   +H Q+  + P+CP G  K++EGYS +   G  + +  +LG   SCL  F+ +PF  C+    C    R D+SYWL++ AP+    +  Q + +YISRC  CE+P++  A HSQ  ++    CP  W  LW GYSF+MHT  G  GGGQSL SPGSCL  FR +P +ECN     C  +++  S++L  VD + +  +G   ++E  K       +SRC+VCMK
Sbjct:  772 QGPAGDPGQYGYKGPKGSQGKRGSPGLPGI-------------FLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGR------SIGIGYTLVKHSQS-SQVPMCPQGMAKLWEGYSLLYVEGQEKAHNQDLGLAGSCLPRFSTIPFLYCTTTELCYYASRNDKSYWLSTTAPIPMMPVAKQQITEYISRCSVCEAPSQAVAVHSQDTSIPP--CPSGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECNGARGTCFFFNNKHSFWLTTVDRDRQFVQGP--ESETLKGDQYRTRISRCQVCMK 1122          

HSP 2 Score: 151.369 bits (381), Expect = 3.318e-36
Identity = 237/696 (34.05%), Postives = 301/696 (43.25%), Query Frame = 1
Query: 1486 KTVKGIKGDSGDEGL---QGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGL------------------------------DGKNGKVGPKGMKG---LLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD-IGDRGLPGD---------KGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGK----PGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGV----------KGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            ++V G KG+SG  G+   QGE G +GS G+ G+ G  GRP T        KG+KG  GL                               G+NG+ G KG +G     G A  L  +G +       ++GEKG  G+ G  G PG RGD+G PG+ G  G+ G  GD I  +GLPGD          G  G KG +    FP + G KGDNG  G  G  G  G PG+ G+     GI G  G  G+ G+ G PG  G                   GE G  G  GI  + G+KG  GD G                  G +G PGL G +G  G  GD+G  G                          G PG PG+ G+ GL G  G  G  G++G  G +G  G   + G  G PG+ G+KG  GS        + GLPG +G  G +G+ G  G  G  GP G +G+  ++G PGPVGD            PG+ GL G  G SG  G     G    +GD   +G+ GI G  G  G +GE G  GR G  G  G +G+ G  GN G+ G +G  G PG  G     GPKG  G +G  G+ G+           G+ GP+G  G  GL      G  G  G  G  G KG++G PG  G  G  G  GI   G+ GS G  G  G KG 
Sbjct:  291 RSVSGSKGNSGPRGIPGRQGEVGRTGSPGL-GQNGIPGRPGT--------KGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGIL-------DKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPG-----------------ASGEPGAPGFNGISGLPGQKGLLGDPGR----------------PGFSGLPGLPGTMGLPGYPGDKGRSGES------------------------GRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVT-EGGRTGAPGMDGLKGERGSS-------LPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGD------------PGLPGLDGGQGFSGPPGPPGPAGPGTIQGD---RGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYG---YKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLA-----GSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGI--VGDPGSPGFQGLTGYKGF 880          

HSP 3 Score: 148.673 bits (374), Expect = 2.258e-35
Identity = 297/936 (31.73%), Postives = 377/936 (40.28%), Query Frame = 1
Query: 1492 VKGIKGDSGDEGLQGEKGISGSKG------VKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQG--EKGKDGLAGRDGNPGIRGDRGRPG--------NDGAIGREGSYGDIGDR---------------GLPGDKG-------------------------------------------IKGAKGDSREETFPSIKGEKGDNGP---DGKEGPKGIKGSPGL--NGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVG--VIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQ----------------RGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEG 4002
            V+G+ GD G  G+ G+ G+ G++G      + GE G  G P  GL G  GPKG+ G SGL G+ G  G KG +G  G   +   +G IG++G  G  G    G  G  G+DG PG  G +G PG          G  G+ G  GD G +               G+PG KG                                           +KG +GD       S+ G KG++GP    G++G  G  GSPGL  NG PG  G  G+ G  G  G                 G     + G  G  GE G     G++GE G  G        PL    + D+G+ G PG+ G  G  G +GD+G  GS G  G+ GQPG P            G PG PG++G +G  G KG  G  G  G  G KG +G  G  G  G+PG  G+KG +G       TG+ G PG  G +GN G  G  G  G  G  GF GI G  G+ G +GD    G  G  G PG  GL G+ G+ G  GE    G  G  G+ G  G  G+ G  G+ G KG+ G+ G T E G  G  G++G KG  G  + G  G +G  G  G DG  G  G  G  G +G+    G  GP GD G  GL+                    +G++G+ G+ G  G  G+ GEPG  G  G  G  G  G KG+ G++G  G +G  G                           D G+ G                       GPKG  G  G  GL GI L  E                              Q   GD G +G  G  G  G  G  G  G  GPKG  GS G+ G  G  G  G  G+ G  G +GL+           G  G PGK G+ G  GL G
Sbjct:   70 VQGLPGDPGINGIPGQPGLPGARGQTLPCIITGEVGSPGFP--GLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR----SVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGF--TGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGP-----APPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKG-----LPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGD-----ATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVT-EGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAG---------------------------DPGQYG---------------------YKGPKGSQGKRGSPGLPGIFLPPED----------------------------VQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLT-----------GYKGFPGKQGLPGRPGLPG 894          

HSP 4 Score: 137.502 bits (345), Expect = 5.186e-32
Identity = 246/706 (34.84%), Postives = 303/706 (42.92%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGNVGNRGTPGP-----KGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSG----KCIGNIQGPQGPFGDKG--DKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDG---KEGPKGIKGSPGLNGKPGISGDMGKMGVKG-DEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNG 3033
            G  G  G RG  G  G VG  G+PG       G+PG+KG KG  G  G  G  G  G  G+ G +G  G  G +G  GE G +G    +      GP  P   +G  DKG +GIPG  G  G                      PG+RGD G  G  G  G  G  GD                    KG+ GD G  G QG  G SG KG  G  G  G P        GPKG+ G+ GL G  G  G  G+KG  G A  +            G  G KG  G AG  G PG  G+ G PG +G  G  G  G +GD G PG  G+ G  G      +P  KG  G++G  G   + G KG+ GSPGL+G  G+ G  G+ GV G  EG        G  G  G KG     + G  G  G KG++  DG  G+ G  G               G RG     G+ GP+G  G+ G  G +G  G  G  G  G    +G +G  G  G  G PGKRG+ G  G  G  GN G KG  GD G SG  G  G  G+PG  G KG +GS+G+ G  G+ G+     D+        Q   G+FGP+GF G        GP       G+ G +G+PG  G  G  G+ G  G+          G  GP G  GI G+ G  G +G +G  G  G+ G  G  GL G
Sbjct:  295 GSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPG---------------------FPGQRGDKGFPGSPGRPGQPGQPGD----------------PIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMP--------GPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGI-----------PGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGG-----RTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQG-------------PPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDV--------QIPNGDFGPEGFSG--------GP-------GLAGSAGQPGSPGFPGPKGKIGSPGK---------PGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPG 894          

HSP 5 Score: 137.117 bits (344), Expect = 8.003e-32
Identity = 317/902 (35.14%), Postives = 400/902 (44.35%), Query Frame = 1
Query: 1525 GLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPG--DKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKM------------------GVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKG-----------DQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGD--------IGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLP-GITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKG----FTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVG-PQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGI 4056
            GL GE GI G  GV G +G  G P   G+ G  G  G +G +      G+VG  G  GL G                 G +G+ G  GL+GR G  G++G+RG PG  G  G +G  G  GD GLPG    G  GA G      FP  KGE G       E      G+ G  G+PG+ GD G+                   G+KG +G+                   + PV+G  G  G  G +   G KGE+GD G           +   G+ G  G PG QG +G+ G  G            +G KG  G+ G  G PG+PG+ G+ G KG  G+PG  G+ G++G  G KGD G  G  G         I DKG  G  G TG  G PG  G KG  GS G  G+ G  G P    G  G+ G  G QG  G  G KG  G+ G  G PGP GD  + G+ G  G PG  G+KG     TG  G  G     G  G  G  G  GE G  G  GI+G  G+ G++G  G  G  G  GL G  G  G  GD+G +G+    G  G  G  G  G+ G  G+ G+ G  GPKG QG  G+   G+ G  G  G+ G  G+    G PG  G+KG  G+ G+          G +G   S+G  G  G  G+ G  G  G  GP GP G  G    +GD G+ G  G  G  G  G+ G  G  G  G  G  G+ G+ G SGI   G  GP GD G                    G +G +G  G++G+ G+ G   P  +V  P GD GP+G +G  G  G     G+ G  G  GPKG  G  G P + G +G+ G +G PG  G +G  G +G PGK G  G  G PG  I
Sbjct:   55 GLAGEPGI-GYAGVPGVQGLPGDPGINGIPGQPGLPGARGQTLPCIITGEVGSPGFPGLPGVP---------------GPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPG-------EALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGD-AGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSV--------SGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGE---SGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSS-LPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGI--PGPQGPAGDPG------------------QYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAG---SAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSI 897          

HSP 6 Score: 109.383 bits (272), Expect = 2.172e-23
Identity = 194/571 (33.98%), Postives = 250/571 (43.78%), Query Frame = 1
Query: 2488 LDGEKGDIGNQ--GMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITG------------------DIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGI--KGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGES-GMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEK-GLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNE--GDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDG-DKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGD------KGKPGN-GIEGPDGDIGNKGR 4092
            L GE+GD G    G KG+ G +G  G +G+ G  G+PG+G  G  G  G +G+ G  GL G TG                    G +G  GE G  G       KG +G  G+PGP      +GI  KG+ G PG+ G+ GF G+               RGD G  G  G  G+ G  GD  ++ G+ G  G  G +G  G +G KG  GV+G              G  GPKG NG+ G  G+ G  G  G KG +G+  G+    G +G  GN G  G  GA GE G PG  G  G  G+ G+ G  G  G +G  G  G  G+ G  G                     D G  G  G+ G  G  G+KG  G+ G DG  GL G  G++G+ G+T  G +G  G +G                  L G +G+   G  G  G KGV+G+ G  G  G QG  GP+G   S G  GP GD G  G D G                   G+RG+ G PG  G  G++G  G PG+ G  G+      KG PGN GI GP G  G+ G+
Sbjct:  282 LKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGT------KGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQ---------------RGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGF------------PGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPG---------------------DKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDG------------------LKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQ 780          

HSP 7 Score: 58.9214 bits (141), Expect = 6.089e-8
Identity = 125/350 (35.71%), Postives = 154/350 (44.00%), Query Frame = 1
Query: 2458 GIPGKRGQSGLDGEKGDIGNQ--------------GMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGE---QGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEK--GDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE--------------------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G PG RG SG  G+ G  G                G+ GD G  G  G KG  G  G PGIG  G  G +G  G+ G+ G+PG  G  G +G++      G++G+ G  G  G+ G  G+PGP          G SG PG  G+KG  G  G  G+   +G  G+RGD G  G     G  G  G  G  G  GR GE GE      G  G  G  G+ GD+G+ G PG  G  G  G  G+ G+KG QG  G  G  GP G  G                          KG+RG+ G   V G+ G  G  G PG +G  G  G  G+GQ G  G  G   +KGQKG 
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGFGLPGDRGFPGFPGGKGRPGLAGEPGIGYAGVPGVQGLPGDPGINGIPGQPGLPGARGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGP---------SGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTS-PGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRS-VSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPG---TKGQKGF 337          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Cavefish
Match: ENSAMXT00000054929.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35732567:35767046:-1 gene:ENSAMXG00000015997.2 transcript:ENSAMXT00000054929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 1.822e-58
Identity = 139/375 (37.07%), Postives = 189/375 (50.40%), Query Frame = 1
Query: 4273 NGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
             GP GD G  G KG +G +G+ GS G+ G                     +   G+ G  G  G  G  GS G  G P   GPKG  G  G  G SG     G+VGD GS G QG  G  G  G QG  G  G  G       ++   +   +H Q+  + P+CP G  K++EGYS +   G  + +  +LG   SCL  F+ +PF  C+    C    R D+SYWL++ AP+    +  Q + +YISRC  CE+P++  A HSQ  ++    CP  W  LW GYSF+MHT  G  GGGQSL SPGSCL  FR +P +ECN     C  +++  S++L  VD + +  +G   ++E  K       +SRC+VCMK
Sbjct:  789 QGPAGDPGQYGYKGPKGSQGKRGSPGLPGI-------------FLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGR------SIGIGYTLVKHSQS-SQVPMCPQGMAKLWEGYSLLYVEGQEKAHNQDLGLAGSCLPRFSTIPFLYCTTTELCYYASRNDKSYWLSTTAPIPMMPVAKQQITEYISRCSVCEAPSQAVAVHSQDTSIPP--CPSGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECNGARGTCFFFNNKHSFWLTTVDRDRQFVQGP--ESETLKGDQYRTRISRCQVCMK 1139          

HSP 2 Score: 150.984 bits (380), Expect = 3.991e-36
Identity = 236/688 (34.30%), Postives = 301/688 (43.75%), Query Frame = 1
Query: 1486 KTVKGIKGDSGDEGL---QGEKGISGSKGVKGERGPSGRPTT-------GLVGPKGP------------------KGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD-IGDRGLPGD---------KGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGK----PGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGV----------KGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            ++V G KG+SG  G+   QGE G +GS G+ G+ G  GRP T       GL+G  G                    G +G  G +G+ G  G +G  G  G A  L  +G +       ++GEKG  G+ G  G PG RGD+G PG+ G  G+ G  GD I  +GLPGD          G  G KG +    FP + G KGDNG  G  G  G  G PG+ G+     GI G  G  G+ G+ G PG  G                   GE G  G  GI  + G+KG  GD G                  G +G PGL G +G  G  GD+G  G                          G PG PG+ G+ GL G  G  G  G++G  G +G  G   + G  G PG+ G+KG  GS        + GLPG +G  G +G+ G  G  G  GP G +G+  ++G PGPVGD            PG+ GL G  G SG  G     G    +GD   +G+ GI G  G  G +GE G  GR G  G  G +G+ G  GN G+ G +G  G PG  G     GPKG  G +G  G+ G+           G+ GP+G  G  GL      G  G  G  G  G KG++G PG  G  G  G  GI   G+ GS G  G  G KG 
Sbjct:  308 RSVSGSKGNSGPRGIPGRQGEVGRTGSPGL-GQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGIL-------DKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPG-----------------ASGEPGAPGFNGISGLPGQKGLLGDPGR----------------PGFSGLPGLPGTMGLPGYPGDKGRSGES------------------------GRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVT-EGGRTGAPGMDGLKGERGSS-------LPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGD------------PGLPGLDGGQGFSGPPGPPGPAGPGTIQGD---RGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYG---YKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLA-----GSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGI--VGDPGSPGFQGLTGYKGF 897          

HSP 3 Score: 141.739 bits (356), Expect = 2.714e-33
Identity = 297/953 (31.16%), Postives = 377/953 (39.56%), Query Frame = 1
Query: 1492 VKGIKGDSGDEGLQGEKGISGSKG-----------------------VKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQG--EKGKDGLAGRDGNPGIRGDRGRPG--------NDGAIGREGSYGDIGDR---------------GLPGDKG-------------------------------------------IKGAKGDSREETFPSIKGEKGDNGP---DGKEGPKGIKGSPGL--NGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVG--VIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQ----------------RGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEG 4002
            V+G+ GD G  G+ G+ G+ G++G                       + GE G  G P  GL G  GPKG+ G SGL G+ G  G KG +G  G   +   +G IG++G  G  G    G  G  G+DG PG  G +G PG          G  G+ G  GD G +               G+PG KG                                           +KG +GD       S+ G KG++GP    G++G  G  GSPGL  NG PG  G  G+ G  G  G                 G     + G  G  GE G     G++GE G  G        PL    + D+G+ G PG+ G  G  G +GD+G  GS G  G+ GQPG P            G PG PG++G +G  G KG  G  G  G  G KG +G  G  G  G+PG  G+KG +G       TG+ G PG  G +GN G  G  G  G  G  GF GI G  G+ G +GD    G  G  G PG  GL G+ G+ G  GE    G  G  G+ G  G  G+ G  G+ G KG+ G+ G T E G  G  G++G KG  G  + G  G +G  G  G DG  G  G  G  G +G+    G  GP GD G  GL+                    +G++G+ G+ G  G  G+ GEPG  G  G  G  G  G KG+ G++G  G +G  G                           D G+ G                       GPKG  G  G  GL GI L  E                              Q   GD G +G  G  G  G  G  G  G  GPKG  GS G+ G  G  G  G  G+ G  G +GL+           G  G PGK G+ G  GL G
Sbjct:   70 VQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASIGEGGQTLPCIITGEVGSPGFP--GLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR----SVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGF--TGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGP-----APPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKG-----LPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGD-----ATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVT-EGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAG---------------------------DPGQYG---------------------YKGPKGSQGKRGSPGLPGIFLPPED----------------------------VQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLT-----------GYKGFPGKQGLPGRPGLPG 911          

HSP 4 Score: 137.502 bits (345), Expect = 5.948e-32
Identity = 246/706 (34.84%), Postives = 303/706 (42.92%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGNVGNRGTPGP-----KGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSG----KCIGNIQGPQGPFGDKG--DKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDG---KEGPKGIKGSPGLNGKPGISGDMGKMGVKG-DEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG-IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNG 3033
            G  G  G RG  G  G VG  G+PG       G+PG+KG KG  G  G  G  G  G  G+ G +G  G  G +G  GE G +G    +      GP  P   +G  DKG +GIPG  G  G                      PG+RGD G  G  G  G  G  GD                    KG+ GD G  G QG  G SG KG  G  G  G P        GPKG+ G+ GL G  G  G  G+KG  G A  +            G  G KG  G AG  G PG  G+ G PG +G  G  G  G +GD G PG  G+ G  G      +P  KG  G++G  G   + G KG+ GSPGL+G  G+ G  G+ GV G  EG        G  G  G KG     + G  G  G KG++  DG  G+ G  G               G RG     G+ GP+G  G+ G  G +G  G  G  G  G    +G +G  G  G  G PGKRG+ G  G  G  GN G KG  GD G SG  G  G  G+PG  G KG +GS+G+ G  G+ G+     D+        Q   G+FGP+GF G        GP       G+ G +G+PG  G  G  G+ G  G+          G  GP G  GI G+ G  G +G +G  G  G+ G  G  GL G
Sbjct:  312 GSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPG---------------------FPGQRGDKGFPGSPGRPGQPGQPGD----------------PIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMP--------GPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGI-----------PGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGG-----RTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQG-------------PPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDV--------QIPNGDFGPEGFSG--------GP-------GLAGSAGQPGSPGFPGPKGKIGSPGK---------PGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPG 911          

HSP 5 Score: 134.42 bits (337), Expect = 5.154e-31
Identity = 316/913 (34.61%), Postives = 402/913 (44.03%), Query Frame = 1
Query: 1492 VKGIKGDSGDEGLQGEKGISGSKGVKGER-GPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPG--DKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKM------------------GVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKG-----------DQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGD--------IGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLP-GITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKG----FTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----------GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVG-PQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGI 4056
            V G++G  GD G+ G  G  G  G +GE  G +G     +       GE G +      G+VG  G  GL G                 G +G+ G  GL+GR G  G++G+RG PG  G  G +G  G  GD GLPG    G  GA G      FP  KGE G       E      G+ G  G+PG+ GD G+                   G+KG +G+                   + PV+G  G  G  G +   G KGE+GD G           +   G+ G  G PG QG +G+ G  G            +G KG  G+ G  G PG+PG+ G+ G KG  G+PG  G+ G++G  G KGD G  G  G         I DKG  G  G TG  G PG  G KG  GS G  G+ G  G P    G  G+ G  G QG  G  G KG  G+ G  G PGP GD  + G+ G  G PG  G+KG     TG  G  G     G  G  G  G  GE G  G  GI+G  G+ G++G  G  G  G  GL G  G  G  GD+G +G+    G  G  G  G  G+ G  G+ G+ G  GPKG QG  G+   G+ G  G  G+ G  G+    G PG  G+KG  G+ G+          G +G   S+G  G  G  G+ G  G  G  GP GP G  G    +GD G+ G  G  G  G  G+ G  G  G  G  G  G+ G+ G SGI   G  GP GD G                    G +G +G  G++G+ G+ G   P  +V  P GD GP+G +G  G  G     G+ G  G  GPKG  G  G P + G +G+ G +G PG  G +G  G +G PGK G  G  G PG  I
Sbjct:   67 VPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASI-------GEGGQTLPCIITGEVGSPGFPGLPGVP---------------GPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPG-------EALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGD-AGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSV--------SGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGE---SGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSS-LPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGI--PGPQGPAGDPG------------------QYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAG---SAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSI 914          

HSP 6 Score: 108.997 bits (271), Expect = 2.905e-23
Identity = 194/571 (33.98%), Postives = 250/571 (43.78%), Query Frame = 1
Query: 2488 LDGEKGDIGNQ--GMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITG------------------DIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGI--KGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGES-GMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEK-GLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNE--GDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDG-DKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGD------KGKPGN-GIEGPDGDIGNKGR 4092
            L GE+GD G    G KG+ G +G  G +G+ G  G+PG+G  G  G  G +G+ G  GL G TG                    G +G  GE G  G       KG +G  G+PGP      +GI  KG+ G PG+ G+ GF G+               RGD G  G  G  G+ G  GD  ++ G+ G  G  G +G  G +G KG  GV+G              G  GPKG NG+ G  G+ G  G  G KG +G+  G+    G +G  GN G  G  GA GE G PG  G  G  G+ G+ G  G  G +G  G  G  G+ G  G                     D G  G  G+ G  G  G+KG  G+ G DG  GL G  G++G+ G+T  G +G  G +G                  L G +G+   G  G  G KGV+G+ G  G  G QG  GP+G   S G  GP GD G  G D G                   G+RG+ G PG  G  G++G  G PG+ G  G+      KG PGN GI GP G  G+ G+
Sbjct:  299 LKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGT------KGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQ---------------RGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGF------------PGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPG---------------------DKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDG------------------LKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQ 797          

HSP 7 Score: 55.4546 bits (132), Expect = 6.785e-7
Identity = 128/367 (34.88%), Postives = 155/367 (42.23%), Query Frame = 1
Query: 2458 GIPGKRGQSGLDGEKGDIGNQ--------------GMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQ--------------------GDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEK--GDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE--------------------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            G PG RG SG  G+ G  G                G+ GD G  G  G KG  G  G PGIG  G  G +G  G+ G+ G+PG  G  G +GES  Q                    G++G+ G  G  G+ G  G+PGP          G SG PG  G+KG  G  G  G+   +G  G+RGD G  G     G  G  G  G  G  GR GE GE      G  G  G  G+ GD+G+ G PG  G  G  G  G+ G+KG QG  G  G  GP G  G                          KG+RG+ G   V G+ G  G  G PG +G  G  G  G+GQ G  G  G   +KGQKG 
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGFGLPGDRGFPGFPGGKGRPGLAGEPGIGYAGVPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASIGEGGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGP---------SGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTS-PGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRS-VSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPG---TKGQKGF 354          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Cavefish
Match: col4a3 (collagen, type IV, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070802-4])

HSP 1 Score: 222.631 bits (566), Expect = 4.040e-58
Identity = 126/323 (39.01%), Postives = 166/323 (51.39%), Query Frame = 1
Query: 4435 GNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQN--VEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKK 5394
            G  G  G  G  GK G +G  G P  RG  G +G  GL G  G + G  G KG  GP G R                           +  +FLFTRH Q R+  P CP GS  I  GYS +  NGN++ +  +LGT  SCL  F+ MPF  C+ D +C    R D SYWL++  P++ D   +    +++YISRC  CE+ +   A HSQT ++ D  CP  W  LW GYSFVM T  G  G GQ LSSPGSCL  F+  P +EC +G   C+ + D+ SY+L  +D      K      +DD  + +   +SRC+VCMK+K
Sbjct: 1004 GPHGLEGRKGQKGKSGREGMPGPPGNRGYNGDRGLTGLQGAPGFD-GPPGQKGRRGPAGNR---------------------------VNDSFLFTRHSQ-RQNVPQCPSGSQLIHSGYSLLFINGNNQGHGQDLGTLGSCLQRFSTMPFLFCNSDSTCHYASRNDYSYWLSTEVPMSKDAPPISEGFIQQYISRCSVCEAQSNVIAVHSQTISVPD--CPSGWEPLWQGYSFVMQTGVGAEGSGQPLSSPGSCLENFQKVPFIEC-HGRGTCSFYTDSYSYWLAALDPTLMFSKPNPKTLKDDCQQRI---ISRCRVCMKQK 1291          

HSP 2 Score: 140.198 bits (352), Expect = 1.040e-32
Identity = 249/773 (32.21%), Postives = 322/773 (41.66%), Query Frame = 1
Query: 1495 KGIKGDSGD-----EGLQGEKGISGSKGVKGERGPSGRPTTG-LVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXX--XXNQGEKGKDGLAGRDGNPGIRGDRGRP---------GNDGAIGREGSYGDIG---------DRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMG-----------------------KMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI-----PGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGL--------------------PGITGDIGNQGES------------GEQGDIGN-----------------------FGPKGFKGIKGNTGKPGPVGDKTIKGIK------------GDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPK---------GERGIKGEQGINGDKGESGMIGRTGENGEKGD---------------QGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKG 3378
            +G+KGD G+     EG QG  G+ G  G  G+ G  GRP      GP+G KGEKG  G  G  G  G +G  G +   C+LC   +         G+ G++G  G  GR G+PG  G++G           GN GA G +G  GD G         D G PG KG  G  G + +   P +KG  G+ G  G  G KG +G PGLNG  G  G MG                       +MG +GD+G                +   A P  GERG  G KG +   G  G  G SGN       P    ++G +G  G+    GP G  G KGD+G +G                          GVPGI     PG  G  G+ GEKG+IG  G  G +G +G  G  G  G IGN   G  G  GSRG++G  G  G                     PG TG  G  GE+            GE GD G                        FGP G KG KG  G PGP G +  +G              G +G PG +G +G  G +G++G    +G+ G  G +GP          G  G  G  G +GDKG  GM G  G +G+ G+                G  G +G  G+ G  G+ G PGP       GPKGI G +G  G  G+ G++GPKGD+G+  L   G  G          +G KGE G PG++G KG+ G   +G  G  G++G +G+KG
Sbjct:   24 RGLKGDKGEQGPNTEGPQGRIGLPGHPGFVGDPGLPGRPEYFERFGPQGRKGEKGRPGPKGTKGSYGEQGEPGDI---CRLCYLSEEKPGPRGIPGDPGQQGPPGNDGRQGDPGPPGNKGLLGLPGLSGSYGNPGAPGCQGPKGDRGFMSGCGQKGDPGDPGPKGNPGRTGRTGDPGDPGVKGPMGEKGNPGSLGGKGDQGFPGLNGLAGRVGPMGGQGFPGVGLPGPPGAKGDFGCEGQMGRQGDQGE-------------KGEPGTAYPTPGERGPPGIKGQRGQRGPSGIPGASGN-------PGPQGQLGPKGQKGQSYDGGP-GFPGYKGDKGLQGRP------------------------GVPGIGKVGRPGPSGAPGMPGEKGNIGF-GPPGAMGRQGVPGCDGTLGPIGN--SGWPGCTGSRGQQGRDGAPGSQGGPGPDGPPGLIGPPGVCSPGCTGSKGPMGENGRPGFPGPPGCKGEPGDPGQHGSGVLGPSGPVGKPGPKGGSGAFGPIGSKGFKGRDGMPGPQGPQGNQGPPGRSGPPGRPGSCGIAGCPGDKGNRGIDGPTGNRGLPGPKGDPGAPGFIGPSVIVANPGDPGNSGDLGPPGFHGDKGNKGMPGLPGNSGKNGNPGCAGQPGPPGDPGTNGCPGVRGQPGIEGSMGDMGVPGP------DGPKGITGARGVPGADGIPGDDGPKGDKGDPSLPGPGDPGR---------LGDKGEPGTPGIKGRKGERGL--MGSPGCPGADGPYGAKG 728          

HSP 3 Score: 133.65 bits (335), Expect = 1.038e-30
Identity = 376/1124 (33.45%), Postives = 466/1124 (41.46%), Query Frame = 1
Query:  193 GRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDK------GVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKL-------------------FVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNI--QGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSK---------GVKGERGPSGRPTTGLVGPKGPK------------GEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDG------KEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGV------------------------PGIPGKRGQSGLDGEKGD-----------IGNQGMKGDIGDKGR---------------SGAKGDTGAIGNPGI-GIKGNEGSRG--EEGETGMRGLPG-----------ITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERG---------IKGEQGI------------NGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQ 3147
            G +  NT   Q      G PG  GD G  G P      G  G  GE G  G  G  GS G+ G PGD                         G  G+PG  G  G  GNDG  G  G  G+K      G+ G  G  G PG   Q  KG++GF    G  G+ G+ G  G  G  G  GD    GD G +GP+G  G PG     +  KG++GFPG  G AG    +                   F  +G+    ++GD GEKGE G    T  +      G  G  G RGQ+G +G  G  G PGP+GQ G KG KG +  DG  GF                G +G KG  G  G  G  IG +   GP G  G  G+KGN G  G  G +G +G                  +PG  G +G  G +G  G  G RG  G +G  G +G  G +G             G  G KG  G           G KGE G  G+  +G++GP GP             G  G  G  G++G  GP+G +G  G   +    G  G  GI G  G+KG  G+ G  GN G+ G +G PG  G IG      + GD G  GD G  G  GD   +  P + G  G NG  G        G  G  G PG+ G+PGI G MG MGV G +G                     K + G RG+ G  GI   DG KG+KGD      +   P +   +GD+G+ G PG++G  G+ G+ G  G  G+DG  G KG  G PG  G+ G  G  G+                        PG  G+RG+ G DG  G             G  G  G  G+KGR                GA GD G+ G PG  GI+GN G++G   +G  G RG PG                   G+ G++GD G  G  G  G  GN+G PGP G   I G  G  GE G +GL G  GE GD G   GRG  G  G  G  GERG         I G+QG+             G  G  G+ GR G+ G+ G +G+ GP GN G  GDRG TG  G  G DG  G KG  G  G +
Sbjct:   31 GEQGPNTEGPQGRIGLPGHPGFVGDPGLPGRPEYFERFGPQGRKGEKGRPGPKGTKGSYGEQGEPGDICRLCYLSEEKP-------------GPRGIPGDPGQQGPPGNDGRQGDPGPPGNKGLLGLPGLSGSYGNPGAPG--CQGPKGDRGFMSGCGQKGDPGDPGPKGNPGRTGRTGDP---GDPGVKGPMGEKGNPGS----LGGKGDQGFPGLNGLAGRVGPMGGQGFPGVGLPGPPGAKGDFGCEGQM--GRQGDQGEKGEPGTAYPTPGER-----GPPGIKGQRGQRGPSGIPGASGNPGPQGQLGPKGQKG-QSYDGGPGF---------------PGYKGDKGLQGRPGVPG--IGKVGRPGPSGAPGMPGEKGNIGF-GPPGAMGRQG------------------VPGCDGTLGPIGNSGWPGCTGSRGQQGRDGAPGSQGGPGPDGPPGLIGPPGVCSPGCTGSKGPMGENGRPGFPGPPGCKGEPGDPGQHGSGVLGPSGPVGKPGPKGGSGAFGPIGSKGFKGRDGMPGPQGPQGNQGPPGRSGPPGRPGSCGIAGCPGDKGNRGIDGPTGNRGLPGPKGDPGAPGFIGPSVIVANPGDPGNSGDLGPPGFHGDKGNKGMPGLPGNSGKNGNPGCAGQPGPPGDPGTNGCPGVRGQPGIEGSMGDMGVPGPDG--------------------PKGITGARGVPGADGIPGDDGPKGDKGDP-----SLPGPGDPGRLGDKGEPGTPGIKGRKGERGLMGSPGCPGADGPYGAKGDIGPPGTPGLPGVAGERGLDGNPGPQGFPGPPGPPGCLGSPGNPGPAGQRGEIGRDGIPGPPGPKGEKGVPGYGQSGAPGVKGEKGRKGDPGLQGPPGPPGWCGAVGDPGSSGPPGPQGIRGNPGAKGLCVDGPKGERGFPGQPGRPGCLGPPGPPGPPGPGQKGDKGDPGPLGQTGPSGSTGNSGPPGPPGRDGINGYPGSKGEMGPKGLPGPQGEPGDCGNNGGRGLQGPNGPPGGPGERGRDAYSRRTPIPGDQGLPGGPGNRGMGGDYGPPGPHGLEGRKGQKGKSGREGMPGPPGNRGYNGDRGLTGLQGAPGFDGPPGQKGRRGPAGNR 1063          

HSP 4 Score: 118.242 bits (295), Expect = 5.674e-26
Identity = 176/521 (33.78%), Postives = 237/521 (45.49%), Query Frame = 1
Query: 1894 LPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPK---GIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGL---DGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQG-----------ESGEQGDIGNFGPKGFKGIKGNTGKPGPV----GDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQ-------KGESGSNGEFGS 3372
            +PGD G +G  G         +KG+KG+ GP+  EGP+   G+ G PG  G PG+ G        G +G                        +GE+G  G KG K   GE+GE GD   C + +   L+  + G RG  G+PG QGP G  G +GD G  G+ G+ G  G  G  GN          G PG  G +G  G     G+KGD G+ G KG+ G  GR+G  GD G  G   +G KGN GS G +G+ G  GL G+ G +G  G             G +GD G  G  G +G +G  G+PG      G++   GIKG  G+ G  G+ G +G  G +G+   +G+ G+  D GP G  G KG++G+ G  G  G IG+ G  G  G  G+ G KGN+G              GP GA G +G+ G  G  G +G  G  G  G +G++G +                +     +  PG  GSKG  GE G          KGE G  G+ GS
Sbjct:   11 IPGDPGSQGPPGGR------GLKGDKGEQGPN-TEGPQGRIGLPGHPGFVGDPGLPGRPEYFERFGPQGR-----------------------KGEKGRPGPKGTKGSYGEQGEPGDI--CRLCY---LSEEKPGPRGIPGDPGQQGPPGNDGRQGDPGPPGNKGLLGLPGLSGSYGN---------PGAPGCQGPKGDRGFMSGCGQKGDPGDPGPKGNPGRTGRTGDPGDPGVKGP--MGEKGNPGSLGGKGDQGFPGLNGLAGRVGPMGGQGFPGVGLPGPPGAKGDFGCEGQMGRQGDQGEKGEPGTAYPTPGERGPPGIKGQRGQRGPSGIPGASGNPGPQGQLGPKGQKGQSYDGGP-GFPGYKGDKGLQGRPGVPG-IGKVGRPGPSGAPGMPGEKGNIG-------------FGPPGAMGRQGVPGCDGTLGPIGNSGWPGCTGSRGQQGRDGAPGSQGGPGPDGPPGLIGPPGVCSPGCTGSKGPMGENGRPGFPGPPGCKGEPGDPGQHGS 470          

HSP 5 Score: 112.849 bits (281), Expect = 2.035e-24
Identity = 330/999 (33.03%), Postives = 401/999 (40.14%), Query Frame = 1
Query:  523 GLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQP------------GSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSK-GVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI------KGIKGDSGEPGVQGLKGFTGESGDKGECS--GRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRG---------------------ETGKPGPIGPDGATGPKGINGIKGEQGMMGVK--GNNGPKGDQGEKGLETKGQRGEKGN----MGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGE 3363
            G  G  G  G +G+KGDKG  G   +  Q + G  G  G  G  G  G   +  + G  G +G+KG  G  G +G  G  GEPGD                       C+L  L                               +PG  G  GD GQ+G  GN G +G PGP G              G+ GA G +G  G  GF                   G KG+ G+            GP+G  G  G  G+ G PG +G +GEKG                   PG  G  GD+G  G +G  G  G  G  G  G         K   G +G  G +G QGEKG  G+     GERGP G    G  G +GP G  G SG  G  G++GPKG KG                 G  G  G KG  GL GR G PGI G  GRPG  GA G  G  G+IG  G PG  G +G  G                   DG  GP G  G PG  G  G  G  G  G +G  G  G  GL G  G        +K   GE G  G  G     GE G+ G  G+  +    P+                 GPIG  G KG  G  G  G  G +G PG+ G  G  G+ G  G    PG +G  G+DG     GN+G+ G  GD G  G  G +  + NPG     G  G  G  G++G  GM GLPG +G  GN G +G+ G  G+ G  G  G++G  G  G +GD  +      KGI G  G PG  G+ G  G  GDKG+ S  G G+ G  GD G  G  GIKG +G  G  G  G  G  G  G KGD G  G  G  GV G+RG                       G PGP G  G  G  GI G  G +G  GV   G +G  G +GEKG +               G +G+ G+ G  G  G+RG+ G  G    G KGE G  G+
Sbjct:   13 GDPGSQGPPGGRGLKGDKGEQGPNTEGPQGRIGLPGHPGFVGDPGLPGRPEYFERFGPQGRKGEKGRPGPKGTKGSYGEQGEPGDI----------------------CRLCYLS----------------------------EEKPGPRGIPGDPGQQGPPGNDGRQGDPGPPGNKGLLGLPGLSGSYGNPGAPGCQGPKGDRGFMSGC---------------GQKGDPGDP-----------GPKGNPGRTGRTGDPGDPGVKGPMGEKGN------------------PGSLGGKGDQGFPGLNGLAGRVGPMGGQGFPGVGLPGPPGAKGDFGCEGQMGRQGDQGEKGEPGTAYPTPGERGPPG--IKGQRGQRGPSGIPGASGNPGPQGQLGPKGQKG-------------QSYDGGPGFPGYKGDKGLQGRPGVPGI-GKVGRPGPSGAPGMPGEKGNIG-FGPPGAMGRQGVPGC------------------DGTLGPIGNSGWPGCTGSRGQQGRDGAPGSQGGPGPDGPPGLIGPPGVCSPGCTGSKGPMGENGRPGFPGPPGCKGEPGDPGQHGSGVLGPSGPVGKPGPKGGSGA-----FGPIGSKGFKGRDGMPGPQGPQGNQGPPGRSGPPGRPGSCGIAGC---PGDKGNRGIDGP---TGNRGLPGPKGDPGAPGFIGPSVIVANPGDPGNSGDLGPPGFHGDKGNKGMPGLPGNSGKNGNPGCAGQPGPPGDPGTNGCPGVRGQPGIEGSMGDMGVPGPDGPKGITGARGVPGADGIPGDDGPKGDKGDPSLPGPGDPGRLGDKGEPGTPGIKGRKGERGLMGSPGCPGADGPYGAKGDIGPPGTPGLPGVAGERGLDGNPGPQGFPGPPGPPGCLGSPGNPGPAGQRGEIGRDGIPGPPGPKGEKGVPGYGQSGAPGVKGEKGRKGDPGLQGPPGPPGWCGAVGDPGSSGPPGPQGIRGNPGAKGLCVDGPKGERGFPGQ 871          

HSP 6 Score: 100.908 bits (250), Expect = 8.885e-21
Identity = 138/369 (37.40%), Postives = 172/369 (46.61%), Query Frame = 1
Query: 2446 DGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSR-GEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG------RGEFGERGDVGPKGERGIK---GEQGINGDKGESGMIGRTGENGEKGDQGLNGP---KGNVGVIGDRGETGKPGPIGPDGATGPKG--------INGIKGEQGMMGVKGNNGPKGDQGEKGLE--------------TKGQRGEKGNMGVIG---NVGAKGELGE-----------PGMRGSKGDN------GETGIGQKGESGSNGEFGSKGQKG 3387
            D +PG PG +G  G  G KGD G QG   + G +GR G  G  G +G+PG+  +     R G +G  G +G PG  G  G+ GE GE GDI             +  KPGP G   I G  G  G PG  G +G  G  G+KG           G  G  G  GPKG+RG     G++G  GD G  G  GRTG  G+ GD G+ GP   KGN G +G +G+ G PG  G  G  GP G        + G  G +G  G +G  G +GDQGEKG                 KGQRG++G  G+ G   N G +G+LG            PG  G KGD       G  GIG+ G  G +G  G  G+KG
Sbjct:    9 DPIPGDPGSQGPPGGRGLKGDKGEQGPNTE-GPQGRIGLPGHPGFVGDPGLPGRPEYFERFGPQGRKGEKGRPGPKGTKGSYGEQGEPGDICRL-------CYLSEEKPGPRG---IPGDPGQQGPPGNDGRQGDPGPPGNKGLLGLPGLSGSYGNPGAPGCQGPKGDRGFMSGCGQKGDPGDPGPKGNPGRTGRTGDPGDPGVKGPMGEKGNPGSLGGKGDQGFPGLNGLAGRVGPMGGQGFPGVGLPGPPGAKGDFGCEGQMGRQGDQGEKGEPGTAYPTPGERGPPGIKGQRGQRGPSGIPGASGNPGPQGQLGPKGQKGQSYDGGPGFPGYKGDKGLQGRPGVPGIGKVGRPGPSGAPGMPGEKG 366          

HSP 7 Score: 77.0258 bits (188), Expect = 1.664e-13
Identity = 194/574 (33.80%), Postives = 240/574 (41.81%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGL-----------QGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDG--------------------NPGIRGDRGRPGND------------GAIGREGSYGDIGDRGLPGDKGIKG--AKGDSREETFP--------------------SIKGEKGDNGPDGKEGPKGIKGSP---------GLNGKPGISGDMGKMGVKGDEGNPXX---------XXXXXXXXXXXXXXXDA----KPVQGERGL------------QGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTG---EPGLQGPIGKVGVKGDQGAKGSD 2376
            G+ G  GD+G +G  G  GNRG PGPKG PG   A G  G   ++                   N G  G  G+ G              P G  GDKGN+G+PG  GN G+ G  G  G  GP GD G +  PG RG  G +G  G+ G  GP G  G  G  G  G  G  G    G KGD GD  L           +GE G  G KG KGERG  G P   G  GP G KG+ G  G  G  G  G +G+ G  G        G  G  G  GN G  G+ G  GRDG                     PG++G++GR G+             GA+G  GS G  G +G+ G+ G KG    G   E  FP                      KG+KGD GP G+ GP G  G+          G+NG PG  G+MG  G+ G +G PG          +G  G  G  G +G DA     P+ G++GL             G  G   ++G KG+KG SG   +    P N    GDRG TG    PG  GP G+ G +G  G + +D
Sbjct:  531 GIAGCPGDKGNRGIDGPTGNRGLPGPKGDPG---APGFIGPSVIV------------------ANPGDPGNSGDLG--------------PPGFHGDKGNKGMPGLPGNSGKNGNPGCAGQPGPPGDPGTNGCPGVRGQPGIEGSMGDMGVPGPDGPKGITGARGVPGADGIPGD--DGPKGDKGDPSLPGPGDPGRLGDKGEPGTPGIKGRKGERGLMGSPGCPGADGPYGAKGDIGPPGTPGLPGVAGERGLDGNPGPQGFPGPPGPPGCLGSPGNPGPAGQRGEIGRDGIPGPPGPKGEKGVPGYGQSGAPGVKGEKGRKGDPGLQGPPGPPGWCGAVGDPGSSGPPGPQGIRGNPGAKGLCVDGPKGERGFPGQPGRPGCLGPPGPPGPPGPGQKGDKGDPGPLGQTGPSGSTGNSGPPGPPGRDGINGYPGSKGEMGPKGLPGPQGEPGDCGNNGGRGLQGPNGPPGGPGERGRDAYSRRTPIPGDQGLPGGPGNRGMGGDYGPPGPHGLEGRKGQKGKSGREGMP-GPPGNRGYNGDRGLTGLQGAPGFDGPPGQKGRRGPAGNRVND 1066          

HSP 8 Score: 61.2326 bits (147), Expect = 1.237e-8
Identity = 111/279 (39.78%), Postives = 133/279 (47.67%), Query Frame = 1
Query: 2452 VPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRG--EEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGR---GEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGN 3258
            VPG  G+ G  G+ GEKG  G+ G++G  G  G  GA GD G+ G PG  GI+GN G++G   +G  G RG PG       Q                  G KG+ G PGP+G     G  G+SG PG  G  G  G  G KGE   +   G  GE GD G  G RG++G  G  G  GE G    +      GDQGL G  GN G+ GD       GP GP G  G KG  G  G +GM G  GN G  GD+G  GL+      G  G+KG  G  GN
Sbjct:  798 VPGY-GQSGAPGVKGEKGRKGDPGLQGPPGPPGWCGAVGDPGSSGPPGPQGIRGNPGAKGLCVDGPKGERGFPG-------QPGRPGCLGPPGPPGPPGPGQKGDKGDPGPLGQTGPSGSTGNSGPPGPPGRDGINGYPGSKGEMGPKGLPGPQGEPGDCGNNGGRGLQGPNGPPGGPGERGRDAYSRRTPIPGDQGLPGGPGNRGMGGDY------GPPGPHGLEGRKGQKGKSGREGMPGPPGNRGYNGDRGLTGLQGAPGFDGPPGQKGRRGPAGN 1062          

HSP 9 Score: 53.1434 bits (126), Expect = 3.350e-6
Identity = 48/106 (45.28%), Postives = 61/106 (57.55%), Query Frame = 1
Query: 3733 GEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN 4050
            G +G  G++G +G  G  GP G   PKG TG++G  G  G  G+DG KG+   KG+  L GP   GR G++GE G PG  G KGE+GL G PG  G  G  G  G+
Sbjct:  630 GVRGQPGIEGSMGDMGVPGPDG---PKGITGARGVPGADGIPGDDGPKGD---KGDPSLPGPGDPGRLGDKGEPGTPGIKGRKGERGLMGSPGCPGADGPYGAKGD 729          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006384.1 (pep scaffold:Pmarinus_7.0:GL480360:11377:26529:-1 gene:ENSPMAG00000005744.1 transcript:ENSPMAT00000006384.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 5.922e-56
Identity = 119/329 (36.17%), Postives = 178/329 (54.10%), Query Frame = 1
Query: 4429 KKGNRGEIGEPGDIGKVGSKGDVGEPAVRG---PKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFE-VPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            ++G  G  G PG  GK GS G  G+P + G   P+G  G+ G+ G  GQ   QG  G+ G++G  G                          G+ +   FL  +H Q  E+ P CP+G  ++++G+S +   G+ + +  +LG   SCL  F+ MPF  C+ +  C    R D+SYWL++ AP+    +  + + +YISRC  CE+P++  A HSQ  ++S   CP  +  LW GYSF+MHT  G  GGGQSL+SPGSCL  FR +P +ECN     C+++ +  S++L  VD   +FE  P  + IKA   +++     +SRC+VCMK
Sbjct:  325 EEGESGRPGFPGSAGKKGSPGYPGKPGLNGLPGPEGSLGDPGIPGQPGQVGSQGSPGNAGTVGIPGM------------------------PGRGVNVGFLLVKHSQT-EQVPQCPVGMARVWDGFSLLYVEGSEKSHNQDLGMAGSCLPRFSTMPFVYCNINEVCNYASRNDKSYWLSTTAPIPMMPVAEEQIRQYISRCAVCEAPSQSIAVHSQ--DVSIPPCPTGYRSLWIGYSFLMHTAAGAEGGGQSLASPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTVDPARQFEDSPPPETIKAGQLRTR-----VSRCQVCMK 621          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006378.1 (pep scaffold:Pmarinus_7.0:GL480360:11377:26529:-1 gene:ENSPMAG00000005744.1 transcript:ENSPMAT00000006378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 8.581e-56
Identity = 119/329 (36.17%), Postives = 178/329 (54.10%), Query Frame = 1
Query: 4429 KKGNRGEIGEPGDIGKVGSKGDVGEPAVRG---PKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFE-VPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            ++G  G  G PG  GK GS G  G+P + G   P+G  G+ G+ G  GQ   QG  G+ G++G  G                          G+ +   FL  +H Q  E+ P CP+G  ++++G+S +   G+ + +  +LG   SCL  F+ MPF  C+ +  C    R D+SYWL++ AP+    +  + + +YISRC  CE+P++  A HSQ  ++S   CP  +  LW GYSF+MHT  G  GGGQSL+SPGSCL  FR +P +ECN     C+++ +  S++L  VD   +FE  P  + IKA   +++     +SRC+VCMK
Sbjct:  327 EEGESGRPGFPGSAGKKGSPGYPGKPGLNGLPGPEGSLGDPGIPGQPGQVGSQGSPGNAGTVGIPGM------------------------PGRGVNVGFLLVKHSQT-EQVPQCPVGMARVWDGFSLLYVEGSEKSHNQDLGMAGSCLPRFSTMPFVYCNINEVCNYASRNDKSYWLSTTAPIPMMPVAEEQIRQYISRCAVCEAPSQSIAVHSQ--DVSIPPCPTGYRSLWIGYSFLMHTAAGAEGGGQSLASPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTVDPARQFEDSPPPETIKAGQLRTR-----VSRCQVCMK 623          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006387.1 (pep scaffold:Pmarinus_7.0:GL480360:11377:24023:-1 gene:ENSPMAG00000005744.1 transcript:ENSPMAT00000006387.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.519 bits (506), Expect = 1.293e-54
Identity = 119/329 (36.17%), Postives = 178/329 (54.10%), Query Frame = 1
Query: 4429 KKGNRGEIGEPGDIGKVGSKGDVGEPAVRG---PKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFE-VPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            ++G  G  G PG  GK GS G  G+P + G   P+G  G+ G+ G  GQ   QG  G+ G++G  G                          G+ +   FL  +H Q  E+ P CP+G  ++++G+S +   G+ + +  +LG   SCL  F+ MPF  C+ +  C    R D+SYWL++ AP+    +  + + +YISRC  CE+P++  A HSQ  ++S   CP  +  LW GYSF+MHT  G  GGGQSL+SPGSCL  FR +P +ECN     C+++ +  S++L  VD   +FE  P  + IKA   +++     +SRC+VCMK
Sbjct:  229 EEGESGRPGFPGSAGKKGSPGYPGKPGLNGLPGPEGSLGDPGIPGQPGQVGSQGSPGNAGTVGIPGM------------------------PGRGVNVGFLLVKHSQT-EQVPQCPVGMARVWDGFSLLYVEGSEKSHNQDLGMAGSCLPRFSTMPFVYCNINEVCNYASRNDKSYWLSTTAPIPMMPVAEEQIRQYISRCAVCEAPSQSIAVHSQ--DVSIPPCPTGYRSLWIGYSFLMHTAAGAEGGGQSLASPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTVDPARQFEDSPPPETIKAGQLRTR-----VSRCQVCMK 525          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006369.1 (pep scaffold:Pmarinus_7.0:GL480360:11377:26532:-1 gene:ENSPMAG00000005744.1 transcript:ENSPMAT00000006369.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 1.071e-53
Identity = 117/327 (35.78%), Postives = 177/327 (54.13%), Query Frame = 1
Query: 4435 GNRGEIGEPGDIGKVGSKGDVGEPAVRG---PKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFE-VPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            G  G +GE G+ G+ G  G  G+P + G   P+G  G+ G+ G  GQ   QG  G+ G++G  G                          G+ +   FL  +H Q  E+ P CP+G  ++++G+S +   G+ + +  +LG   SCL  F+ MPF  C+ +  C    R D+SYWL++ AP+    +  + + +YISRC  CE+P++  A HSQ  ++S   CP  +  LW GYSF+MHT  G  GGGQSL+SPGSCL  FR +P +ECN     C+++ +  S++L  VD   +FE  P  + IKA   +++     +SRC+VCMK
Sbjct:  396 GTPGAMGEEGESGRPGFPGSAGKPGLNGLPGPEGSLGDPGIPGQPGQVGSQGSPGNAGTVGIPGM------------------------PGRGVNVGFLLVKHSQT-EQVPQCPVGMARVWDGFSLLYVEGSEKSHNQDLGMAGSCLPRFSTMPFVYCNINEVCNYASRNDKSYWLSTTAPIPMMPVAEEQIRQYISRCAVCEAPSQSIAVHSQ--DVSIPPCPTGYRSLWIGYSFLMHTAAGAEGGGQSLASPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTVDPARQFEDSPPPETIKAGQLRTR-----VSRCQVCMK 690          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005021.1 (pep scaffold:Pmarinus_7.0:GL491368:4260:5799:1 gene:ENSPMAG00000004564.1 transcript:ENSPMAT00000005021.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 2.208e-39
Identity = 76/187 (40.64%), Postives = 112/187 (59.89%), Query Frame = 1
Query: 4840 GTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVD--SEF-EVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            G   SCL  F+ MPF  C+ +  C    R D+SYWL++ AP+    +   ++  Y+SRC  CE+PA+  A HSQ  ++S   CP  +  LW GYSF+MHT  G  GGGQSL+SPGSCL  FR +P +ECN     C+ + +  S++L  V+   +F + P+ + +KA   +++     +SRC+VCMK
Sbjct:    1 GLAGSCLPRFSTMPFVYCNINEVCNYASRNDKSYWLSTTAPIPMMPVADDDIRPYVSRCAVCEAPAQAIAVHSQ--DVSIPPCPVGYRSLWIGYSFLMHTAAGAEGGGQSLASPGSCLEDFRATPFIECNGARGTCHFFANKYSFWLTAVEEAQQFADAPRPETLKAGQPRTR-----VSRCQVCMK 180          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Nematostella
Match: EDO44729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV66])

HSP 1 Score: 180.644 bits (457), Expect = 9.543e-46
Identity = 311/910 (34.18%), Postives = 411/910 (45.16%), Query Frame = 1
Query: 1006 TGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEK-----GEKGDSGNC-----------TINFVKPLNATEM-------------GDRGDTGEPGLQ------GPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFK-GIKGNTGKPGPVGDKTI---KGIKGDSGEPGVQGLKGFTGESGDKGECSGR---GEFGERGDVGPKGERGIKGEQGINGD---------------------------------KGESGMIGRTGENGEK---GDQGLNGPKGNVGVIGDRGETGKPGPI------------------------GPDGATGPKGINGIKGEQGMMGVKGNN---GPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKG 3387
             G +G+RGTPG +G  G +G +G+ G                        +RG +G  GE G SG  +    G  G  G KG+KG +G  G +G  G KG  G+PG  GP+G  G     G  G IG  G  G+ G+ GP G+ G  G  G +G  G  G     G++G  G  GL+G+ G  G  G KG  G +G P    T G +G KG  G+ G  G+ G  G +GP G++G  G              G+KG+ G  G DG  G  GN GI G +G     G IG +G  GD+G  G+PG +G+ G +G   +     + G  G  G  GK    GI+G  GL G  G +G +G  G  GDEGN G+ G      +     +D + +  E      K +K ++          K  S  C            + +V+ L    +             G RG  G PG Q      GPIGK GV G +G  G+ G  G +G  G+ G  G KG  G  G  G PG  G+ G+ G  G++G++G+ G++G  G  G +G  G  G  G+ G+ G  G RG EG TG+ G+ G+ G IG  G  G+ G  G+ GP G + G+ G TG  GP+G K     KG  G  GE G  GL+G  G  GD+G    R   GE G +G+ GP G +G++G  G+ GD                                 KG++G IG  GE G K   GD G  GPKG +G +G  GE G  G                          GP G  G KGI G  G  G  G+KG     GP+G  G  GL   KG++GEKG  G +G  G KG  GE G+ G +G  G  G    IG  G  G  G  GSKG++G
Sbjct:    1 MGLMGSRGTPGDQGGRGPQGVQGLLG------------------------DRGPRGPPGEQGFSG--VKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRM------------GLKGDAGYDGVDGFKGHAGNTGIPGPQG---TMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKP---GIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPGDIVPRYKGHLVILDKREILDE-----SKILKNVENNTRLPLLRMKLRSPGCFLQHLWAGPALALRYVQALMYPILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRG 861          

HSP 2 Score: 160.999 bits (406), Expect = 1.233e-39
Identity = 323/989 (32.66%), Postives = 439/989 (44.39%), Query Frame = 1
Query:  253 GPKGDYGRIGNPGPIGP---KGYTGNMGELGARGLVG---DSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDF----FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGP------------KGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPG-----YQGNLGEKGFKXXXXXXXXXXXXXXSC-LPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGI-SGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGL---QGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQG---PIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDI---------------------GNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNV 3048
            GP+G  G +G+ GP GP   +G++G  G +G+ GL+G   + G  G+DG+ G+RG  G  G+PG  G  G  G  G +G +G+ G +G+ G+ G++G  G+ G +G  G KG KG +G  G      FQ + G KG AG +G  G              G  G+ GI G  G  GPIG  G  GD        G  G PG +G  G    L   +G+     +GD+                     G DG  G +G  G+TG  G +GT GP             G PGS+G  G RG +G +G  G+ G  G QG  GK G RG +G  G +G +G          G  GD GD+GN+G+PG     Y+G+L     + +   +  + ++ ++  LP  R  +   G   +    GP     +                    +G +G  G +G  G  G +G++G+RGP G+P  +G  G  G KG  GL G  G+ G  GPKG  G +G+             G  G+ GE G  G  G  G+ G+ G+ G+PG  G  GREG  G  G  GLPG +G++G++G +       + G KG  GP G  G +G  G+PG  G PG  SG  GK G++G  G+                    K   GE+G    +GEKG   + G++G +GD G              +G+R   GE GL+G   PIG  G++G  G +G                         DG+ G  GK+G  G  G  G  G  G  GD G KG++G            IG KG  G +G  G+ G  G  G  GD+G  GE G QG                       G+ GP+G  GIKG  G  GP+GD  IKG  G  G  G  G  G  G  G +GE    G  GERG  GP GE G+ G++G  G  G  G IG  G  G  G  G  G +G +
Sbjct:   17 GPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDG------------FKGHAGNTGIPGPQGTMGPIGAKGILGDV-------GAPGMPGGVGSIGPSG-LQGFQGRM--GLKGDA---------------------GYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSI--------GDPGDPGDEGNEGLPGDIVPRYKGHLVILDKREILDESKILKNVENNTRLPLLRMKLRSPGCFLQHLWAGPALALRYVQALMYPILSNPLLS-----RGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSK------------GPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGST------GVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGH--------------------KGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRG-------------PIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGD------------------------DGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGK-----------IGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRGKL 863          

HSP 3 Score: 146.747 bits (369), Expect = 2.914e-35
Identity = 304/884 (34.39%), Postives = 389/884 (44.00%), Query Frame = 1
Query: 1810 GIRGDRGRPGNDGAIGREGSYGDIGD---RGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNG------KPGISGDMGKMGVKGDEGNP-XXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQ---GPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPG------------------------VQGLKGFTGESGDKGECSGRGEFGERGDVGPK------------------GERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGV---IGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNN---------------GPKGDQGEKGLE----------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-----IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNK---GVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFG------------------------EDGDKGNVGPKGNKGLSGPC-------QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKG 4089
            G+ G RG PG+ G  G +G  G +GD   RG PG++G  G KG          KGEKG  G DG +G +G KG  GL G       PG  G  G +G+ G  G+P              T  + AK  +G  G  G  G++   G  G KGD+G   ++  K       G  G+TG PG Q   GPIG  G+ GD GA G           G  G+ G  G +GF G  G+ G  G  G+DG KG  GN G+ G  G  G  GAKG  G +G PG+ G +G  G+RG EG+ G  GLP         G  G QGD G  G +G +G++G +GK G +GD    G +G+ G PG                        ++ ++  T     + +    G F +    GP                     RG  G  G  G  G  G  G  G+ G  G  G++G KGN+G    IG +G+ G+ GP GP GA G  G  G  G+ G +GV+G N               GP G QG +G +           +G RG +G+ GV G  G KG +G PG RG  G  G+ G      G  G++G  G  G KG  G +G  G  G  G  G  G +G +G++G IGE                       KDG KGL G +G  G  G  L+G +G  GD+G  G  G  G  G  GG G PG  G++GD G KG     G KGE G KG+ G  G  GPKG  G  G  G KG  G                        + G +G VG KG +G SGP          G  G RG  G PG +G KG QG +G  G++G  G KG  G NG+ G  G +G  G
Sbjct:    2 GLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFK-------GHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMP---------GGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLP---------GPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPGDIVPRYKGHLVILDKREILDESKILKNVENNTRLPLLRMKLRSPGCFLQHLWAGPALALRYVQALMYPILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGE---------------------RAKDGEKGLKGETGPIGGQG--LEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPG 837          

HSP 4 Score: 116.701 bits (291), Expect = 4.302e-26
Identity = 256/756 (33.86%), Postives = 330/756 (43.65%), Query Frame = 1
Query:  223 QNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKG---IAQKGEKGFPGPI---GDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPK---------GQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXK--TVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSG----------RPTTGLVGPKGPKGEKGL---------SGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIK---GAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS 2373
            Q T   +G  G  GD G  G PG +G  G +G  G  G  GL GD+G +G DG  G  G +G  G  G  G  G  G+ GD G  G+PG  G NG +G +G  G  GL G  G +GD    G+PG      +G +G                    G+ G  G  G  GD GD+G  G+ G+   + KG   I  K E      I    +  T   L  +K ++P    G   +    G             P L   +  RG  G +G  G  G PGP+         G+PG  G KG  G+ G IG +G  G++G  G +G  G  GSKG  G+ G  G     ++GP G  G +G  G  G PG  G  G +GFKG  G  G         LPGKRG  G +G  G  G  G +G  G  G  G  G  GD G   +  G+ G +G  G  G KG  G KG  G+RG  G          R   G +G +   GEKGL          GL+G+ G  G  G++G  G    +   G  G  G  G+ G+ G  G AG+ G  G  G +G PG+ G +G +G  GD+G  G  G +G     G  G    +     KG+ GD GP G  G KGI+G+ G  G  GI G  G MG +G +GNPG                    + G +G QGEKG     GE+G+KG  G   +          +G RG  G PG  G IG +G KG  G+ GS
Sbjct:  175 QGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDP---GKPGI-----RGHEGLQ------------------GVSGKAGSIGDPGDPGDEGNEGLPGDIVPRYKGHLVILDKREILDESKILKNVENNTRLPLLRMKLRSP----GCFLQHLWAGPALALRYVQALMYPILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVG-----VRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPG---------LPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPG--------------------LLGRKGRQGEKGTAGRLGERGKKGPFGENGV----------LGKRGTLGPPGSPGSIGDMGAKGHPGSLGS 856          

HSP 5 Score: 115.931 bits (289), Expect = 8.775e-26
Identity = 119/302 (39.40%), Postives = 151/302 (50.00%), Query Frame = 1
Query: 2536 IGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPG---------PVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGM---IGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKGM 3390
            +G  G  G  GD G  G  G+ G+ G+ G RG  GE G  G+ G  G  G  G  GE+G  G  G KG +G KG +G PG           G K   GI G SG PG  G +G TGESG  G    +G+ G  G +GP G +G +G  G+ GD G  G+    G  G  G  G QG  GP G  G++GD G  G PG +G   + GP G+ G +G  G+ G  G +G  G +G  G    G  G +G MG IG  G  G++G PGM GS+G NG  G    +G  G  G  G  G  G+ G+
Sbjct:    1 MGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVG---SIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAG--NTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGI 297          

HSP 6 Score: 115.161 bits (287), Expect = 1.510e-25
Identity = 274/850 (32.24%), Postives = 339/850 (39.88%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGP---IGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIG-------------------------DAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPK-GEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPG------DKGIKGAKGDSREETFPSIKG------EKGDNGPDGKEGPKGIKGSPGLNGKPG---------ISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGET 2643
            G+ G KG  G  G PGP   +GP G  G +G++GA G+ G  GS G  GL G +G                    G +GD G  G +G  G  GN G+ G  G  G  G KG  G +G PG       G +G  G  G  G+ G  G  G  G  GD G  GIRG  G QG  G +G  GD P     +G +G PG I                          +  T   L  +K ++P    G   +    G             P L   +  RG  G +G  G  G PGP+G  G +G  G  G  G  G                  N G+KG +G  G  G+        QGPFG KG  G  G  G  G+ GE G +                  G  G++G +G  GE G  GP G  G  G  G  G  G  GK  +G++G  G  G+ G KG+ G  GV G RG  G P  G +GP G + G  G +GL G  G  GP G KG +G                   +GEKG  GL G  G+ G RG  G    DG  G +G  G IG +GL G      D GI+G +G           G      + GD G  GK G  G KG PG  G PG           GD+G +G KG +G      L    G     G   K   G+RG QG  GIK I G  G  GDSG              MG RG  G PGL      +G KG QG KG+                            G  G+RG+ G  GE G +G    +G +G  G  G+ GD GA G+PG     + GS+G  G+ 
Sbjct:  158 GVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGR------------------MGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPG-----MPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGD-PGDPGDEGNEGLPGDIVPRYKGHLVILDKREILDESKILKNVENNTRLPLLRMKLRSP----GCFLQHLWAGPALALRYVQALMYPILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKG------------------NIGAKGRIGLQGDRGE--------QGPFGPKGAGGEMGSKGPPGDFGEVGVR------------------GPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGK--RGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTP--GDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVG------------------KRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQG--AYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKG-------GYGLMGPRGPDGNPGL------LGRKGRQGEKGTA---------------------------GRLGERGKKGPFGENGVLGK---RGTLGPPGSPGSIGDMGAKGHPG-----SLGSKGRRGKL 863          

HSP 7 Score: 86.2705 bits (212), Expect = 9.102e-17
Identity = 194/554 (35.02%), Postives = 249/554 (44.95%), Query Frame = 1
Query:  217 CTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNR---------GTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXX----KTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPG 1839
               N     G  GP G  G +G+PGP G +G  G +G+ G  G  G+ G+ G+ GL GDRGE G +G  G  G+ G  G  GD G+VG+ G NG  G +G  G  GK G  G +G +G KG  G PG     K+G                        + G +G  G+ G  G +GPIG+ G           +G+ G PG IG  G++  +        P + G  G  G  G  G+ G  G  GE G  G  GD+G +GD G +G R         G  GP G  G +G  G++G DG+ G +G +G  G  G  G  G  G  G+ G  G +GK            G KG+ G +G PG  G +G KGF                      GD+G  GE G  GA+GP G+ G  G  G  G  G  G    +   GIKG  G  G  G+ GI G  G+ G RGP G P  GL+G KG +GEKG +G  G+ GK GP G  G+LG    L            G  G  G  G  G  G+PG  G +GR G
Sbjct:  398 ILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPG--LPGKRG------------------------LRGSEGSTGVYGMKGMKGPIGVPGF----------RGQHGTPGDIGPPGSESGV--------PGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGK-----------IGTKGEPGRKGSPGDIGYVGPKGF---------------------LGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNP--GLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTL------------GPPGSPGSIGDMGAKGHPGSLGSKGRRG 861          

HSP 8 Score: 53.5286 bits (127), Expect = 8.448e-7
Identity = 59/172 (34.30%), Postives = 79/172 (45.93%), Query Frame = 1
Query: 3712 QGNEGDIGEKGNKGVKGELGPKGNVGPQGDQG------PKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSG-------------------------PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN--------------GIEGPDGDIGNKGR 4092
            +G+ G IG+ G  G KG +G KG +G QGD+G      PKG  G  G  GP GDFGE G +G  G  G++G+ G                         P ++G  G+ G  G  G  G+KG  G+ G  G+ G  GD G PG+              G +GPDG+ G  G+
Sbjct:  427 EGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGK 598          

HSP 9 Score: 51.9878 bits (123), Expect = 3.075e-6
Identity = 51/126 (40.48%), Postives = 67/126 (53.17%), Query Frame = 1
Query: 3718 NEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN-GIEGPDGDIGNKGR 4092
            + G  G  G +G  G  GP+G  G +G  G  G +G+KG  G KG  G  GD+G  GP G KG  G  + G  G  G+ G  G  G  GE G EG+PG++G+ G  G  G  G +GP+G  G  G+
Sbjct:  405 SRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGG--EMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGK 528          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Nematostella
Match: EDO34165 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ52])

HSP 1 Score: 162.54 bits (410), Expect = 4.162e-45
Identity = 89/229 (38.86%), Postives = 128/229 (55.90%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGN-GGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFEVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            F  TRH Q     P CP     ++EGYS +   GN   +  +LG+  SC+  F+ MPF  C+ +  C    R D S+WL++  P+    ++  NV+ YI RC  CE  +   A HSQ+  +    CP  W+ LW GYSF+MHT+ GN G GQ LSSPGSCL  FR  P +EC +G   C+++    S++L  VD   +F +P+ + +KA      N+ + +SRC+VC K
Sbjct:    4 FFLTRHSQT-VRVPRCPEDRPPLWEGYSLLYVQGNERAHGQDLGSPGSCIQRFSTMPFLFCNINNVCNLASRNDYSFWLSTPEPIPMMPVQETNVQPYIGRCAVCEVSSHVMAVHSQSITVPS--CPSGWSPLWQGYSFLMHTSAGNDGSGQLLSSPGSCLEDFRAHPFIEC-HGRGTCHYYGSTYSFWLATVDQNKQFRIPRPETLKA-----GNLRERVSRCQVCQK 223          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 179.104 bits (453), Expect = 5.402e-45
Identity = 416/1145 (36.33%), Postives = 511/1145 (44.63%), Query Frame = 1
Query:  211 TVCTQNTC--RCV----------------GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESX-----XXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPG-DFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGA------------KGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC--------------IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEG------------LQGEKGISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLS------GLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGL------PGDKGIKGAKGD--SREE--TFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGM---------------------KGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGE---QGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG 3327
            T+C  N C  +C+                G PG  GD G  G  G  GP GY G  G  G RG  G  G  G  G PG   ++              G  G  G  G RG  GLPG  G++G +G  G  G  G SG  G +G  G  G PG D F    GE+G   ++G +G  G  GF G +G  G++G+ G RG VG  G  G  G PG  P     +G+ G  G  G  G      +   +  P   G  G  G  G KGK G  G  G PG  G  G  G +G  G  G  G PG  G PG KGA            +G  G+ G+ G  G  G  G +G  G+ G  GSKGE G  G +G                IG + GP GP GD G +G  G  G+ G  G  G KG  G             PG  G  G KG+ G SG +G  G  G  G  G  G  G EGKT  G+ GD G +G            LQG  G+ G  GV G +G +G P     TG  GP G KGE GL+      G+ GKNG  G  G +G +G             +G +G  G +G  GL G+ G  G RG+RG  G  GA+G  G  G+ G  GL      PGD+G  GA G   S+ E   + +I GE G  GP G  G  G +G PG +G+ G  G  G  G +G  G P            G  G D  P  G  GL G  G +   GEKGE G  G    N          G  GD G  GL G  G  G  G+QGA G  G  G +G  G  G KGV G+ G  G+ G  G+RG+ G  G +G  G+QGM                      G  G  GR+G KG TG  G P     G +G  GE G  G  G PGI G  G  GE G  G+IG       KG KG +G PG      I G +G  G PG++G +G+ G+ G  GE    G  G RG  G  GE G+ GE    GING  G  G+ G  GE G  G+ G  G +G  G  G  G  G+P   G  GA G +G +G  G+QG  G +G NGP+GD+G +G   +G++G+KG  G  G+ GA G+ GE G  G  G +G  G
Sbjct:   50 TICCYNGCVYQCIKPAPTYPPVKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQG---EKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPG-APGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRV-GPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGS------------PGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKT--GLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGP------------QGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPP------------GIDGKDGAP--GSDGLNGPPGPQGPAGEKGEAGQPGTNGFN----------GKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRP-----GRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGR------KGEKGPSGPPG------ITGNRGPPGSPGIKGERGYPGKDGRAGEP---GAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEP---GVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRG--PRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPG 1114          

HSP 2 Score: 176.022 bits (445), Expect = 4.521e-44
Identity = 287/818 (35.09%), Postives = 365/818 (44.62%), Query Frame = 1
Query: 1219 QGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGR---------------------EGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGD---------------MGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCT-------------INFVKPLNAT-EMGDRGDTGEPGLQGPIGKVGVKGDQGA------------KGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGER----------GIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGI---------KGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-------IGQKGESGSNGEFGSKGQKGM 3390
            +GP GP GD GD+G  G  G  G LG  G                   PG +G  GD G  G+ G  GP G            D  D    +KG  G  G  G  G  G  GS G +G+RG  G P  +G  G +G  G  G  G+DG +G  G +G KG  G +      G  G+KG +GN GE+G   + GR G PG  G  G PG+ GA G+                      G+ G+ G RGLPG+ G+KG +G +     P  +G +G +GP G +G  GI G PG   +PG+ GD                G  G  G  GNPG                 A  + G+RG  G  G     GEKG +G +G+               I  V P+    + G RG TG  G  G  G  G KG+QG+            KGS G +G+ G+ G  G  G  G+ G +G  G+PG  GQ G  G  G      ++G  G  G SG  G  GA G PG     G +G  G++GE G  G RG+PG+ G  GN GE GE+G +G  GP+G  G +G  G PG  G+   +G +G  G+PG  G +G  GE+G  G     G+ G+RG  G  G             I GE G  G  G  G  GR G  G  G +G  G KG+ G   +RG  G PG  G DGA G  G+NG          KGE G  G  G NG  GDQG +GL  T G  G  G  G  G  G  G  G  G++G+KG  G +G       +GQ+G  GS G  G+ G +GM
Sbjct:   75 RGPDGPPGDIGDQGPSGEAGKPGPLGYNG------------------QPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERG---MVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPG---EPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPG-----------------ATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRG---ERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGM 848          

HSP 3 Score: 166.007 bits (419), Expect = 4.821e-41
Identity = 418/1219 (34.29%), Postives = 509/1219 (41.76%), Query Frame = 1
Query:  460 GDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPG----DQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGD---------------------RGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGV---IGFXXXXXXXXXXXXXXXXXNRGSKGEVGE--------------AGGSGKCIGNIQGPQGPFGDKGDKGNQGI---PGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGL---------AGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPV-----QGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMI------------------GRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPK------GINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLK-GESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFG 3861
            GD GD G  G  G  G  G +G  G  G+ GD G +GD+G  G PG   QA  G KG                      D +    GI+G  G  GP G  G PG    D P+G  Q+GE G PG  G AG               +RG SG  G                PG+DG  G                      +GQKG+ GN+G RG  G  G+PG  GA G  GS G    +G  G  G +G  G  G  G RG+ G  G               A GS    GN QGPQGP G +G KG  GI   PG  G  G+KG  G PGP G  G  G S  PG  G+ G  G NG+ GA G  G  G                     KG+ G EG  G  G  G+ G  G+RG  GR   G +GP G  G +G +G  G  G  GP G KG  G+       G  G+KG  G  GE G+ GL          GR+G  G+ GD G+ G  GA G+       G  G+PG  G+ GAKG + E       G+ GD GP G  G KG  G  G  G PG++G  G  G  G+ G                      PV     QG  G QG  G+    GE G +G+ G       KP    E G +G+TG  GL GP GK G +G  GA G+     +  +              +  + G PG +G SG  G  G  G  G  G  G  G  G++G+ G +G PGI G  G  GS G  G  G +G  G  G+ G  G +G  G  G+ GP+G  G  G  G+ G  G     G  G  G  G++G KG  G SG  G     G  G+RG +G KG  G  G QG+ G  G  G                    GR G  G  G+ G  G  G  G  G  G  G+PG  GPDG  G +      G  G KG  G  G+ GN GP G  G KG   +G  G+ G  G  G VG +G  G+PG  G  G+ G+ GI     +G+NG  G  G K                              GE GS G+ GK G  G  G  G  G +G  G+ G  G +G  G   K G +GP G NGP GD                  +GN G  GEKG+KG  G  G  G  G QG+QGP G  G+ G  GP+G+ G
Sbjct:   82 GDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKG---------------------PDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRG--QRGEVGLPGESGSAG---------------RRGASGPPGS---------------PGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGN-QGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGS--------------------KGEKGSEGPNGSPGPRGAPGPPGKRGKIGR--VGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEP------GKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERG----------------------PVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDG----KPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIR--------------YFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGIT---GTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKG--ERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGI-----NGTNGRGGIPGLK------------------------------GERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGD------------------KGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPGPRGNVG 1120          

HSP 4 Score: 134.42 bits (337), Expect = 2.252e-31
Identity = 265/759 (34.91%), Postives = 345/759 (45.45%), Query Frame = 1
Query: 1945 TFPSIKGEKGDNGPDGK---EGPKGIKGSPG---LNGKPG---ISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG---------LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGN------------EGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKG--------LSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKG 4089
            T+P +KG++G +GP G    +GP G  G PG    NG+PG   + GD G  G +G +G PG         +       A  ++G  G  G +G   + G +G  G                  G RG+ G PG  G  G+ G  G  G+ G DG                     F G PG  G++G++G         L G+KG+ GN G +G +G  GR G  G  GA G+PG    +G+ G             +G RG  G  G RGLPG  G  G +G +G +G  GN GP+G  G +G+ G+          GI G  GEPG+ G KG  G  G  G+   RG  G  G  G        G  GINGD+G  G  G+ G  GEKG +G NG  G  G  G  G+ GK G +GP G  G  G  G  G +G  G  G NG KG+QG     + G  G  G+ G  G+ G  GE G  G+RG  G  G  G  ++G++G  G+ G  G+ G  G+   +   G  G  G  GV G KG  GE                      GKDG  G  G +G KG SG+   +G  G  G NG  G+ G  G  G +G +G PG QG  G  G+ G  G +GE G  G  G  G++GP+G TG  G TGP G  G+ G  G  G   +K         +  P  QG SGN    G PG+ G+ G  G  G PG  G  G++G+ G  GI+G DG  G+ G
Sbjct:   67 TYPPVKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDG----------------PRGQRGEVGLPGESGSAGRRGASGPPGSPGIDG---------------------FSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQ---------AGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITG------NPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQG-----SPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPG--REGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGE---------------------PGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGN---PGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDG 742          

HSP 5 Score: 129.798 bits (325), Expect = 6.213e-30
Identity = 346/996 (34.74%), Postives = 445/996 (44.68%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVG---------LPGCNGTNGEKGNDGLAGKMGLSGDKGVKGD------KGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGD------------------TGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC----------IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKG---ENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGT-ACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYG---------------------------DIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGP------------KGIKGSPGLNGKPGISGDMG---KMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPV-------------QGERGLQGEKGIKPIDGEKGEKGDSGN-----------CTINFVKPLNATEMGDRGDTGEPGL---QGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPG---KRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKG 2871
            G+PGP+G  G  G  G +G  G +G+ G  GA G  G  G +G  G PG++GE G+ G  G  G PG  G  G+ G++G          PG +G  G  G+ G  GK+GL+G  G +G       +G  G PG+     +G +G  G+ G               + G +G  G RG  G+QGP G SG  G +     Q G  G PG  G  G    +        P  RG SG  G  G  G TG+ G  G PG  G +G +G+KG                    G +G  G  GP G PGS+GA G RG  G  G  G +G++G  G  G  G++G KG  G+ G  G+               +G  G  GD G  G  G PG    L  +G  GMPGP+G  G  G +  PGK GD G +G     GESG  G RG  G  G  G+ G+ G+ G    +G +G  G +G  G  G +G  G +GERG  G+P  G +G +GP+GE G +GL G  GK G +G  G  GT   K          G  G QG  G  G  GR G PG  G RG PG  G+ G  G  G                           + G+ G PG  G  G  GD      P   G  G NG  G  GP            KG KG  G +G+PGI+G +G   ++G KG EG PG +G+ G  G  G  G    P               G +G  GE G    DGE GE G  G                          G++G +G PG+   +GP G  G+KG++G  G DG +G+ G  G  G  G  G  G  G PG PG     G+ G+ G KG+ G+ G  G  G +G  G  G  GA G PG+  +G +G+RG++G+ G +G        G QG +G QGD GN GP+G KG KG TG  G  G     G +G+ G PGV G  G  G  G+ G
Sbjct:  162 GLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGN-----EGARGLPGNPG---------------LKGKRGATGSRGSPGNQGPQGPSGPQGSK----GQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKP--GAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGV--QGAKGARGDDGKDGKQG------PAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPG---APGQQGEQGPPGVAGTDGPPGPRGNVG 1120          

HSP 6 Score: 122.094 bits (305), Expect = 1.260e-27
Identity = 234/659 (35.51%), Postives = 292/659 (44.31%), Query Frame = 1
Query: 2446 DGVPGIPGKRGQSGLDGEKGDIG------NQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNE------GSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGD------KGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGE---------------NGEKGDQGLNGPKGNVGVIGDRGET---GKPGPIGPDGATGPKGING------------------------------IKGEQGMMGVKGNNGPKGDQGEKGLETK----GQRGEKGN------------------MGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----QQGRSGNRGEMGAPGK-------------VGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGR 4092
            DG PG  G +G SG  G+ G +G      NQGM+GD G +G  G +G  G       GIKG +      G +G  G  G RG PG+ G  G+ G  G++G++G  G  G  G +G +G PG        GI G SG PG QG KG  G SG       KG+    G  GERG VG  G  G  G  G  G  G  G +G TG+                G  G++G  G  GN G+ G RG T   G PG  GP G +GP+G  G                              I+G  G  G+ GN G  G  G++G   +    G +GEKG+                   G IG VG  G +G+PG RG+ G  G  G     G+KGE GS G  G  G KG +G  G  G  G  G  G  G  G  G  G+ G  G  G+ G  G  G+       G  G+ G SG  G  G    GE G  GD GP G  G  G+ G  G +G+PG  G  G+ GE G    +G +GP+G  G  G QGP G  G  GE+GP+G+ G DG  G +G +G +G +GP       G+ G+RG  GA G              +G  G QG  G PG  GR G  G  G  G  G  G  G +GR
Sbjct:   78 DGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPG------SPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGAN--GEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGE---RGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGR 725          

HSP 7 Score: 73.559 bits (179), Expect = 8.375e-13
Identity = 231/665 (34.74%), Postives = 292/665 (43.91%), Query Frame = 1
Query: 2737 FKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERG-----IKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKG----------LETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKG------------NTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----------QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQG 4611
             KG +G  G PG +GD+      G SGE G  G  G+ G+ G++G    RG+ G +GD GP+G  G       G +G + +   +G+ G  G  G +G  GL GP+G+ G  G RGE G PG       +G  G  G  G  G  G+ G +G  G+QGEKG             KGQ+GE+GN+      G +G +G P              G+ G  G+ G  GS G +G  G  G  GP GP GP GL+GV+G  G+ G  G  G  G  G  G  G RG+ G  GP+G SG  G KG +GI    GE G  GD G  G  G  G  G +G  G PG  GN G  G  G++G  G  G  G+ G +G +GP G              G  G  GP G  G+ G +G  GP+G  G +GP             G  G++G+ G+ GK G  G  GL G PG+ G  G +GK   G+ G DG  G  G  GK       G  G  G SG  GAKG  G                              E G  GD G  G  G +G  G  GS G+ G                         G  G  GEPG+ G VG +G  G P  +GP G+ G+ G SG  G+    G  G  G  GPQG
Sbjct:   71 VKGQRGPDGPPGDIGDQ------GPSGEAGKPGPLGYNGQPGNQGM---RGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPG------ESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNL------GERGMVGRP--------------GRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGK--TGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANG------------------------------EPGKDGDTGPQGPAGAKGESGLAGSRGMPGVA-----------------------GKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQG 645          

HSP 8 Score: 63.929 bits (154), Expect = 7.505e-10
Identity = 221/661 (33.43%), Postives = 271/661 (41.00%), Query Frame = 1
Query:  238 CVGIPGPKG---------DYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXL------FGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGA------------VGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKG------------ENGESGAHGPRGDFGFNXXXXXXXXXXXXXKT-VKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-------TTGLVGPKGPKGEKGLSG------LDGKNGKVGPKGMKGLLGTACKLCXXXXXX------------------XXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGP 2004
              G+PGP G         + G+ G+ GP GP G  G  G  G+RG+ G +G NG  G PG+RG  G  G  G  G  G  GL       G RG+ G  G  G  GE+G  G  G  GL+G  G  GD+G  G  G      +  + FA                            I G+ G QGP G  G PG Q  G+    G +G PG  G  G   ++       PP   G  G                   PG DG              G+ GQ G  G  G  G  GP+G PG+ GA G  G  G        G  G  G +G  G +G+KG +G +G  G     I G  G  G  G KG +G PG QG  G  G  G PGP GP G  G S   G  G  G KG            E GE G  G  G+ G  G  G  G+ G  G+   KG KG SG  G+ G +G  GS G+KGERG  G+          GL GP G  GE GL G      ++G NG+ G  G+KG  G+  +  K G  G                   KG +G+ G+ GK G AG  G  G +GD+         G  G  G+ GD+G  G  G  GA G   E+  P + G  G  GP G  GP
Sbjct:  535 MTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFA----------------------------IIGEPGAQGPSGNPGTPGRQ--GMPGASGRRGAPGAKGSRGERGRV------GPPGIDGKDGA------------------PGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGA------SGPTGPVGPRGPGGIKGAKGVMGSSGRPG-----ITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDK---------GNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPGPRGNVGP 1121          

HSP 9 Score: 63.5438 bits (153), Expect = 9.747e-10
Identity = 238/655 (36.34%), Postives = 305/655 (46.56%), Query Frame = 1
Query: 2800 IKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENG--EKGDQGLNGP---------KGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGESGPIGD---------------NGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGE------------LGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXED-KKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSG---------QEQGMVGDKGSIGPQG 4611
            IK     P V+G +G  G  GD G+   +G  GE G  GP G  G  G QG+ GD G  G  G  G  G   +   G+ GP         KG+ G  G RG  G PGP G DG  G +G  G+ GE G  G +G +GP G  G  G     G++GEKG  G  G  G  G  G+ G  G+ G+ G  G  G+ G  G+ G  GS G +G  G  G  GP GP GP GL+GV+G  G+ G  G  G  G  G  G  G RG+ G  GP+G SG  G KG +GI    GE G  GD                GP+G  G+ G+ G  G  G  G  G  G IG KG KG +G              G +G +G  G  GP G+ GS+G TGP+G  G  G  G  G +G+ G +G    G  G++G  G  G+ G  G +G  G PG  GR G  G PG+  +G DG  G  G+  +                  QG  G+ G  G  G  G  G  G  G  G  G  G KGE+G  G  G+ G+ G  G  GE G  G +G +G QG  G  G  G  G  GE   +G RG  G+PG +G+ G +G+ G   + GP G  G++G +G  G         +   ++G+ G+ GP G
Sbjct:   62 IKPAPTYPPVKGQRGPDGPPGDIGD---QGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAG--FPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGD--DGQDGKPGAPGKPDRLS---------------LQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSG 694          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Nematostella
Match: EDO33050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC3])

HSP 1 Score: 167.933 bits (424), Expect = 3.318e-42
Identity = 221/606 (36.47%), Postives = 290/606 (47.85%), Query Frame = 1
Query: 1486 KTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNG------KPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXX-XXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIG------------DKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMG 3246
            + +KG +G  G  G  G +G+ G+KG +G  G +G P  GLVGP G  G +G+ G  G+ G  G KG+KG  G+                      G  GL G  G PG +G RG        G +G  GD G RG PG++G +G KG          KGEKG  G DG +G +G KG  GL G       PG  G  G +G+ G  G+PG  G +G  GE G    + AK  +G  G  G  G++   G  G KGD+G   ++  K       G  G+TG PG QG +G +G KG  G  G+                           PG+PG RG +G  G +GD+G+ G+ G  G             +G  G  G  G+IG+PG   KGN G +G  GE GM+G PG   D GN+G  G+ G IG  GP G  G  G  G  GP G +      G  G PG QGL+G  G  G  G    +G  G +G +G +G+RG +G  G  G  G+ G  G  G  G  G  G+ G KG +GV G RG+ G PG IGP G+      +G+ G+ G+ G  G+ GP G++G       G+RGEKG MG
Sbjct:  287 QLIKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSP--GLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSP---------------------GSMGLMGSRGTPGDQGGRG------PQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFK-------GHAGNTGIPGPQGTMGPIGAKGILGDVGA---------------------------PGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGK--KGNIGEKGPSGEQGMKGDPG---DEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPR------GALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSE-----SGVPGKTGLRGPMGHKGPDGEKG-----YVGKRGEKGFMG 808          

HSP 2 Score: 157.147 bits (396), Expect = 7.747e-39
Identity = 222/663 (33.48%), Postives = 297/663 (44.80%), Query Frame = 1
Query: 2212 GEKGEKGDSG-NCTINFVKPLN----ATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----------------------GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPG---------PVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
            GE G KG+ G    I   +  +    A E+  +   G  GL+G  G  G +G QGAKG                             G+PG+ G  GL G  G  G +G++GD G KG  GAKG  G  G+PG                       G+ G+ G RG  GE G RG+ G  G  G  G  GE+G  G  G KG +G KG +G PG           G K   GI G SG PG  G +G TGESG  G    +G+ G  G +GP G +G +G  G+ GD G  G+    G  G  G+ G+ GP+G +G IG +G  G    +G  G  G +G+NG +G +G +G  G  GP G QG+ G    G RG +G  GV G  G+   +G+PG +G+ G+ G +G     E G  G+ G +G +G+ G                        DIG IG                       GP G++G  G++G +G +  G  G +G  GP G                   +G+ G IG+ G  G KG +G KG +G QGD+G +G  G KG  G  G  G  G +G+ G  G KG+ GP   G  G RG+ G PG +G  G +   G+PGK G  G  G      +GPDG+ G  G+
Sbjct:  255 GEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKR---------------------------GLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGV---DGFKGHAGNTGIPGPQGTMGPIGAKGILGD---VGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPG--KPGIRGHEGLQGVSGKAGS---IGDPGKKGNIGEKGPSG-----EQGMKGDPGDEGNEGLPG------------------------DIGIIG---------------------MQGPPGVTGKDGQQGAAGPS--GPRGALGHPGPQG------------------LEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPI--GVPGFRGQHGTPGDIGPPGSE--SGVPGKTGLRGPMGH-----KGPDGEKGYVGK 800          

HSP 3 Score: 151.754 bits (382), Expect = 4.274e-37
Identity = 243/666 (36.49%), Postives = 307/666 (46.10%), Query Frame = 1
Query: 1501 IKGDSGDEGLQ------GEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKV------------GPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATE-----------MGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGN------QGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            I G  G +GL+      G  G  G  G +G RGP G P     GPKG  G K   GL  ++               GP+G+KG  G A            G +G QG KGK GL G  G+PG+ G  G PG       EG  GD G +G  G KGIKG  G         + G +G  G  G  GP+G++G  G  G  G  G+ G  GVKG  G+                        G  G +GEKG +  DG KGE+G  G   +   K                 +G  G  G+ G +GP G+ G  G  GAKG           G  G+ G  G +GF G  G+ G  G  G+DG KG  GN G+ G  G  G  GAKG  G +G PG+ G +G  G+RG EG+ G  GLPG  G  G+      +G  G QG  G  G  G  G KGN G+ GP G+   +G+KGD G+ G +GL G  G  G +G     G+ G++G  GP G RG  G  G  G +G+ G IG+ G +G KG+ G    KG +G+ GDRGE G  GP G  G  G KG  G +G  G+ G+KG  GP G          G RG+ G  G IG  G+  E G PG  G +G      +G KG  G  G  G +G+KG 
Sbjct:  220 IVGSKGPDGLRGPHGDPGRPGGPGMPGPRGYRGPKGEP-----GPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYA------------GHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGP------EGIQGDPGQKGFEGAKGIKGFPGSPGSM---GLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGS-----------------------HGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQK---------GGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGE---QGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGA---KGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIG--------VPGFRGQHGTPGDIGPPGS--ESGVPGKTGLRGP-----MGHKGPDGEKGYVGKRGEKGF 806          

HSP 4 Score: 138.272 bits (347), Expect = 7.188e-33
Identity = 256/736 (34.78%), Postives = 317/736 (43.07%), Query Frame = 1
Query: 1054 GSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGK--CIG-----------------NIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAG------------RDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGE---SGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMG 3159
            GSKG  G+RG        G  G+ G  G  G  G RG KGE G  G  G   CIG                  I+GPQ      G KG  G  G+QG  G KG +G+PG  G  G +G   LPG  G  GD G+ G  GA G                       +KG  G  G  GL G +G  G +G +G +G       GL+G +GP+G  G  G  G  G VG  G+ G  G   K       G  G+KG +G KGK GL G              G  GI G  G PG DG+ G  G  G  G  G  G KG  G+ G S  + F    G KGD G DG +G KG  G+ G+ G  G  G +G  G+ GD G P                          G+ G +G   ++G +G +GD                +G  G  G PG QG  GK G++G +G +G  G +                     G  G PGK+G     GEKG  G QGMKGD GD+G  G  GD G IG                    M+G PG+TG  G QG    SG +G +G+ GP+G +G +G  GKPG      + G KG+ G       KG  G  GD+GE    G  G  GD+G KG  G +G  G+ G KG  G IG  G  G+ G  G  GP G+    G  G+TG  GP+G  G  G KG  G +GE+G MG
Sbjct:  222 GSKGPDGLRGPH------GDPGRPGGPGMPGPRGYRGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQ------GLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKG-----------------------IKGFPGSPGSMGLMGSRGTPGDQGGRGPQG-----VQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGK------EGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAP--------------------------GMPGSRG---LNGTRGPEGD----------------LGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKA---------------------GSIGDPGKKGNI---GEKGPSGEQGMKGDPGDEGNEGLPGDIGIIG--------------------MQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPG------VSGTKGNIGA------KGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSES--GVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMG 808          

HSP 5 Score: 132.109 bits (331), Expect = 5.048e-31
Identity = 224/667 (33.58%), Postives = 285/667 (42.73%), Query Frame = 1
Query: 1051 PGSKGAKGIRGSDGV---IGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAG------------RDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDT---GAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGEC-SGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGR 2991
             G KG  G +G  G    IG            +      +G +G  G  G +G      QG QG  G +G  G  G PG  G +G                     LPG  G  GD G+ G  GA G                       +KG  G  G  GL G +G  G +G +G +G       GL+G +GP+G  G  G  G  G VG  G+ G  G   K       G  G+KG +G KGK GL G              G  GI G  G PG DG+ G  G  G  G  G  G KG  G+ G S  + F    G KGD G DG +G KG  G+ G+ G  G  G +G  G+ GD G PGM G              ++ + G RG +G+ G   + G  G +GD G   I   + L     G  G  G+PG +G IG+ G  G+QG KG                               PG  G  GL G+ G IG QG  G  G  G+ GA G +   GA+G+PG  G++G+ G  G+ G +G +G  G  G IG QG+ GEQG    FGPKG  G  G+ G PG  G   + G+KG  G  GV G +G  G  GD G   S  G  G+ G  GP G +G  GE+G  G +GE G +G+
Sbjct:  251 RGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGH-----QGVQGAKGKRGLPGEAGSPGLVGPVG---------------------LPGPEGIQGDPGQKGFEGAKG-----------------------IKGFPGSPGSMGLMGSRGTPGDQGGRGPQG-----VQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGK------EGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPG--------------SRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVS-GKAGSIGDPGKKGNIGEKGPSGEQGMKGD------------------------------PGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGP---FGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGK 809          

HSP 6 Score: 115.546 bits (288), Expect = 8.822e-26
Identity = 227/616 (36.85%), Postives = 288/616 (46.75%), Query Frame = 1
Query: 2800 IKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGN----------GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGA 4614
             +G  GEPG +G  G+    G   E     +  E      KG +G+KG  G  G +G  G  G+ G  GE G  GL GP   VG+ G  G  G PG  G +GA   KGI G  G  G MG+ G+ G  GDQG         RG +G  G++G+ G +G  GE G RG KG  G  G IG+KGE G  G  G KG++G +G+ G  G  GP GP G  G KG  G IG+                   G+ GKDG +G +G SG  G  G   KG+ G +G  GP+G  G  G            R G +GD G  G  G KG  G  G  GPQG  GP G  G  G+ G  G  G  G  G  GP+G+ G SG       G  G  G PGK GI+G +GL+G+ GK G +GD GK GN          G++G  GD GN+G  G  GI G  G  G  G+ G+QGA                                  G +GPRG +G  G +G++G +G +G  G+ G KG  G +G  G++G        ++G  G  G  GD+G  G  G  G   V G KG+KG  G+ G+ GQ     G  G IGP G+
Sbjct:  250 YRGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGP---VGLPGPEGIQGDPGQKGFEGA---KGIKGFPGSPGSMGLMGSRGTPGDQG--------GRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGK------------------SGSPGKDGSEGPTGESGPTGALGA--KGQKGGVGSIGPSGLQGFQG------------RMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSG-----LPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGA---------------------------------AGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGD-----RGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQH----GTPGDIGPPGS 772          

HSP 7 Score: 109.383 bits (272), Expect = 6.950e-24
Identity = 213/629 (33.86%), Postives = 267/629 (42.45%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGN---VGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNC-TINFVKPLNAT----------EMGDRGDTGEPGLQG------PIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKG---DIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----GIKGNEGSRGEE----GETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKG 2745
            G+ GA G RG  G+ G+   VG  G PGP+G  G  G KG  G+ G+ GF G  G  G+          GS+G  G+ GG        +GPQG  G  GD+G +G PG QG  G KG                    G  G IG KGE G+ G  G +G+ G                  KG  G  GD+G  G  G  G KG  G  G SG P    + G  G  GP G  G  G  G  G +GP G++G  G              G+KG+ G  G DG  G  GN GI G +G     G IG +G  GD+G  G+PG +G+ G +G             +GD G  G  GP G +G PG   KPGI G  G  GV G  G+                    K   GE+G  GE+G+K   G++G +G  G+   I    P   T            G RG  G PG QG      PIGK GV G +G  G+                         G  G+ G RG+ G  G KG   D+G++G  G  G  G  G KG  G IG PG     G  G+ G  G E    G+TG+R      G +G++G  GE+G +G  G KGF G
Sbjct:  306 GVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGL---------MGSRGTPGDQGG--------RGPQGVQGLLGDRGPRGPPGEQGFRGVKGAV------------------GSHGLIGRKGEKGKEGRDGVKGERG-----------------SKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRM------------GLKGDAGYDGVDGFKGHAGNTGIPGPQG---TMGPIGAKGILGDVGAPGMPGSRGLNGTRG------------PEGDLGHSGLPGPPGFQGDPG---KPGIRGHEGLQGVSGKAGS--------------IGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAK------------------------GRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLR------GPMGHKGPDGEKGYVGKRGEKGFMG 808          

HSP 8 Score: 105.531 bits (262), Expect = 1.018e-22
Identity = 205/614 (33.39%), Postives = 264/614 (43.00%), Query Frame = 1
Query:  241 VGIPGP---KGDYGRIGNPGPIGPKGY---TGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSG-RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDS----REETFP---SIKGEKGDNGPDGKEGPKGIKGSPGLNGK 2040
            VG+PGP   +GD G+ G  G  G KG+    G+MG +G+RG  GD G  G  G+ G                     L GDRG  G PG  G  G KG  G  G +G  G+KG +G  G  GE        +G KG +G  G  G  G  G  G +G  G  G  G  G  G +GP G SG  G     +  KG+KG  G IG +G    L   +G+                              GL G  G  G  G  G+ GN G PGP+G  G  GAKGI G  G  G                    GS+G              + G +GP GD G  G  G PG+QG+ G+ G +G  G  G  G  G    PGK+G+IG+KG +GE G  G  GD G                  +G+ GD G  G+QG  G++G  G +G  GPSG R   G  GP+G +G++G  G  G +G  G  G KG +G                   QG++G+ G  G  G  G  G +G PG++G+ G  G  G  G  G+PG +G  G  GD      E   P    ++G  G  GPDG++G  G +G  G  GK
Sbjct:  329 VGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQG---------------------LLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGE--------RGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTG----ALGAKGQKGGVGSIGPSG----LQGFQGRM-----------------------------GLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMP------------------GSRG--------------LNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGN-----------------EGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGL------------------QGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGK 809          

HSP 9 Score: 104.76 bits (260), Expect = 1.686e-22
Identity = 232/702 (33.05%), Postives = 296/702 (42.17%), Query Frame = 1
Query:  466 RGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPG-DFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKR---GQSGLDGEKGDIGNQGMKGDIGDK 2547
            +G  GL G  G  G +G  G  GK GL G+ G  G  G +G PG +  Q   G+KGF                     +G +G KG  G  G  G +G  G PGDQ      +G +G  G +GD G          + PP ++G  G KG  G  G  G KG  G+ G DG  G+RG KG +G  G++G  GP G PG KGA GI G  G  G  G EG  G  G  G  G +G KG VG  G SG     +QG QG  G KGD G  G+ G++G+ G  G                  +PG +G +G  G                                 KGI GD G  G+ G +G++G++G +G+ G SG P      G  G  G +G +GL G+ GK G +G  G KG                     N GEKG  G  G  G+PG  G+ G PG+ G IG +G        G+ G  G +GA G S            G  G  G  GP+G++G  G  GKPG+SG  G +G KG  G                       +QG+RG QG  G K   G+ G KG  G+              G  G  G  G++GPIG  G +G  G  G  G  G +                  GVPG  G R   G  G DGEKG +G +G KG +G +
Sbjct:  290 KGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGF---------------------EGAKGIKGFPGSPGSMGLMGSRGTPGDQ----GGRGPQGVQGLLGDRGP---------RGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSG-----LQGFQGRMGLKGDAGYDGVDGFKGHAGNTG------------------IPGPQGTMGPIG--------------------------------AKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKG---------------------NIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGP------PGVTGKDGQQGAAGPS------------GPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIG-----------------------LQGDRGEQGPFGPKGAGGDMGSKGPPGS-------------EGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSE-----------------SGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGKQ 810          

HSP 10 Score: 73.559 bits (179), Expect = 5.937e-13
Identity = 140/426 (32.86%), Postives = 186/426 (43.66%), Query Frame = 1
Query:  238 CVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGAR------------------GLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPI---GMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGK---RGDIGDKGENGESGAHGPRGDFGF 1443
             +GI G  G  G+ G+ GP G  G TG +G  G +                  GL GD+G +G DG  G  G +G  G  G  G  G  G+ GD G  G+PG  G NG +G +G  G  GL G  G +GD G  G      +  +G +G +G                    G  GD G +G++G++GP    GM G+PGD+       G +G PG IG  G          + PP   G  G++                  G  G  G RG  G  G  G  G  GP G+PG  G KG  G+ G IG +G  G++G  G +G  G+ GSKG  G  G +G  +  ++G +GP G  G +G  G PG  G  G +                 S +PGK   RG +G KG +GE G  G RG+ GF
Sbjct:  457 AIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPG-----IRGHEGLQGVSGKA------------------GSIGDPGKKGNIGEKGPSGEQGMKGDPGDE-------GNEGLPGDIGIIGM---------QGPPGVTGKDGQQ------------------GAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTG--VYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSE-----------------SGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGF 806          

HSP 11 Score: 51.2174 bits (121), Expect = 4.968e-6
Identity = 118/373 (31.64%), Postives = 148/373 (39.68%), Query Frame = 1
Query:  202 NCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ----PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGF 1308
            N      Q T   +G  G  GD G  G PG  G  G  G  G+LG  GL G  G  G  G PG RG                             G  G +G+ G+ G  GK G  G+KG  G++G  G+PGD                                +G++G  G  G +G QGP G++G+ G Q    P G   +G  G PGP G  G                RG  G+ G  G KG  G KG  G  G  G  G  G KG  G++G++G PG +G  G  G KG++G  GV GF                G  G+ G++G  G      G   G +GP G KG  G +   GY G  GEKGF
Sbjct:  529 NTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHE---------------------------GLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGD--------------------------------EGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSG--PRGALGHPGPQGLEG---------------DRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGF---------------RGQHGTPGDIGPPGSESGVPGKT-GLRGPMGHKGPDGEK---GYVGKRGEKGF 806          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Nematostella
Match: EDO30432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0T5])

HSP 1 Score: 155.992 bits (393), Expect = 1.136e-40
Identity = 149/404 (36.88%), Postives = 202/404 (50.00%), Query Frame = 1
Query: 2152 AKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVK-PLNAT-EMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETK-------GQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGET 3324
            A+  +G RGL G++G + + G KG++G  G       + P   T   G +G  G  GL+GPIG  G+KG +G  G  G                       G+ G  G RG  GL G +G  G QG  G  G +G  G +G TG  G  G     G +G  G RG  G TG+RG+PG +G  G  G++G  G  G  GP+G++G+ G+ G  G  G + ++G  G  G  GV G  G  G++G +G    RG  G RG  G +G RG+KG +G+ G  G++G  GR G  G  G +G  GP+G  G+ G +G  G  G  GP G TG +G+ G+ G  G  G  G  G +G QG KGL+ K       G RG KG+ G  G  G  G  G  G+RG +G   E+
Sbjct:   35 ARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRG---------------------LRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKTGATGPQGLRGYRGKTIES 417          

HSP 2 Score: 152.91 bits (385), Expect = 1.646e-39
Identity = 163/482 (33.82%), Postives = 220/482 (45.64%), Query Frame = 1
Query: 1807 PGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGP---DGKEGPKGIKGSPGLNGK---PGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGES------GMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETK 3216
            PG RG RG     GA G +G+ G  G RGLPG +G +G KG   +     + G  G  GP    G  GPKGI+G  GL G     G+ G  G MG +G  G                     K   G RG +G KG + + G +G+ G  G   +           G RG TG+PGL GP G  G +G  G +G  G                       G+ G+PGK G++G  G+ G  G +G  G  G +G +G+KG  GA              RG++G  G  G PG  G  G  G  G+ G  G  GP+G +G++G      P G++ ++G+KG  G  G  G  G  G +G  G    RG+ G RG  G KG +G++G  G+ G +G +      G+ GRTG+ G  G  GL GP+G  G+ G              GATGP+G+ G+KG +G  G +G  G  G QG +G   K
Sbjct:   18 PGPRGLRG---YTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRG--------------------LKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLR----------GYRGFTGKPGLTGPRGLKGARGATGPRGYTGR---------------------TGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGARGA--------------RGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRG------PQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGK------------TGATGPRGLRGLKGSRGWTGPRGKTGATGPQGLRGYRGK 413          

HSP 3 Score: 147.902 bits (372), Expect = 6.870e-38
Identity = 168/497 (33.80%), Postives = 226/497 (45.47%), Query Frame = 1
Query: 1495 KGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGK---EGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGES 2976
            +G++G +G  GL+G +G  G +G+ G+RG          G KG KG++GL GL G  GK GP+G  G                                   G  GIRG RG  G  G  G +GS G +G RGL G KG  G++G      +  +KG +G  GP GK    GP+G++G  G  GKPG++G  G  G +G                            G RG  G  G++ + G+ G  G  G       +P     MG RG  G   L G  G  G +G QG +G+ G  G+                  +GVPG PG +G++G  G  G  G +G++G  G++G  G KG  G  G PG    G +G  G  G TG RG  G  G  G +G  G +G  G  GP+GF G +G  G PG  G     G  G  G  G++GLKG TG +G +G    RG  G RG  GP+G+ G  G QG+ G +G++
Sbjct:   21 RGLRGYTGARGLKGARGYRGWRGLPGQRG--------YRGLKGAKGQRGLRGLTGATGKQGPRGWTGA---------------------------------RGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRG------YRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARG--------------------------ATGPRGYTGRTGLRGVPGKSGRNGTPGKNG----RPGAKGAMGPRGYRG---LTGSKGARGARGKQGLRGATGRPGR------------------NGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGK--NGAKGRNGAPGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGL---RGLKGSRGWTGPRGKTGATGPQGLRGYRGKT 414          

HSP 4 Score: 140.584 bits (353), Expect = 2.277e-35
Identity = 163/509 (32.02%), Postives = 224/509 (44.01%), Query Frame = 1
Query: 1621 GPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGE 3144
            GP+G +G +G  G  G  G +G +GL                      G++G  GL G  G  G+RG  G  G  G  G  G+ G  G RGL G KG  G +G      F   +G +G  G  G  G +G+KGS GL G  G +G  G  G++G  G                         G+ GL G +G+K   G  G +G +G   +  V P  +   G  G  G PG +G +G  G +G  G+KG+                               G RG+ GL G  G  G  G+ G  G KG++GA+G TG  G  G+ G +GN+G RG +G  G++G PG  G  G  G  G  G  G  GP+GF G+KG             KG++G +G   ++G +GFTG+ G       RG  G  G  G  G+ G++G QG+ G KG++G  G  G  G KG +G  GP+G                    GATGP+G+ G +G+
Sbjct:   19 GPRGLRGYTGARGLKGARGYRGWRGL---------------------PGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRG-----------------------FTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGV-PGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGAR------------------------------GARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKG------------AKGVRGATG---LRGPRGFTGKQGL------RGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKT------------------GATGPQGLRGYRGK 413          

HSP 5 Score: 124.79 bits (312), Expect = 4.507e-30
Identity = 167/474 (35.23%), Postives = 214/474 (45.15%), Query Frame = 1
Query: 2599 GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC-QQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKI 4017
            G++G  G+RG +G  G RG  G+ G  G +G  G +G       +G +G+ G TGK GP      +G  G  G  G++GL+G  G  G       RG  G RG +GP+G RG+KG  G  G +G  G  G TG  G+ G +G  G +G  G  G  G TG  G  G  GATGP+G  G  G +G+ G  G NG  G  G  G   KG  G +G  G+ G+ GA+G  G+ G+RG+         G+ G +G  G  GSKG+ G  G                                                     GP+GL G+ G +G  G  L+G  G  G  G  G  G  G  G  G  G  G+ G  G  G KG KGV+G  G +G  G  G QG +G  G  G+TG  G  G  G +G  G KG  G +GP   +G  G+RG  G  GK G  G QGL G  GK 
Sbjct:   22 GLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQ------RGLRGLTGATGKQGP------RGWTGARGPKGIRGLRGLKGPIGP------RGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPG--AKGAMGPRGYRGLTGSKGARGARGKQGLRGA--------TGRPGRNGVPGRPGSKGKTGARGA---------------------------------------------------TGPRGLRGLRGPQGNQG--LRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKTGATGPQGLRGYRGKT 414          

HSP 6 Score: 123.635 bits (309), Expect = 1.078e-29
Identity = 164/494 (33.20%), Postives = 218/494 (44.13%), Query Frame = 1
Query: 1219 QGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGES 2697
            +G +G  G +G KG +G  G++G  G++G++G               L G +G  G +G  G +G  GPRG  G  G  G         + ++G+KG  G  GL+G +G  G +G++G +G     TTG  G +G KG +GL+G  GK G  GP+G++G  G   K                G  G  GL G  G  G RG  GR G  G  G+ G  G  G  G PG KG  G +G      +  + G KG  G  GK+G +G  G PG NG PG  G  GK G +G  G                        +G RGL+G +G + + G KG +G  G    N  K  N       G TG  G  GP G  G+KG +G +G+ G                       G  G  GK+G  G+ G  G  G  G  G  G +G  G KG TGA G  G+ G+KG+ G  G  G+TG  G  G+ G  G   ES
Sbjct:   21 RGLRGYTGARGLKGARGYRGWRGLPGQRGYRG---------------LKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGI--------RGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKG-----TTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGK---------------PGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRG------YRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATG-----------------------PRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAP----GRTGARGKIGPRGFTGLKGAKGVRGATG---------------------LRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRGKTGATGPQGLRGYRGKTIES 417          

HSP 7 Score: 123.635 bits (309), Expect = 1.088e-29
Identity = 169/530 (31.89%), Postives = 224/530 (42.26%), Query Frame = 1
Query:  964 GLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGM---KGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGD 2544
            GL G  G RG KG  G  G RG PG +G  G KGAKG RG  G+ G                               +GK     QGP+G  G +G KG +G+ G +G +G +G K                  G RG +G +G  G  G  G RG                     +G+KG  G  G QG+ G  G +G++G RG +G+P  GL GP+G KG +G +G  G  G+ G +G+    G  GT  K  + G  G  G +G +G  G  G  G  G  G+RG  GRPG +G  GR GS G  G RG  G +G++G +G    +    +KG +G  G  GK G KG  G+PG  G  G  G  G  G+KG +G                       V+G  GL+G +G     G +G  G +G    N                G+PGL+GP G  G+KG  GA G                          G+ G+ G RG +G  G+ G  G QG++G  G 
Sbjct:   22 GLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGA------------------------------TGK-----QGPRGWTGARGPKGIRGLRGLKGPIGPRGLK------------------GSRGFMGPRGLRGLKGTTGSRG--------------------YRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKP--GLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGLKGAKG-----------------------VRGATGLRGPRGFTGKQGLRGVPGRTGKTGAN----------------GKPGLRGPQGLKGLKGKTGATGP------------------------RGLRGLKGSRGWTGPRGKTGATGPQGLRGYRGK 413          

HSP 8 Score: 115.161 bits (287), Expect = 7.603e-27
Identity = 146/407 (35.87%), Postives = 197/407 (48.40%), Query Frame = 1
Query: 2923 GERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-------TKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT----LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGN---KGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFG---EDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
            G RG++G  G  G KG  G  G  G  G++G +GL G KG  G+ G  G TGK GP G  GA GPKGI G++G +G +G +G  G +G  G +GL        ++G RG KG+ G+ G  G  G  G  G+RG +G  G+ G+   G  G  G  G+ G +G  G  G  G  G  G  G  G  G  G  G +                        GP+G  G++G KG  G      L+G +G  G NG                  +PGR G++G  G +G    +G++G  GP+GN G +G +G +G  G  G+ G KG  G     G +G +GP+G  GL     +G  G RG  G  G  G  G+QGL G+PG+ G+ G  GKP  G+ GP G  G KG+
Sbjct:   19 GPRGLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGL--TGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAM------------------------GPRGYRGLTGSKGARGARGKQGLRGATGRPGRNG------------------VPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPGRTGARGKIGPRGFTGL-----KGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKP--GLRGPQGLKGLKGK 374          

HSP 9 Score: 113.62 bits (283), Expect = 2.362e-26
Identity = 101/253 (39.92%), Postives = 136/253 (53.75%), Query Frame = 1
Query: 2698 GEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGE---FGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGE---KGDQGLNGPKGNV------GVIGDRGETGKPGPIGP------DGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI----GQKGESGSNGEFGSKGQKGM 3390
            G +G  G  G +G KG +G  G  G  G +  +G+KG  G+ G++GL G TG+ G +G    RG     G RG  GP G RG+KG +G  G +G  G+ G TG  G    KG +GL GP+G        G+ G RG TGKPG  GP       GATGP+G  G  G +G+ G  G NG  G  G  G   KG  G +G  G+ G+ GA+G  G+ G+RG+ G  G  G+    G KG++G+ G  G +G +G+
Sbjct:   19 GPRGLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPG--AKGAMGPRGYRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGL 269          

HSP 10 Score: 105.916 bits (263), Expect = 9.677e-24
Identity = 168/481 (34.93%), Postives = 220/481 (45.74%), Query Frame = 1
Query:  286 PGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGM------SGEPGDQ-PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGT 1707
            PGP G +GYT      GARGL G  G  G  GLPG RG                 GL G +G  GL G  G  G++G  G  G  G  G +G++G KG IG  G      KG +GF G  G  G KG  G  G RG+ G +G  G +G  G +GP G+      +G+PG   P+G+  KG +G  GP G  G      V      P + G +            G  G  G PG  GA+G RG +G TG+ G RG    +G+ G +GA G  G +GV G                    GSKG+ G  G +        GP+G  G +G +GNQG+ G +G+ G +G                   PGK G  G  G  G +GA G  G  GF G              +KG KG  G  GL+G +G +G +G++G  G +G+  TG  G  G +G +GL GL GK G  GP+G++GL G+
Sbjct:   18 PGPRGLRGYT------GARGLKGARGYRGWRGLPGQRGYR---------------GLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGL-----KGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGL--KGARGATGPRGYTGRTGLRGV------PGKSGRN------------GTPGKNGRPGAKGAMGPRGYRGLTGSKGARGA---RGKQGLRGATGRPGRNGVPGRP------------------GSKGKTGARGAT--------GPRGLRGLRGPQGNQGLRGLKGSRGVQG------------------RPGKNGAKGRNGAPGRTGARGKIGPRGFTG--------------LKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGK--TGANGKPGLRGPQGLKGLKGKTGATGPRGLRGLKGS 389          

HSP 11 Score: 82.4185 bits (202), Expect = 4.170e-16
Identity = 143/368 (38.86%), Postives = 186/368 (50.54%), Query Frame = 1
Query: 3556 GPKGLSGISGEKGLSGIT-LKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQG------PKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVG---IKGEQGLEGLPGKIGRMGDKGKPG----NGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQ--EQGMVGDKGSIGPQG 4611
            GP+GL G +G +GL G    +G  G  G  G  G  G  G +G +G  G  G+QG  G  G +G KG++G  G KG +GP+G +G      P+G  G KG TG +G  G  G +G  GP+G  G  GP  QG  G RG  G PG  G   +KG +G  G  G  GR G +G PG    NG  G +G  G KG  G +G +G +G KG  G  G+QG +G  G  G  G  G  G  G  G +G  G +G++G  GP+G+ GL G+KG +G +G  G  G  G  G                    + G RG+IG  G  G  G+KG  G   +RGP+G  G+QGL G  G+  + G  G  G  GPQG
Sbjct:   19 GPRGLRGYTGARGLKGARGYRGWRGLPGQRGYRGLKGAKGQRGLRGLTGATGKQGPRGWTGARGPKGIRGLRGLKGPIGPRGLKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGP--QGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTGSKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGA-----------------PGRTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFTGKQGLRGVPGRTGKTGANGKPGLRGPQG 367          

HSP 12 Score: 70.8626 bits (172), Expect = 1.790e-12
Identity = 127/393 (32.32%), Postives = 176/393 (44.78%), Query Frame = 1
Query: 3550 KDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQG---------------PKGNTGSKGETGPKGDFGEDG---------------------DKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE--QGMVGDKGSIGPQG 4611
            K GP+G +G  G KG+ G  L+G  GPIG  G      L G +G  G +GL G +G  G  G +G KG +G  GP+G  G +G QG               P+G  G++G TGP+G  G  G                      KG +GP+G +GL+G   +G  G RG+ G  G  G  G  G+ G PG  G+ G +G  G  G+ G  G  GN+G  G +G +G  G  G++G  GR GA G                                   G RG +G  G  G++G KG  G+TG+ G +G                      G +G  G PG  GK G+ G   +P +RGP+G+KG +G +G +G    +G+ G +G  GP+G
Sbjct:   71 KQGPRGWTGARGPKGIRG--LRGLKGPIGPRG------LKGSRGFMGPRGLRGLKGTTGSRGYRGLKGSRGLTGPQGKTGARGPQGLRGYRGFTGKPGLTGPRGLKGARGATGPRGYTGRTGLRGVPGKSGRNGTPGKNGRPGAKGAMGPRGYRGLTG--SKGARGARGKQGLRGATGRPGRNGVPGRPGSKGKTGARGATGPRGLRGLRGPQGNQGLRGLKGSRGVQGRPGKNGAKGRNGAPG---------------------------------RTGARGKIGPRGFTGLKGAKGVRGATGLRGPRGFT--------------------GKQGLRGVPGRTGKTGANG---KPGLRGPQGLKGLKGKTGATGPRGLRGLKGSRGWTGPRG 397          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Medaka
Match: col4a1 (collagen type IV alpha 1 chain [Source:NCBI gene;Acc:100415780])

HSP 1 Score: 361.688 bits (927), Expect = 2.657e-101
Identity = 503/1420 (35.42%), Postives = 662/1420 (46.62%), Query Frame = 1
Query: 1372 RGDIGDKGENGESGAH--GPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEK--GISGSKGVKGERGPSGRPTTGL--VGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPG---LNGKPGISGDMGKMGVKGD---EGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS--DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI-----------------------KGIKGDSGEPGVQGL-----------KGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGE--IXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKG-----------NVGPKGNKGLSG----PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKI--GRMGDKGKPGN-GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGV------KGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQ--NVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            +G  G +GE G +G H  GPRG+ G                  KG  G  GD G+ GE   G  G  G KGE GP G+P   L  +  KG  G  GL GL G+ G+      KG  G  C  C+   I         GE G  G  G  G PG  G +G  G  G  G  G  G  G+ GL G  G  GA GD      P +KGEKG  G  G +G  G+ G PG   L G+PG+ G+  K G+KG+   +G PG  G  GE G  G  G      +G++G QG  G     G  G KG+ G   ++   P      G RG+ G PG+QG   + G++GD G  G   D         G PG  G KG  G  G PG+PG+ G+ G DG  G  G+ G KG+ G                     +G  G +G +G  G+ G PG  G+IG  G  G++G  G  GP+G KG  G  G PG  G                           +GIKGD G PG  GL            GF G  G +G     G  G  G +G +G +G  G  G+ G +G  G  G  G  G +GD G  GP G  G  G +GE G+PG  GP G      +  +KGE+G  G +G+ G  GD+G +G++        G+ G+ G  G  G  G+PG +G +G  GE G +G  G+ GS GE G  G  G +G KGD G  G  G  GL G KG+ G  GE  IG  G  G+ G  G  G  G+ G+ G KG SG+ G  G+ G   KG+ G IG  G                    GR G++GD G  G+ G  G  G  G  G QG  GP+G+ G  GE G  G  GE GD G            +G KG+KG SG    P   G  G +G+ G PG  G +GE G  GLPG    G  GD+G+ GN G  GP G IG  G  G                  R G KG KG  G  G  GETG+ G  G+ G  G  G+ G +G +G+ GL G+ G  G KGE+G  G  G +                     +   +G++G PG  G  G +G  G P ++G +G+      KG+ G+ GY G    + G KG   P     +  +     P           P   +++  FL TRH Q  E  P+CP G+  I++GYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL S  P+   M  +   +++ +ISRC  CE+PA   A HSQT  + +  CPE W  LW GYSFVMHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  ++    F+ P    +KA + ++     ++SRC+VCMK+
Sbjct:  341 KGFPGPQGEPGPAGRHIEGPRGEPG-----------------QKGDVGQKGDRGVLGESLPGPPGQPGKKGEPGPPGQPVDPLACILAKGNSGPPGLPGLQGEEGQ------KGDKGDTCVHCETSGII--------GEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVV--IAPGLKGEKGFPGRPGLQGQPGLDGLPGRDGLPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGFGQPGERGDKGGQGRPGTPGAPGLPGLKGEPGK-GVSIPGPQGVP--GPRGENGLPGIQG---ERGLQGDPGLPGFPGDKGEQGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPG---------------------RGLPGPKGFQGPPGITGFPGQKGNIGLPGIPGQEGQTGPPGPQGLKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMGNMGMPGVQGFPGSPGLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQ--------GDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQKGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGP--KGDKGSIGYQG------------------QAGRPGDKGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISLQGPKGDRGETGNQGAPGPKGVIGEAGFPG------------------RDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPGQTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGFKG-EVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPGPKGDNGVPGYDG----LPGAKGE--PGLPGPQGPRGYPGPPGPDGVPGQVGAPGPSSMDHGFLVTRHSQAVE-VPLCPGGTRLIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTSPEPMPMSMAPITGDSIKPFISRCAVCEAPAMVIAVHSQTIRIPE--CPEGWDSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATIEDSNMFKKPIPTTLKAGELRT-----QISRCQVCMKR 1638          

HSP 2 Score: 215.312 bits (547), Expect = 1.349e-55
Identity = 379/1059 (35.79%), Postives = 482/1059 (45.51%), Query Frame = 1
Query:  208 NTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGD---------KGVKGDKGYIGEPGDFFQAKKGE----KGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKT-------PPDQRGD--SXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGS--KGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESG--AHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKG---LLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFG--------PKGFKGIKGNTGKPGP---VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGV-------IGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGE 3231
            +T     T   +G PGP+G  G  G PGP+G KG  G  G  G  G  G  G+ G  G PG  G  GD  I             G +G+ G PG  G  G+ G DGL G+ GL G          +G+KG++G  GEPG      +       GF                      G++GDKG +G  G  G  G+ G  G+  KG++  G +G PGP G+ G    L  ++G+         P   GD         G  G +G KG +G PG  G  G+ G+ G  G  G  G+PG KG+PG    G KG +G  G+ GF                   G KG +G  G  G+      GP GP G KGD G  G+PG Q        KG+PGP GP G  G+    G+ G  GDKG  G  G    GP+G+ G  G  G  G  G  G       G  G  G QG KG  G+ G+ G +G  G P  GL G  G +G+ G +G  G++G+ GPKG +G   L G   ++        KG KG+ G++G  G++G  G  G++GD G PG DG  G  G  GD GDRG PG+ G  G  G          KG  G+ G  G  GPKG KG  G  G PG  G  G+ G  G  G PG+                   V G++G  G+ G+    GEKGEKG SG        P +    G +GD G  G QG  G+ G KGD G  GS                   G  G DG PG  G +G SG  G+KG+ G  G+ G  G++G  G  G         +G KG++GS G  G  G  G+PGI GD G  G  G QG+ G  G        PKG +G  GN G PGP   +G+    G  G+ GE G QGL GF GE+G KG+    G  G+ G  G  G++G +G QG+ G  G  G IG  G  GE GD+G  G KG  G        +  +G+ G PG  G  G  GP G  G+KG+QG+ G  G   PKGD G  G +     KG+ G 
Sbjct:  435 DTCVHCETSGIIGEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVIAP-----------GLKGEKGFPGRPGLQGQPGLDGLPGRDGLPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGFG-------------------QPGERGDKGGQGRPGTPGAPGLPGLKGEPGKGVSIPGPQGVPGPRGENG----LPGIQGERGLQGDPGLPGFPGDKGEQGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPGRGLPGPKGFQGPPGITGFP------------------GQKGNIGLPGIPGQE--GQTGPPGPQGLKGDIGPPGLPG-QTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGS--AGRDGQIGTQGRKGEMGNMGMPGVQGFPGSP--GLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQ---------KGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPG---------------VPGQKGHTGDPGVPGSPGEKGEKGYSG-------MPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGLPGS------------------VGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISLQGPKGDRGETGNQGAPGPKGVIGEAGFPGRDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPGQTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGFKGEVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPG---PKGDNGVPGYDGLPGAKGEPGL 1382          

HSP 3 Score: 212.231 bits (539), Expect = 1.129e-54
Identity = 386/1145 (33.71%), Postives = 497/1145 (43.41%), Query Frame = 1
Query:  247 IPGPKGDYGRIGNPGPIG----PKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAG---KMGLSGDKGVKGDKGYIGEPGDFFQAK--KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGN----VGNRGTPGPKGQ---PGSKGAKGIRGSDGVIGFX--------XXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGI-----------------------SGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLD------------GKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNG------PDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKG-----------------FKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKG---ESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKG----------NMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            +PGP G  G+ G PGP G    P       G  G  GL G  G  GQ G   D+G++  +               G +GD G PG  G+ G+KG  G  G   + G  G+ G+ G  G +G PGD   A   KGEKGF G  G               + G  G  G+ G  G  G  G+ GEP  +  GI  ++G  G PG IG  G      +  G   P +RGD G +G                PG  GA G  G KG+ G      G +G PGP+G+   PG +G +G++G  G+ GF            G  G  G +G  G  G+ G  GE G  GK    + G  G  G KG+ G +G+PG +G  G  G                +  PG++G+IG  G  G+ G  GP G                     +G+KGD G  GL G+ G                         G +G+KG++G  G P   + GP+G KG  G  G+             G++G++G +G KG +G                  N G  G  G  G  G PG  G RG PG  G  G  G  G  G+RG PG   ++G  G+  +     +KGEKGD G        G  G +G++G PG+ GK G  G  G+ G KGD G PG  G  G                G++G  GE GI    G KG KGD G       K L+    G++GDTG PG  G IG  GV G +G  G                          GVPG PG++G+ G  G  G  G QG KGD G  G  G  G  G  G+PG+   G+ G  G +G  G  GL G +G  G++GE GE G  G+ G +G                  KG KG++G PG  G+  + GIKGD G PG QG +G TGE G  G              GPKG+RG  G QG  G KG   E+G  GR GE GEKG QGL G +G  G  GD G  G PG       TG  GI+G KGE+G+ GV G  G KG+ G+ G   KG+ G++G                 +  KG++G PG++G  G  G  G  G KG+ G  G  G KG  G+
Sbjct:  383 LPGPPGQPGKKGEPGPPGQPVDPLACILAKGNSGPPGLPGLQGEEGQKG---DKGDTCVHCETSGIIGEPGPQ--GPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVIAPGLKGEKGFPGRPG---------------LQGQPGLDGLPGRDGLPGQPGLKGEPAKE--GIKGERGRDGEPGQIGPPGERGPPGI-AGFGQPGERGDKGGQGR---------------PGTPGAPGLPGLKGEPGKGVSIPGPQGVPGPRGENGLPGIQGERGLQGDPGLPGFPGDKGEQGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGK--DGLTGQAGSPGQKGEPG-RGLPGPKGFQGPPGI---------------TGFPGQKGNIGLPGIPGQEGQTGPPGP--------------------QGLKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMG------------------NMGMPGVQGFPGSPGLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPG---LQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGP--------------PGQKGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLD----GEKGDTGSPGEPG-IGVPGVPGQKGHTGDP------------------------GVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGL--PGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISL----------QGPKGDRGETGNQGAPGPKGVIGEAGFPGRDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPG------QTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGF--KGEVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPGPKGDNGV 1367          

HSP 4 Score: 196.052 bits (497), Expect = 1.029e-49
Identity = 330/927 (35.60%), Postives = 420/927 (45.31%), Query Frame = 1
Query:  694 MDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRG-TPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGD--RGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIK-----PIDGEKGEKGDSG--NCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA---------------KGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGEC--SGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDG---------ATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNG 3360
            ++G +G+ G +GDVG +G  G+ GE    P G  Q G+KG PGP G         + KG + P                          PGL G  G+ GQKGD G+      T G  G+PG +G KG +G  G +G KG +GQ G  G+ G+ G++G+ G +G  G  G     +  P    G KG+KG  G PG QG  G  G  G  G            LPG+ G  G+  + G  G  G  G+ G  G  G+ G  G  G    G +GD G +G  G  G  G  G+KGE G  G    G  G  GP+GE GL G+ G+ G  G  G+ G  G   +             G  G  G  G +G  G PG+ G+ GRPG DG  G+ GS G  G+  RGLPG KG +G  G +    FP   G+KG+ G  G  G +G  G PG  G   + GD+G  G+ G  G PG  G                   G  G++G+KG        + G +GEKG  G          P      G  G  G  G +G +G +G+ G QG  GS                         G+PG PG RG  G  G  G+ G  G KG+ G+ G  G                KGDTG  G+PG+ G +G +G +G+ G  G  G PG  G  G++G+ G  G+ G+ GP G KG  G  G PGP G K   G KGD G PG  G KG  GE GD G     G G  G  G  G  G+ G+ G  G  G+KG SGM G  G  G KGD+G  G +G  G  GD+G+ G PG +G  G           GP G  G KGE G  G+ G+ G +GD G  G    G  GE G  G  G+ G  G  G PG+ G KGD G  G  G +GE+G  G
Sbjct:  357 IEGPRGEPGQKGDVGQKGDRGVLGESLPGPPG--QPGKKGEPGPPGQPVDPLACILAKGNSGP--------------------------PGLPGLQGEEGQKGDKGDTCVHCETSGIIGEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVIAP----GLKGEKGFPGRPGLQGQPGLDGLPGRDG------------LPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGFGQPGERGDKGGQGRPGTPGAPGLPGLKGEPG-KGVSIPGPQGVPGPRGENGLPGIQGERGLQGDPGLPGFPGDKGE-------QGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPGRGLPGPKGFQGPPGIT---GFP---GQKGNIGLPGIPGQEGQTGPPGPQG---LKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMGNMGMPGVQGFPGSP------------------------GLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQKGSLGEMGIPGPAGPK---GTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERG 1195          

HSP 5 Score: 181.415 bits (459), Expect = 2.886e-45
Identity = 288/839 (34.33%), Postives = 365/839 (43.50%), Query Frame = 1
Query: 1159 RGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKG----------VKGERGPSG-RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSRE---------------ETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPG----ISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGI---PGKRGQSGL------DGEKGDIGNQGMKGDIGD--------------------------------KGRSGAKGDTGAIGNPGIGIKGNEGSRGEEG---------ETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSG---------RGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRG---ETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG----IGQKGESGSNGEFGSKGQKG 3387
            +G  G  GE G +G+ I      +GP G+ G KG+ G  G +G LGE                    LPG  G  G KGE G  G                           KG  G  G  GLQGE+G  G KG          + GE GP G +   G  GP G KG+KG +G  G+NG+ G +G  GL+G    +   GD+               GL G  G PG  G +G+PG DG  GR+G  G  G +G P  +GIKG +G   E                 F    GE+GD G  G+ G  G  G PGL G+PG    I G  G  G +G+ G PG                    +QGERGLQG+ G+    G+KGE+G  G           +   G  G  G PGL G  G+ G  G  G  GS G  G+ G+              F G PGI   PG++G  GL      +G+ G  G QG+KGDIG                                  GR G KGD G  G PG+ + G +G +G  G           G  G  G  G IG QG  GE G++G  G +GF G  G  G PG  GD    G  G+SGEPG +G +G  G  G  GE +          +G+ G+RGD G  G+RG +G QG  G  G+ G  G  G+ G+KGD+G  G  G++G  G +G   E G PGP GP G  G  G  G  G +G+ G KG+ G  G+ G       GQ+G  G+ GV G+ G KGE G  GM GS G  G  G    IG +G++G  G+ G  G  G
Sbjct:  341 KGFPGPQGEPGPAGRHI------EGPRGEPGQKGDVGQKGDRGVLGES-------------------LPGPPGQPGKKGEPGPPGQP----------------VDPLACILAKGNSGPPGLPGLQGEEGQKGDKGDTCVHCETSGIIGEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVI-----------APGLKGEKGFPGRPGLQGQPGLDGLPGRDGLPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGF-GQPGERGDKGGQGRPGTPGAPGLPGLKGEPGKGVSIPGPQGVPGPRGENGLPG--------------------IQGERGLQGDPGLPGFPGDKGEQGPPGIGFPG-----PSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPGRGLPGPKG-------FQGPPGITGFPGQKGNIGLPGIPGQEGQTGPPGPQGLKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMGNMGMPGVQGFPGSPGLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQKGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGLPG 1094          

HSP 6 Score: 87.8113 bits (216), Expect = 9.943e-17
Identity = 190/560 (33.93%), Postives = 237/560 (42.32%), Query Frame = 1
Query:  259 KGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGD--------------TGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKG----------------------------ISGSKGVKGERGPSGRP----TTGLVGPKGPKGEKGLSGLDG------------------------------KNGKVGPKGM-KGLLGT 1707
            KGD G  G+PG  G +GY G  G+ G  G  G+ GS GQ G  GDRG  G+ G  G  G        G  G++G+PG  G  G KG+ G  G  G  G  G KGD G  GEPG       G+KG  GD G  G  GEKG  G  GM G  G +G +GD G  G  G +G PGD       KG+ G PG +G+ G D +      + P   RGD GE                  PG DG  G  G++GD               G  G++G+ G  G PG+ G  GI+G  G  G                   +G +GE GE G  G  +      QGP GD+G+ GNQG PG +G +GE GF G  G  G  G  G   LPG +G+ G KG+ G  G  G  G  G +G  G+ G  G  G    G KG+ GD G +GE G                              G +G+ G +GP+G P      G+ G  GPKG+ G+ G DG                              + G  GP  M  G L T
Sbjct:  920 KGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQK------GSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGD-------KGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGE------------------PGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPG------------------PQGPQGETGERGLPGISL------QGPKGDRGETGNQGAPGPKGVIGEAGFPGRDGEKGEKGSQG---LPGFQGETGHKGDPGVPGLPGQTGLPGIDGQKGERGLQGVPG--FPGTKGEIGDIGFKGEVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPGPKGDNGVPGYDGLPGAKGEPGLPGPQGPRGYPGPPGPDGVPGQVGAPGPSSMDHGFLVT 1419          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Medaka
Match: col4a1 (collagen type IV alpha 1 chain [Source:NCBI gene;Acc:100415780])

HSP 1 Score: 358.221 bits (918), Expect = 1.306e-100
Identity = 491/1377 (35.66%), Postives = 646/1377 (46.91%), Query Frame = 1
Query: 1495 KGIKGDSGDEGLQGEK--GISGSKGVKGERGPSGRPTTGL--VGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPG---LNGKPGISGDMGKMGVKGD---EGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS--DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI-----------------------KGIKGDSGEPGVQGL-----------KGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETG-IGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGE--IXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKG-----------NVGPKGNKGLSG----PCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKI--GRMGDKGKPGN-GIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGV------KGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQ--NVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            KG  G  GD G+ GE   G  G  G KGE GP G+P   L  +  KG  G  GL GL G+ G+      KG  G  C  C+   I         GE G  G  G  G PG  G +G  G  G  G  G  G  G+ GL G  G  GA GD      P +KGEKG  G  G +G  G+ G PG   L G+PG+ G+  K G+KG+   +G PG  G  GE G  G  G      +G++G QG  G     G  G KG+ G   ++   P      G RG+ G PG+QG   + G++GD G  G   D         G PG  G KG  G  G PG+PG+ G+ G DG  G  G+ G KG+ G                     +G  G +G +G  G+ G PG  G+IG  G  G++G  G  GP+G KG  G  G PG  G                           +GIKGD G PG  GL            GF G  G +G     G  G  G +G +G +G  G  G+ G +G  G  G  G  G +GD G  GP G  G  G +GE G+PG  GP G      +  +KGE+G  G +G+ G  GD+G +G++        G+ G+ G  G  G  G+PG +G +G  GE G +G  G+ GS GE G  G  G +G KGD G  G  G  GL G KG+ G  GE  IG  G  G+ G  G  G  G+ G+ G KG SG+ G  G+ G   KG+ G IG  G                    GR G++GD G  G+ G  G  G  G  G QG  GP+G+ G  GE G  G  GE GD G            +G KG+KG SG    P   G  G +G+ G PG  G +GE G  GLPG    G  GD+G+ GN G  GP G IG  G  G                  R G KG KG  G  G  GETG+ G  G+ G  G  G+ G +G +G+ GL G+ G  G KGE+G  G  G +                     +   +G++G PG  G  G +G  G P ++G +G+      KG+ G+ GY G    + G KG   P     +  +     P           P   +++  FL TRH Q  E  P+CP G+  I++GYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL S  P+   M  +   +++ +ISRC  CE+PA   A HSQT  + +  CPE W  LW GYSFVMHT+ G  G GQ+L+SPGSCL  FR +P +EC +G   CN++ ++ S++L  ++    F+ P    +KA + ++     ++SRC+VCMK+
Sbjct:  205 KGDVGQKGDRGVLGESLPGPPGQPGKKGEPGPPGQPVDPLACILAKGNSGPPGLPGLQGEEGQ------KGDKGDTCVHCETSGII--------GEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVV--IAPGLKGEKGFPGRPGLQGQPGLDGLPGRDGLPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGFGQPGERGDKGGQGRPGTPGAPGLPGLKGEPGK-GVSIPGPQGVP--GPRGENGLPGIQG---ERGLQGDPGLPGFPGDKGEQGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPG---------------------RGLPGPKGFQGPPGITGFPGQKGNIGLPGIPGQEGQTGPPGPQGLKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMGNMGMPGVQGFPGSPGLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQ--------GDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQKGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGP--KGDKGSIGYQG------------------QAGRPGDKGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISLQGPKGDRGETGNQGAPGPKGVIGEAGFPG------------------RDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPGQTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGFKG-EVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPGPKGDNGVPGYDG----LPGAKGE--PGLPGPQGPRGYPGPPGPDGVPGQVGAPGPSSMDHGFLVTRHSQAVE-VPLCPGGTRLIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTSPEPMPMSMAPITGDSIKPFISRCAVCEAPAMVIAVHSQTIRIPE--CPEGWDSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIEC-HGRGTCNYYANSYSFWLATIEDSNMFKKPIPTTLKAGELRT-----QISRCQVCMKR 1476          

HSP 2 Score: 217.624 bits (553), Expect = 2.364e-56
Identity = 380/1058 (35.92%), Postives = 483/1058 (45.65%), Query Frame = 1
Query:  208 NTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGD---------KGVKGDKGYIGEPGDFFQAKKGE----KGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKT-------PPDQRGD--SXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGS--KGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESG--AHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMK---GLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNF--------GPKGFKGIKGNTGKPGP---VGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGV-------IGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKG 3237
            +T     T   +G PGP+G  G  G PGP+G KG  G  G  G  G  G  G+ G  G PG  G  GD  I             G +G+ G PG  G  G+ G DGL G+ GL G          +G+KG++G  GEPG      +       GF                      G++GDKG +G  G  G  G+ G  G+  KG++  G +G PGP G+ G    L  ++G+         P   GD         G  G +G KG +G PG  G  G+ G+ G  G  G  G+PG KG+PG    G KG +G  G+ GF                   G KG +G  G  G+      GP GP G KGD G  G+PG Q        KG+PGP GP G  G+    G+ G  GDKG  G  G    GP+G+ G  G  G  G  G  G       G  G  G QG KG  G+ G+ G +G  G P  GL G  G +G+ G +G  G++G+ GPKG +   GL G   ++        KG KG+ G++G  G++G  G  G++GD G PG DG  G  G  GD GDRG PG+ G  G  G          KG  G+ G  G  GPKG KG  G  G PG  G  G+ G  G  G PG+                   V G++G  G+ G+    GEKGEKG SG        P +    G +GD G  G QG  G+ G KGD G  GS                   G  G DG PG  G +G SG  G+KG+ G  G+ G  G++G  G  G         +G KG++GS G  G  G  G+PGI GD G  G  G QG+ G          GPKG +G  GN G PGP   +G+    G  G+ GE G QGL GF GE+G KG+    G  G+ G  G  G++G +G QG+ G  G  G IG  G  GE GD+G  G KG  G        +  +G+ G PG  G  G  GP G  G+KG+QG+ G     GPKGD G  G +   G +GE G
Sbjct:  273 DTCVHCETSGIIGEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVIAP-----------GLKGEKGFPGRPGLQGQPGLDGLPGRDGLPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGFG-------------------QPGERGDKGGQGRPGTPGAPGLPGLKGEPGKGVSIPGPQGVPGPRGENG----LPGIQGERGLQGDPGLPGFPGDKGEQGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPGRGLPGPKGFQGPPGITGFP------------------GQKGNIGLPGIPGQE--GQTGPPGPQGLKGDIGPPGLPG-QTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGS--AGRDGQIGTQGRKGEMGNMGMPGVQGFPGSP--GLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQ---------KGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPG---------------VPGQKGHTGDPGVPGSPGEKGEKGYSG-------MPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGLPGS------------------VGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISLQGPKGDRGETGNQGAPGPKGVIGEAGFPGRDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPGQTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGFKGEVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFP---GPKGDNGVPGYDGLPGAKGEPG 1219          

HSP 3 Score: 211.46 bits (537), Expect = 1.753e-54
Identity = 386/1148 (33.62%), Postives = 497/1148 (43.29%), Query Frame = 1
Query:  247 IPGPKGDYGRIGNPGPIG----PKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAG---KMGLSGDKGVKGDKGYIGEPGDFFQAK--KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIA-QKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGN----VGNRGTPGPKGQ---PGSKGAKGIRGSDGVIGFX--------XXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGI-----------------------SGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLD---------------GKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNG------PDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKG-----------------FKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKG---ESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKG----------NMGVIGNVGAKGELGEPGMRGSKGDNGETGI-GQKGESGSNGEFGSKGQKGM 3390
            +PGP G  G+ G PGP G    P       G  G  GL G  G  GQ G   D+G++  +               G +GD G PG  G+ G+KG  G  G   + G  G+ G+ G  G +G PGD   A   KGEKGF G  G               + G  G  G+ G  G  G  G+ GEP  +  GI  ++G  G PG IG  G      +  G   P +RGD G +G                PG  GA G  G KG+ G      G +G PGP+G+   PG +G +G++G  G+ GF            G  G  G +G  G  G+ G  GE G  GK    + G  G  G KG+ G +G+PG +G  G  G                +  PG++G+IG  G  G+ G  GP G                     +G+KGD G  GL G+ G                         G +G+KG++G  G P   +    GP+GEKG+ G                 G++G++G +G KG +G                  N G  G  G  G  G PG  G RG PG  G  G  G  G  G+RG PG   ++G  G+  +     +KGEKGD G        G  G +G++G PG+ GK G  G  G+ G KGD G PG  G  G                G++G  GE GI    G KG KGD G       K L+    G++GDTG PG  G IG  GV G +G  G                          GVPG PG++G+ G  G  G  G QG KGD G  G  G  G  G  G+PG+   G+ G  G +G  G  GL G +G  G++GE GE G  G+ G +G                  KG KG++G PG  G+  + GIKGD G PG QG +G TGE G  G              GPKG+RG  G QG  G KG   E+G  GR GE GEKG QGL G +G  G  GD G  G PG       TG  GI+G KGE+G+ GV G  G KG+ G+ G   KG+ G++G                 +  KG++G PG++G  G  G  G  G KG+ G  G  G KG  G+
Sbjct:  221 LPGPPGQPGKKGEPGPPGQPVDPLACILAKGNSGPPGLPGLQGEEGQKG---DKGDTCVHCETSGIIGEPGPQ--GPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVIAPGLKGEKGFPGRPG---------------LQGQPGLDGLPGRDGLPGQPGLKGEPAKE--GIKGERGRDGEPGQIGPPGERGPPGI-AGFGQPGERGDKGGQGR---------------PGTPGAPGLPGLKGEPGKGVSIPGPQGVPGPRGENGLPGIQGERGLQGDPGLPGFPGDKGEQGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGK--DGLTGQAGSPGQKGEPG-RGLPGPKGFQGPPGI---------------TGFPGQKGNIGLPGIPGQEGQTGPPGP--------------------QGLKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDM---PGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMG------------------NMGMPGVQGFPGSPGLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPG---LQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGP--------------PGQKGSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLD----GEKGDTGSPGEPG-IGVPGVPGQKGHTGDP------------------------GVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGL--PGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISL----------QGPKGDRGETGNQGAPGPKGVIGEAGFPGRDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPG------QTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGF--KGEVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPGPKGDNGV 1205          

HSP 4 Score: 195.282 bits (495), Expect = 1.633e-49
Identity = 331/936 (35.36%), Postives = 421/936 (44.98%), Query Frame = 1
Query:  694 MDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRG-TPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGD--RGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIK-----PIDGEKGEKGDSG--NCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGA---------------KGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGEC--SGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDG---------ATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            ++G +G+ G +GDVG +G  G+ GE    P G  Q G+KG PGP G         + KG + P                          PGL G  G+ GQKGD G+      T G  G+PG +G KG +G  G +G KG +GQ G  G+ G+ G++G+ G +G  G  G     +  P    G KG+KG  G PG QG  G  G  G  G            LPG+ G  G+  + G  G  G  G+ G  G  G+ G  G  G    G +GD G +G  G  G  G  G+KGE G  G    G  G  GP+GE GL G+ G+ G  G  G+ G  G   +             G  G  G  G +G  G PG+ G+ GRPG DG  G+ GS G  G+  RGLPG KG +G  G +    FP   G+KG+ G  G  G +G  G PG  G   + GD+G  G+ G  G PG  G                   G  G++G+KG        + G +GEKG  G          P      G  G  G  G +G +G +G+ G QG  GS                         G+PG PG RG  G  G  G+ G  G KG+ G+ G  G                KGDTG  G+PG+ G +G +G +G+ G  G  G PG  G  G++G+ G  G+ G+ GP G KG  G  G PGP G K   G KGD G PG  G KG  GE GD G     G G  G  G  G  G+ G+ G  G  G+KG SGM G  G  G KGD+G  G +G  G  GD+G+ G PG +G  G           GP G  G KGE G  G+ G+ G +GD G  G    G  GE G  G  G+ G  G  G PG+ G KGD      G  G  G  GE G +G  G+
Sbjct:  195 IEGPRGEPGQKGDVGQKGDRGVLGESLPGPPG--QPGKKGEPGPPGQPVDPLACILAKGNSGP--------------------------PGLPGLQGEEGQKGDKGDTCVHCETSGIIGEPGPQGPKGDQGPPGPVGSKGDKGQTGPPGENGRPGSQGNPGLMGAPGAVGAPGDVVIAP----GLKGEKGFPGRPGLQGQPGLDGLPGRDG------------LPGQPGLKGEPAKEGIKGERGRDGEPGQIGPPGERGPPGIAGFGQPGERGDKGGQGRPGTPGAPGLPGLKGEPG-KGVSIPGPQGVPGPRGENGLPGIQGERGLQGDPGLPGFPGDKGE-------QGPPGIGFPGPSGPKGYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPGRGLPGPKGFQGPPGIT---GFP---GQKGNIGLPGIPGQEGQTGPPGPQG---LKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPGTPGLDMPGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMGNMGMPGVQGFPGSP------------------------GLPGSPGLRGDPGFTGPSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQKGSLGEMGIPGPAGPK---GTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGDKGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDK-----GYPGPQGPQGETGERGLPGI 1037          

HSP 5 Score: 157.147 bits (396), Expect = 8.155e-38
Identity = 306/919 (33.30%), Postives = 384/919 (41.78%), Query Frame = 1
Query:  229 TCRCVGIPGPKGDYGR-IGNPGP---IGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKG-----VKGDKGYIGEPGDF-FQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQ----------------------KGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKC-------IGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDN--------------GPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGS-----------RGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTI 2793
            T    G+PG KG+ G+ +  PGP    GP+G  G  G  G RGL GD G     G PGD+GE G  GI             G  G  G PG  G  G  G DGL G+ G  G KG     + G KG+ G PG   F  +KG  G  G  G                +G  G  G +G  GD GP G+ G+ G                              KG+KGFPG     G D           P  +G+ G  G  G  G  GL G  G  G DG +G +G+KG+ GN+G  G  G  G PG  G+ G+RG  G  G              G+ G  G KGE GE G  G         + +++G +G  GD+GD G  G  GYQG  G+ G  G  G  G          PG+ GD GD+G  GE G+ GP G  G                   G KG  GD G  G  G  G  G KG+ G  G P  G+ G  G KG  G  G+ G  G+ G KG  G+ G+                G QG KG  G  G  G  G  GD+G PG  G++G  G  G  G+ GL G  G +G KG+  E+  P   GE+GD               G  G +G  G+ G+PG  G PGI GD G  G +G +G                         GERGL G      + G KG++G++GN              G +G  GE G  G  G+ G KG QG  G  G +G KG                 GVPG+PG+ G  G+DG+KG+ G QG+ G  G KG  G  G  G +G+ G                    +G+ G  G++GLPG  G  G  G  G+QG  G  GPKG  G+ G  G PG  G+  +
Sbjct:  433 TPGAPGLPGLKGEPGKGVSIPGPQGVPGPRGENGLPGIQGERGLQGDPG---LPGFPGDKGEQGPPGIGFPGPSGPK----GYSGAPGAPGLPGEPGRPGKDGLTGQAGSPGQKGEPGRGLPGPKGFQGPPGITGFPGQKGNIGLPGIPG---------------QEGQTGPPGPQGLKGDIGPPGLPGQTGPPGAPGKGLPGPPGPQGPHGEPGPHGREGIKGDKGFPG---TPGLDM----------PGPQGEKGVPGFPGIPGGRGLPGPPGSAGRDGQIGTQGRKGEMGNMGMPGVQGFPGSPGLPGSPGLRGDPGFTG------------PSGESGEPGPKGERGEPGLQGPPGEMNDVDMEHMKGEKGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGS---------PGQPGDKGDRGFPGEPGSMGPPGQKG--------SLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSP---------------GVQGPKGDKGSIGYQGQAGRPGDKGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGEPGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGE-----------------------TGERGLPGIS----LQGPKGDRGETGN----------QGAPGPKGVIGEAGFPGRDGEKGEKGSQGLPGFQGETGHKGD---------------PGVPGLPGQTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGFKGEVGDRGFPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQGITGFPGPKGDNGVPGYDGLPGAKGEPGL 1220          

HSP 6 Score: 87.4261 bits (215), Expect = 1.466e-16
Identity = 188/541 (34.75%), Postives = 234/541 (43.25%), Query Frame = 1
Query:  259 KGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGD--------------TGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXN--RGSKGEVGEAGGSGK--CIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKG------------FKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKN---------------------------GKVGPKGM-KGLLGT 1707
            KGD G  G+PG  G +GY G  G+ G  G  G+ GS GQ G  GDRG  G+ G  G  G        G  G++G+PG  G  G KG+ G  G  G  G  G KGD G  GEPG       G+KG  GD G  G  GEKG  G  GM G  G +G +GD G  G  G +G PGD       KG+ G PG +G+ G D +      + P   RGD GE                  PG DG  G  G++GD               G  G++G+ G  G PG+ G  GI+G  G  G +G +G+ G +G  G      +G +GE G  G  G    IG    P G  G+KG+KG+QG+PG+QG  G KG              G+ G  G  G  G    PG +G+IGD G  GE G  G    F                  +KG  G  G +GL G +G +G  G+KG++G      TG  GPKG  G  G  GL G                             G  GP  M  G L T
Sbjct:  758 KGDTGDRGDPGVSGDRGYQGVQGDPGMPGKDGEPGSPGQPGDKGDRGFPGEPGSMGPPGQK------GSLGEMGIPGPAGPKGTKGDFGRPGHPGFKGLDGEKGDTGSPGEPGIGVPGVPGQKGHTGDPGVPGSPGEKGEKGYSGMPGSPGVQGPKGDKGSIGYQGQAGRPGD-------KGDPGLPGSVGEPGRDGRPGEGGLQGPSGPRGDKGE------------------PGEDGIPGSTGERGDPGLPGRGVPGPPGELGTKGDKGSSGLPGAPGNPGVPGIKGDKGYPGPQGPQGETGERGLPGISLQGPKGDRGETGNQGAPGPKGVIGEAGFP-GRDGEKGEKGSQGLPGFQGETGHKGDPGVPGLPGQTGLPGIDGQKGERGLQGVPGFPGTKGEIGDIGFKGEVGDRG----FPGLKGGEGPPGPPGPQLFIKGDVGAPGIQGLPGPQGPAGFPGLKGQQG-----ITGFPGPKGDNGVPGYDGLPGAKGEPGLPGPQGPRGYPGPPGPDGVPGQVGAPGPSSMDHGFLVT 1257          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Medaka
Match: col4a5 (collagen type IV alpha 5 chain [Source:NCBI gene;Acc:101168818])

HSP 1 Score: 218.009 bits (554), Expect = 1.656e-56
Identity = 102/235 (43.40%), Postives = 141/235 (60.00%), Query Frame = 1
Query: 4711 FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLAS-----LAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTT-GGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSE--FEVPKGKYIKAEDDKSKNVYKELSRCKVCMKK 5391
            FL TRH Q  +E P CP G+N I++GYS +   GN   +  +LGT  SCL  F+ MPF  C+ +  C    R D SYWL++     ++PVTG+ I+      +ISRC  CE+PA   A HSQT  + +  CP+ W  LW GYSF+MHT+ G  G GQ+L+SPGSCL  FR SP +EC +G   CN++ ++ S++L  VD    F  P+ + +KA      N+   +SRC VCMK+
Sbjct: 1239 FLITRHSQA-QEVPYCPDGTNLIYDGYSLLYVQGNERAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPNEMPMSPVTGETIK-----PHISRCSVCEAPAMVIAIHSQTIQIPE--CPQSWQTLWIGYSFMMHTSAGAEGSGQALASPGSCLESFRSSPFIEC-HGRGTCNYYGNSYSFWLATVDFSEMFRKPEPETLKA-----GNLRSRISRCAVCMKR 1459          

HSP 2 Score: 87.0409 bits (214), Expect = 1.686e-16
Identity = 102/265 (38.49%), Postives = 126/265 (47.55%), Query Frame = 1
Query: 2443 FDGVPGIPGKRGQSGLDGEKGDIGN----------------QGMKGDIGDKGRSG---AKGDTGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNG 3177
            F G PG PG+ G  G  G KGD G+                +G+KGD G  G +G    KG  G  G+PG+ G  G  G+ G +G  G  G PG  G  G  G  G  GD+G  GP G KG+ G +G+PG  G     G  G  GEPG  G+ G  G  G KG+    G  G  G  G  G  G+ G  G  G KGE G+ G  G  G  G +GL+G  G  G +G  G  G+PG       TGP G+ G KG+ G  G+ G  G
Sbjct:  700 FKGDPGFPGRDGPQGPIGPKGDRGDPGIPGPPGIARPPENIKGIKGDPGPPGLAGFPGQKGIAGLPGDPGLPGTDGRPGTPGPQGPKGDSGFPGSPGSPGFPGPKGNMGDMGIPGPSGLKGLPGISGRPGLPGQPGAPGFPGSKGEPGSAGV-GPAGMKGQKGDPGQPGFPGNPGSKGSSGLPGLPGGPGGPGAKGEPGLPGFIGSPGPTGPKGLDGEPGIPGPLGSPGRPGEPG------LTGPPGLRGEKGQAGRDGIPGPPG 957          

HSP 3 Score: 60.4622 bits (145), Expect = 2.260e-8
Identity = 54/126 (42.86%), Postives = 65/126 (51.59%), Query Frame = 1
Query: 3736 EKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGP-------CQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
             KG KG  GE G +G  G  GD GP+GN G KGE G  G  G DG  G    KG++G  GP        + GR G +GE G PG  G+KGE+G +G  G  G  G     G G+ G  G  G KG+
Sbjct:   67 RKGEKGEPGEPGKRGKPGKDGDPGPQGNPGFKGEPGLPGLPGRDGSAGQ---KGDRGFPGPPGEVIPDTEPGRVGPKGEPGIPGSPGLKGERGPQGFTGPPGEPGRPATGGRGVPGTPGYPGEKGQ 189          

HSP 4 Score: 56.225 bits (134), Expect = 3.741e-7
Identity = 157/496 (31.65%), Postives = 185/496 (37.30%), Query Frame = 1
Query: 1810 GIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGK---------------VGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKG---------------------FTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKG-------------------------------------------NVGVIG 3060
            GI+GD G PG  G  G++G  G  GD GLPG  G  G  G                 GP G  G  G  GSPG  G  G  GDMG  G  G +G PG                    + G  GL G+ G     G KGE G +G      V P  A   G +GD G+PG  G  G                 G KG+ G  G              G+ G  G KG DG PGIPG  G  G  GE G  G  G++G+ G  GR G  G  G  G PG+   G  G  G  G  GM+G  G  G  G  G  G +GD G  G  G  G  GN G PG    ++++G KG  G PG+ G +G                     F G  G  G        G++GD G  G  G  G  G+ G KG+SG+ G  G  G KGDQG  GP G                                             G  G
Sbjct:  742 GIKGDPGPPGLAGFPGQKGIAGLPGDPGLPGTDGRPGTPGP---------------QGPKGDSGFPGSPGSPGFPGPKGNMGDMGIPGPSGLKGLPG--------------------ISGRPGLPGQPGAPGFPGSKGEPGSAG------VGP--AGMKGQKGDPGQPGFPGNPGSKGSSGLPGLPGGPGGPGAKGEPGLPGF------------IGSPGPTGPKGLDGEPGIPGPLGSPGRPGEPGLTGPPGLRGEKGQAGRDGIPGPPGIKGEPGLPGFGGPGPSGLPGIPGMKGDLGPPGPPGIPGFPGPKGDPGFNGAPGVPGNPGNPGSPG----RSMQGPKGLQGLPGLPGREGLPGPEGPRGLPGGGGVKGEKGFPGSPGQPGFP------GQKGDPGTPGFPGSPGSSGLPGLKGDSGVPGVPGFPGPKGDQGPQGPSGFPGDPGNLGPPGPPGDPAVQPPPGFVKGVRGPPGPPGSPGPKGQTGTPG 1172          

HSP 5 Score: 54.299 bits (129), Expect = 1.567e-6
Identity = 161/496 (32.46%), Postives = 200/496 (40.32%), Query Frame = 1
Query: 1516 GDEGLQGEKGISGSKGVKGERGPS--------GRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKP-VQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKG-----------------------SDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGD------------------TGAIGNPGI-GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTG-------------KPGPVGDKTIKGIKGD 2811
            GD G  G  G  G  G KG+RG           RP   + G KG  G  GL+G  G+ G  G  G  GL GT                        DG  G  G  G +GD G PG+ G+ G  G  G++GD G+PG  G+KG  G S     P   G  G  G  G+ G  G+    G  G  G  GD G+ G  G+ G+ G  GL G  G  G  G   +P + G  G  G  G K +DGE G  G  G+              G+ G TG PGL+G  G+ G  G  G  G                         G  G  G PG PG  G KG  GF+G PG+PG  G  G  G     G +G++G  G  GR G  G                    G+ G PG  G KG+ G+ G  G  G  GLPG+ GD G  G  G  G  G+ GP+G  G  G+ G             +P P     +KG++G 
Sbjct:  702 GDPGFPGRDGPQGPIGPKGDRGDPGIPGPPGIARPPENIKGIKGDPGPPGLAGFPGQKGIAGLPGDPGLPGT------------------------DGRPGTPGPQGPKGDSGFPGSPGSPGFPGPKGNMGDMGIPGPSGLKGLPGISGRPGLPGQPGAPGFPGSKGEPGSAGV----GPAGMKGQKGDPGQPGFPGNPGSKGSSGLPGLPGGPGGPGAKGEPGLPGFIGSPGPTGPKGLDGEPGIPGPLGS----------PGRPGEPGLTGPPGLRGEKGQAGRDGIPGPPGIKGEPGLPGFGGPGPSGLPGIPGMKGDLGPPGPPGIPGFPGPKGDPGFNGAPGVPGNPGNPGSPGRSMQ-GPKGLQGLPGLPGREGLPGPEGPRGLPGGGGVKGEKGFPGSPGQPGFPGQKGDPGTPGFPGSPGSSGLPGLKGDSGVPGVPGFPGPKGDQGPQGPSGFPGDPGNLGPPGPPGDPAVQPPP---GFVKGVRGP 1155          

HSP 6 Score: 52.7582 bits (125), Expect = 4.309e-6
Identity = 86/262 (32.82%), Postives = 115/262 (43.89%), Query Frame = 1
Query: 2266 PLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGD------IGDKGRSGAKGDTGAIGNPGIGIKGNEGSR-GEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLN 3030
            P++  + GD+GD G PGL+G  G  G  G  G +  +                        G PG PGKRG+ G DG+ G  GN G KG+       G  G +G KGD G  G PG  I   E  R G +GE G+ G PG+ G+ G QG +G  G+ G     G +G+ G  G PG       KG KG  G+PG+        + G            +       G+  I G  G+ G  G+ G  G  G+ GEKG+  +N
Sbjct:   34 PVDVIQRGDKGDPGYPGLRGDPGPPGPPGPSGGRKGE-----------------------KGEPGEPGKRGKPGKDGDPGPQGNPGFKGEPGLPGLPGRDGSAGQKGDRGFPGPPGEVIPDTEPGRVGPKGEPGIPGSPGLKGERGPQGFTGPPGEPGRPA-TGGRGVPGTPGYPG------EKGQKGRPGDPGISLPGPPGRQGGPGLPGPPGPPGPQGFST--PGQSCIPGPPGLPGTLGDRGFQGEQGQKGEKGETCVN 263          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Medaka
Match: col4a6 (collagen, type IV, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-101001-2])

HSP 1 Score: 199.519 bits (506), Expect = 1.333e-53
Identity = 129/377 (34.22%), Postives = 192/377 (50.93%), Query Frame = 1
Query: 4270 ENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEV---PKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            E+ P GD+GL G +G  GY+G+ G +GI G                       + G +G  G PG++G+ G  G      + GP G  G  GL G SG+++   G   +                GP G  G  G  G   +++   +   +H Q+ E+ P+CP G   ++ GYS +   G  + +  +LG   SCL  F+ MPF  CS +  C    R D+SYWL++ AP+    +    ++ YISRC  CE+P++  A HSQ  +++  +CP  W  LW GYSF+MHT  G  GGGQSL SPGSCL  FR +P +ECN     C+++ +  S++L  VD + E    P  + +KA  ++S+     +SRC+VC K
Sbjct:  226 ESQPSGDMGLPGERGPLGYRGDSGWSGIPG-----------------------RPGPKGRPGAPGNLGRTGPSG------LPGPLGDPGSPGLPGTSGRQERKPGGNVTFS-AAPPTGLFLFILSGPPGNIGLPGIPGSSSRSISIGYTLVKHSQS-EQVPMCPQGMPSLWNGYSLLYVEGQEKAHNQDLGQPGSCLPRFSTMPFLYCSPNEVCFFASRNDKSYWLSTSAPIPMMPVSAGQIQPYISRCSVCEAPSQAVAVHSQ--DMTIPMCPPGWRSLWIGYSFLMHTAAGAEGGGQSLMSPGSCLEDFRATPFIECNGAKGTCHYFANKYSFWLTTVDPKREFVSSPNQETLKAGQERSR-----VSRCQVCSK 564          

HSP 2 Score: 81.6481 bits (200), Expect = 4.070e-15
Identity = 110/293 (37.54%), Postives = 136/293 (46.42%), Query Frame = 1
Query: 2548 GRSGAKGDTGAIGNPG---IGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKG---IKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQG------INGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGM 3390
            GR GA G  G  G  G    G +G +G +G++GE G+ G  GI G  G  GES   G  G  G  G  G+ GN G  GP G     G   I+G+ GEPG   L GF G  G KGE    G  G  G  G K E   K   G       +G  GESG  GR G  G  GD G  G KG  GV+        P PI     + P G  G+ GE+G +G +G++G  G  G  G   KG+ G  GN+G  G  G  G LG+PG  G  G +G     Q+ + G N  F +    G+
Sbjct:   42 GRPGAPGIPGLKGERGDSYPGQRGFDGVKGQKGEPGLPGTSGIPGQPGLPGESALAGIAGPVGDPGLPGLDGNYGFQGPPGPPGPPGSGTIQGERGEPG---LPGFPGSPGRKGEPGFNGGPGYPGSAGVK-EYKCKTWYGSHMGFWFSGSPGESGFNGRPGLKGVPGDPGQKGRKGPPGVV-------LPSPIV---ESQPSGDMGLPGERGPLGYRGDSGWSGIPGRPG--PKGRPGAPGNLGRTGPSGLPGPLGDPGSPGLPGTSGR----QERKPGGNVTFSAAPPTGL 314          

HSP 3 Score: 73.9442 bits (180), Expect = 8.797e-13
Identity = 88/277 (31.77%), Postives = 116/277 (41.88%), Query Frame = 1
Query: 1765 GEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGRE---GSYGDIGDRGLPG---DKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTG 2577
            G++G DG+ G+ G PG+ G  G PG  G  G     G  G +GD GLPG   + G +G  G        +I+GE+G+ G  G  G  G KG PG NG PG  G  G    K               G          P  GE G  G  G+K + G+ G+KG  G   +    P+   E    GD G PG +GP+   G +GD G                           + G+PG PG +G+ G  G  G  G  G+ G +GD G  G  G +G
Sbjct:   62 GQRGFDGVKGQKGEPGLPGTSGIPGQPGLPGESALAGIAGPVGDPGLPGLDGNYGFQGPPGPPGPPGSGTIQGERGEPGLPGFPGSPGRKGEPGFNGGPGYPGSAGVKEYKCKTWY----------GSHMGFWFSGSP--GESGFNGRPGLKGVPGDPGQKGRKGPPGVVLPSPI--VESQPSGDMGLPGERGPL---GYRGDSG---------------------------WSGIPGRPGPKGRPGAPGNLGRTGPSGLPGPLGDPGSPGLPGTSG 294          

HSP 4 Score: 63.5438 bits (153), Expect = 1.459e-9
Identity = 93/286 (32.52%), Postives = 115/286 (40.21%), Query Frame = 1
Query: 2449 GVPGIPGKRG-----QSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDT------GAIGNPGI-GIKGNEGSRGE------------EGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNT-----------GKPGPVGDKTIKGIKGDSGEPGVQGLKGFTG-----------ESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQG------------------------------------LNGPKGNVGVIG 3060
            G+PG+ G+RG     Q G DG KG  G  G+ G  G  G+ G  G++      G +G+PG+ G+ GN G +G             +GE G  GLPG  G  G +GE G  G  G  G  G K  K  T           G PG  G     G+KG  G+PG +G KG  G            SGD G    RG  G RGD    G  GI G  G  G  G  G +GRTG +G  G  G                                    L+GP GN+G+ G
Sbjct:   48 GIPGLKGERGDSYPGQRGFDGVKGQKGEPGLPGTSGIPGQPGLPGESALAGIAGPVGDPGLPGLDGNYGFQGPPGPPGPPGSGTIQGERGEPGLPGFPGSPGRKGEPGFNGGPGYPGSAGVKEYKCKTWYGSHMGFWFSGSPGESGFNGRPGLKGVPGDPGQKGRKGPPGVVLPSPIVESQPSGDMGLPGERGPLGYRGD---SGWSGIPGRPGPKGRPGAPGNLGRTGPSGLPGPLGDPGSPGLPGTSGRQERKPGGNVTFSAAPPTGLFLFILSGPPGNIGLPG 330          

HSP 5 Score: 55.4546 bits (132), Expect = 5.744e-7
Identity = 76/228 (33.33%), Postives = 94/228 (41.23%), Query Frame = 1
Query: 1528 LQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGI------------------RGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIK-----------------GAKGDSREETFPSIKGEKGDNGPDGKEGPKG-IKGSPGLNGKP----GISGDMGKMGVKGDEG 2091
            L G  G  G  G+KGERG S     G  G KG KGE GL G  G  G+ G  G   L G A                  G  G  GL G DGN G                   RG+ G PG  G+ GR+G  G  G  G PG  G+K                 G+ G+S     P +KG  GD G  G++GP G +  SP +  +P    G+ G+ G +G +GD G
Sbjct:   40 LGGRPGAPGIPGLKGERGDSYPGQRGFDGVKGQKGEPGLPGTSGIPGQPGLPGESALAGIA------------------GPVGDPGLPGLDGNYGFQGPPGPPGPPGSGTIQGERGEPGLPGFPGSPGRKGEPGFNGGPGYPGSAGVKEYKCKTWYGSHMGFWFSGSPGESGFNGRPGLKGVPGDPGQKGRKGPPGVVLPSPIVESQPSGDMGLPGERGPLGYRGDSG 249          
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Medaka
Match: col4a6 (collagen, type IV, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-101001-2])

HSP 1 Score: 185.267 bits (469), Expect = 5.864e-50
Identity = 127/372 (34.14%), Postives = 188/372 (50.54%), Query Frame = 1
Query: 4285 GDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEV---PKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            G+ G NG  G++G  G+ G  GI G+KG                      G +G  G PG++G+ G  G      + GP G  G  GL G SG+++   G   +                GP G  G  G  G   +++   +   +H Q+ E+ P+CP G   ++ GYS +   G  + +  +LG   SCL  F+ MPF  CS +  C    R D+SYWL++ AP+    +    ++ YISRC  CE+P++  A HSQ  +++  +CP  W  LW GYSF+MHT  G  GGGQSL SPGSCL  FR +P +ECN     C+++ +  S++L  VD + E    P  + +KA  ++S+     +SRC+VC K
Sbjct:  103 GESGFNGRPGLKGVPGDPGFYGIKGSKG--------------------TPGPKGRPGAPGNLGRTGPSG------LPGPLGDPGSPGLPGTSGRQERKPGGNVTFS-AAPPTGLFLFILSGPPGNIGLPGIPGSSSRSISIGYTLVKHSQS-EQVPMCPQGMPSLWNGYSLLYVEGQEKAHNQDLGQPGSCLPRFSTMPFLYCSPNEVCFFASRNDKSYWLSTSAPIPMMPVSAGQIQPYISRCSVCEAPSQAVAVHSQ--DMTIPMCPPGWRSLWIGYSFLMHTAAGAEGGGQSLMSPGSCLEDFRATPFIECNGAKGTCHYFANKYSFWLTTVDPKREFVSSPNQETLKAGQERSR-----VSRCQVCSK 439          
BLAST of Collagen alpha-2(IV) chain vs. Planmine SMEST
Match: SMESG000021729.1 (SMESG000021729.1)

HSP 1 Score: 2582.36 bits (6692), Expect = 0.000e+0
Identity = 1766/1772 (99.66%), Postives = 1769/1772 (99.83%), Query Frame = 1
Query:  100 MIVTVLNSVNKXXXXXXXXXXXXXXXXXQWTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQPLLYI 5415
            MIVTVLNSVNKSQLTWLLLLSFVLLASSQWTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESGDYGIPGIHGDPGDIGLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAGDEG SGEKGEKGFIGKRGMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSGEKGEGGQKGKTGLKGITGEPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFKGVEGQKGIQGKQGKDGNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKGMPGPNGPIGDIGDSCLPGKRGDIGDKGENGESGAHGPRGDFGFNGDAGDEGDIGDEGKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCKKGDIGEKGIKGNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPGMKGLKGEIGEKGTKGIDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDGISGKKGQPGKPGNKGVKGTKGFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGN GIGIKGNEGSRGE+GETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGN+GVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRG+KGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMEGEKGDIGPIGPKGPGGLKGVKGEKGDIGEIGSRGKIGKTGGIGKKGERGNTGKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTGDIGLPGDKGDKGGKGLPGRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGK GIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGREGKQGIKGESGEKGEDGESGRQGAKGIKGEIGNKGNTGETGYIGSKGIKGDIGDKGIKGENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKGIQGDRGMGGMKGYRGMVGEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARGKPGKKGDQGPQGPKGQIGEQGPIGQALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQPLLYI
Sbjct:    1 MIVTVLNSVNKSQLTWLLLLSFVLLASSQWTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESGDYGIPGIHGDPGDIGLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAGDEGFSGEKGEKGFIGKRGMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSGEKGEGGQKGKTGLKGITGEPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFKGVEGQKGIQGKQGKDGNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKGMPGPNGPIGDIGDSCLPGKRGDIGDKGENGESGAHGPRGDFGFNGDAGDEGDIGDEGKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCKKGDIGEKGIKGNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPGMKGLKGEIGEKGTKGIDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDGISGKKGQPGKPGNKGVKGTKGFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNSGIGIKGNEGSRGEDGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNIGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGDKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMEGEKGDIGPIGPKGPGGLKGVKGEKGDIGEIGSRGKIGKTGGIGKKGERGNTGKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTGDIGLPGDKGDKGGKGLPGRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKAGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGREGKQGIKGESGEKGEDGESGRQGAKGIKGEIGNKGNTGETGYIGSKGIKGDIGDKGIKGENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKGIQGDRGMGGMKGYRGMVGEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARGKPGKKGDQGPQGPKGQIGEQGPIGQALESTFLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQPLLYI 1772          
BLAST of Collagen alpha-2(IV) chain vs. Planmine SMEST
Match: SMESG000002557.1 (SMESG000002557.1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 806/1770 (45.54%), Postives = 1032/1770 (58.31%), Query Frame = 1
Query:  187 WTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ---PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLP---GKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLC---XXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGE---------------LGPKGNVGPQGD------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE---QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPV-CPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEF--EVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            ++   NC   C  ++CRC+   G KGD G+ G  G  G +G+TG++G  G++G+ GD G  G  G  GD G SG  GI G  GD G+ G  G  GD GL GCNGT GEKGN GL GK GL+G  G KG KG IG+ GD   ++  EKGF G+ G +G  G +G  G +G  GD G+ G  G  G QG  GM G PGD       +  KG KG  G  G+ G++C L  L G T  ++ GD G+KG  GQKG  G KGI G  G+DG +G+ G KGD G  G  G  G  G  G+KG KG+ G DG +G KG  G KG +G  G DGNRG KG+ GE G +  C    +G  G  G +GDKGN G  G  G  G KGF+G  G  G IGD G SC+    G+ G IGDKG  G +G  GPRG  G NGD G+EG++      +KG KG++GD G  G  G  G KGVKG +G +G    G  G KG KG  GL+G  GK GK G KG KG  GT C  C   KKG+IG KG KGN+G +GK G+ G+DG  G++G +G  G  G +G++G  GDIG  G+   KG+KG  G S   T  +++ + G+ G  G+ G KG KG  G  G  G  G  G +G KGD G+PG +  KGEIG+KG  G     + GE+G  G KG K + G  GEKG+ G C +  ++   + + GD G+ G  G  G  GKVG+KG++G  G  GI G+KG  GK G KG+KG  G  G  G+ GK G++G  G KG+ G +G KGDIG +G  G KG+ G IG    G +G +G  G+ GE+G RG+ G  G+ G QG +G QG  G+ G KG++G KGN GK GP   + IKG  G+ G  G QG  G  G+ G  G+C G    G+RG+ G KG  G KG+ G  GDKGE G     G  G +G++G  G KGN G  GDRG  G+ G  G  G  G KG+ G KG QG+ G KG  G  G+QGE G  TKG++G  G  G +G  G KG +G+  +RG KGD G    G  GE+G  G  G KG  G++G KG+ GPIG  GP G KG KG KG+IG+ G+ G  G +G  G KGERG+ GKDG  G+ G  G KG+ G  + G  G +GD+G                     ++G++G++GE G+KG+KG+               LGPKGN+G +GD      QG +G+ G +G  G  GD GE+G+ GNVG KG+KG  G C  G+ G  G  G  G  GIKGE+G+EGLPGK G  G KG    G +G +GDIG +GR G +G  G +G++G+ G +G  G KG KG  G  GN G  G  G  G+KG  G+KG +G  G RG+ G +G  G  G KG  GS G +G KG+ GD+G  G KG++GM+G++  G RG IGE GD G VG KG+ GE   RG KG KG +G+ G +  E   QG  GDKGSIG +G                        P    + ST LFT H Q+ + K + CP  S KI+ GYSFVM NG  +++ M++GT SSCL  FNIMPF  C RDGSC   IR+D+SYWL+SL P +   ++V  + K +S+CV CE P +PYAFHSQT   +D+ CPEDW ELW GYSFVMH++    GGQSLSSPGSC+ YFRF PL+ECNNGM  C+HW D  +Y+LR +  EF     + +Y++      K +   +SRC VC K
Sbjct:   22 FSNASNCRERCDGSSCRCIPNDGQKGDNGKRGRDGVKGRRGFTGDIGMFGSQGIQGDIGKLGIVGESGDHGLSGIIGINGEDGDSGEPGSKGSIGDTGLKGCNGTKGEKGNVGLIGKQGLNGKIGYKGIKGDIGDTGD---SQTKEKGFMGEVGETGSPGLQGERGLQGKPGDNGETGDHGSQGIQGDRGMPGIPGDSGFVNSNLQIKGFKGKSGIPGEPGSNCYLAYLNG-TRSNKNGDYGDKGFQGQKGLPGRKGIQGIYGIDGNIGNSGPKGDPGFRGKIGPKGNTGSHGAKGRKGVSGIDGYLGSKGKIGYKGQRGTAGIDGNRGLKGDRGEPGDNTDCTKMKEGMIGEIGVQGDKGNNGGTGLMGKKGNKGFRGNQGKRGDIGDPGASCIHAPKGRIGAIGDKGIIGTNGRPGPRGLKGINGDEGEEGEVSY---YIKGGKGETGDAGAIGITGDQGKKGVKGRKGYAGDGVLGKFGEKGIKGISGLNGFPGKTGKPGSKGFKGENGTMCNSCIIGKKGEIGSKGSKGNKGIEGKKGINGKDGRQGLKGIKGSFGKSGKVGKQGDAGDIGKSGI---KGMKGEPGSSNNLT-NTVREQNGNKGETGEFGKKGEKGIAGKIGNFGRIGSNGLIGFKGDPGDPGAQSEKGEIGDKGLSGKSFTLIYGEKGELGNKGNKGLSGVSGEKGNLGECIVTHLENQTSIDTGDVGEIGSVGEPGIPGKVGLKGEKGIIGKSGIEGQKGSSGKSGMKGIKGANGEPGEAGLNGKIGETGSIGFKGEPGEKGQKGDIGFEGSKGVKGNKGLIGVTKNGEQGKQGEPGDIGESGKRGMKGDVGEQGIQGSTGYQGIYGDPGEKGYQGPKGNKGKQGPKNAEDIKGEIGEKGAQGAQGKTGIKGDEGSIGDCIGIPSKGDRGNFGEKGSLGDKGKIGEKGDKGEPGPSNDFGRQGVEGNKGNPGNKGNKGEAGDRGFQGEEGKQGIIGEPGLKGLKGSKGLQGIFGSKGLKGVNGNQGELGPITKGEKGIMGEQGTVGRKGDKGNMGDGKIRGIKGDRGNPTTGFIGENGDKGILGQKGIFGLKGSKGNQGPIGFLGPKGEKGYKGIKGEIGDKGNIGYPGISGFQGSKGERGDLGKDGVPGMKGEIGNKGVPGNFVIGIRGDLGDSG---------------------KKGSDGEVGETGDKGIKGQRGVMGLFGEKGNKGYLGPKGNIGEKGDFGELGAQGRQGDPGKQGMQGQIGDPGENGEIGNVGIKGDKGKMGECILGKVGEVGIEGEIGLTGIKGEKGIEGLPGKHGYKGQKGFSVAGNKGIEGDIGFEGRRGTKGDHGINGDQGDRGNNGSIGPKGFKGFQGENGNKGLKGIKGVIGLKGLEGEKGKQGYTGRRGEQGPHGNNGTTGVKGNFGSPGPIGEKGVSGDKGEKGEKGFKGMIGKETNGERGRIGEVGDQGNVGQKGEFGELPDRGRKGEKGSKGIIGVTDSEIGIQGEEGDKGSIGIKGK--IGKSGEVGKKGIKGTIGSFGRPASITITSTLLFTFHIQDSDTKKLECPGKSQKIYAGYSFVMVNGGGQLHSMDIGTPSSCLQTFNIMPFAHCLRDGSCSTGIRSDKSYWLSSLEPESLTPVDVSKMYKALSQCVVCEIPTQPYAFHSQTERYNDISCPEDWVELWRGYSFVMHSSASKSGGQSLSSPGSCIQYFRFHPLIECNNGMSSCHHWADGNAYYLRSLSGEFFNSTKEAQYLEQTTKNMKEILDSISRCVVCTK 1757          
BLAST of Collagen alpha-2(IV) chain vs. Planmine SMEST
Match: SMESG000002557.1 (SMESG000002557.1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 806/1770 (45.54%), Postives = 1032/1770 (58.31%), Query Frame = 1
Query:  187 WTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ---PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLP---GKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLC---XXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGE---------------LGPKGNVGPQGD------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE---QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPV-CPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEF--EVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            ++   NC   C  ++CRC+   G KGD G+ G  G  G +G+TG++G  G++G+ GD G  G  G  GD G SG  GI G  GD G+ G  G  GD GL GCNGT GEKGN GL GK GL+G  G KG KG IG+ GD   ++  EKGF G+ G +G  G +G  G +G  GD G+ G  G  G QG  GM G PGD       +  KG KG  G  G+ G++C L  L G T  ++ GD G+KG  GQKG  G KGI G  G+DG +G+ G KGD G  G  G  G  G  G+KG KG+ G DG +G KG  G KG +G  G DGNRG KG+ GE G +  C    +G  G  G +GDKGN G  G  G  G KGF+G  G  G IGD G SC+    G+ G IGDKG  G +G  GPRG  G NGD G+EG++      +KG KG++GD G  G  G  G KGVKG +G +G    G  G KG KG  GL+G  GK GK G KG KG  GT C  C   KKG+IG KG KGN+G +GK G+ G+DG  G++G +G  G  G +G++G  GDIG  G+   KG+KG  G S   T  +++ + G+ G  G+ G KG KG  G  G  G  G  G +G KGD G+PG +  KGEIG+KG  G     + GE+G  G KG K + G  GEKG+ G C +  ++   + + GD G+ G  G  G  GKVG+KG++G  G  GI G+KG  GK G KG+KG  G  G  G+ GK G++G  G KG+ G +G KGDIG +G  G KG+ G IG    G +G +G  G+ GE+G RG+ G  G+ G QG +G QG  G+ G KG++G KGN GK GP   + IKG  G+ G  G QG  G  G+ G  G+C G    G+RG+ G KG  G KG+ G  GDKGE G     G  G +G++G  G KGN G  GDRG  G+ G  G  G  G KG+ G KG QG+ G KG  G  G+QGE G  TKG++G  G  G +G  G KG +G+  +RG KGD G    G  GE+G  G  G KG  G++G KG+ GPIG  GP G KG KG KG+IG+ G+ G  G +G  G KGERG+ GKDG  G+ G  G KG+ G  + G  G +GD+G                     ++G++G++GE G+KG+KG+               LGPKGN+G +GD      QG +G+ G +G  G  GD GE+G+ GNVG KG+KG  G C  G+ G  G  G  G  GIKGE+G+EGLPGK G  G KG    G +G +GDIG +GR G +G  G +G++G+ G +G  G KG KG  G  GN G  G  G  G+KG  G+KG +G  G RG+ G +G  G  G KG  GS G +G KG+ GD+G  G KG++GM+G++  G RG IGE GD G VG KG+ GE   RG KG KG +G+ G +  E   QG  GDKGSIG +G                        P    + ST LFT H Q+ + K + CP  S KI+ GYSFVM NG  +++ M++GT SSCL  FNIMPF  C RDGSC   IR+D+SYWL+SL P +   ++V  + K +S+CV CE P +PYAFHSQT   +D+ CPEDW ELW GYSFVMH++    GGQSLSSPGSC+ YFRF PL+ECNNGM  C+HW D  +Y+LR +  EF     + +Y++      K +   +SRC VC K
Sbjct:   24 FSNASNCRERCDGSSCRCIPNDGQKGDNGKRGRDGVKGRRGFTGDIGMFGSQGIQGDIGKLGIVGESGDHGLSGIIGINGEDGDSGEPGSKGSIGDTGLKGCNGTKGEKGNVGLIGKQGLNGKIGYKGIKGDIGDTGD---SQTKEKGFMGEVGETGSPGLQGERGLQGKPGDNGETGDHGSQGIQGDRGMPGIPGDSGFVNSNLQIKGFKGKSGIPGEPGSNCYLAYLNG-TRSNKNGDYGDKGFQGQKGLPGRKGIQGIYGIDGNIGNSGPKGDPGFRGKIGPKGNTGSHGAKGRKGVSGIDGYLGSKGKIGYKGQRGTAGIDGNRGLKGDRGEPGDNTDCTKMKEGMIGEIGVQGDKGNNGGTGLMGKKGNKGFRGNQGKRGDIGDPGASCIHAPKGRIGAIGDKGIIGTNGRPGPRGLKGINGDEGEEGEVSY---YIKGGKGETGDAGAIGITGDQGKKGVKGRKGYAGDGVLGKFGEKGIKGISGLNGFPGKTGKPGSKGFKGENGTMCNSCIIGKKGEIGSKGSKGNKGIEGKKGINGKDGRQGLKGIKGSFGKSGKVGKQGDAGDIGKSGI---KGMKGEPGSSNNLT-NTVREQNGNKGETGEFGKKGEKGIAGKIGNFGRIGSNGLIGFKGDPGDPGAQSEKGEIGDKGLSGKSFTLIYGEKGELGNKGNKGLSGVSGEKGNLGECIVTHLENQTSIDTGDVGEIGSVGEPGIPGKVGLKGEKGIIGKSGIEGQKGSSGKSGMKGIKGANGEPGEAGLNGKIGETGSIGFKGEPGEKGQKGDIGFEGSKGVKGNKGLIGVTKNGEQGKQGEPGDIGESGKRGMKGDVGEQGIQGSTGYQGIYGDPGEKGYQGPKGNKGKQGPKNAEDIKGEIGEKGAQGAQGKTGIKGDEGSIGDCIGIPSKGDRGNFGEKGSLGDKGKIGEKGDKGEPGPSNDFGRQGVEGNKGNPGNKGNKGEAGDRGFQGEEGKQGIIGEPGLKGLKGSKGLQGIFGSKGLKGVNGNQGELGPITKGEKGIMGEQGTVGRKGDKGNMGDGKIRGIKGDRGNPTTGFIGENGDKGILGQKGIFGLKGSKGNQGPIGFLGPKGEKGYKGIKGEIGDKGNIGYPGISGFQGSKGERGDLGKDGVPGMKGEIGNKGVPGNFVIGIRGDLGDSG---------------------KKGSDGEVGETGDKGIKGQRGVMGLFGEKGNKGYLGPKGNIGEKGDFGELGAQGRQGDPGKQGMQGQIGDPGENGEIGNVGIKGDKGKMGECILGKVGEVGIEGEIGLTGIKGEKGIEGLPGKHGYKGQKGFSVAGNKGIEGDIGFEGRRGTKGDHGINGDQGDRGNNGSIGPKGFKGFQGENGNKGLKGIKGVIGLKGLEGEKGKQGYTGRRGEQGPHGNNGTTGVKGNFGSPGPIGEKGVSGDKGEKGEKGFKGMIGKETNGERGRIGEVGDQGNVGQKGEFGELPDRGRKGEKGSKGIIGVTDSEIGIQGEEGDKGSIGIKGK--IGKSGEVGKKGIKGTIGSFGRPASITITSTLLFTFHIQDSDTKKLECPGKSQKIYAGYSFVMVNGGGQLHSMDIGTPSSCLQTFNIMPFAHCLRDGSCSTGIRSDKSYWLSSLEPESLTPVDVSKMYKALSQCVVCEIPTQPYAFHSQTERYNDISCPEDWVELWRGYSFVMHSSASKSGGQSLSSPGSCIQYFRFHPLIECNNGMSSCHHWADGNAYYLRSLSGEFFNSTKEAQYLEQTTKNMKEILDSISRCVVCTK 1759          
BLAST of Collagen alpha-2(IV) chain vs. Planmine SMEST
Match: SMESG000002557.1 (SMESG000002557.1)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 806/1770 (45.54%), Postives = 1032/1770 (58.31%), Query Frame = 1
Query:  187 WTGRKNCNTVCTQNTCRCVGIPGPKGDYGRIGNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQ---PKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLP---GKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLC---XXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGE---------------LGPKGNVGPQGD------QGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQE---QGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALESTFLFTRHFQNREEKPV-CPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDMIEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHTTGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDSEF--EVPKGKYIKAEDDKSKNVYKELSRCKVCMK 5388
            ++   NC   C  ++CRC+   G KGD G+ G  G  G +G+TG++G  G++G+ GD G  G  G  GD G SG  GI G  GD G+ G  G  GD GL GCNGT GEKGN GL GK GL+G  G KG KG IG+ GD   ++  EKGF G+ G +G  G +G  G +G  GD G+ G  G  G QG  GM G PGD       +  KG KG  G  G+ G++C L  L G T  ++ GD G+KG  GQKG  G KGI G  G+DG +G+ G KGD G  G  G  G  G  G+KG KG+ G DG +G KG  G KG +G  G DGNRG KG+ GE G +  C    +G  G  G +GDKGN G  G  G  G KGF+G  G  G IGD G SC+    G+ G IGDKG  G +G  GPRG  G NGD G+EG++      +KG KG++GD G  G  G  G KGVKG +G +G    G  G KG KG  GL+G  GK GK G KG KG  GT C  C   KKG+IG KG KGN+G +GK G+ G+DG  G++G +G  G  G +G++G  GDIG  G+ G KG  G+  ++   T     G KG+ G  GK+G KGI G  G  G+ G +G    +G KGD G+PG +  KGEIG+KG  G     + GE+G  G KG K + G  GEKG+ G C +  ++   + + GD G+ G  G  G  GKVG+KG++G  G  GI G+KG  GK G KG+KG  G  G  G+ GK G++G  G KG+ G +G KGDIG +G  G KG+ G IG    G +G +G  G+ GE+G RG+ G  G+ G QG +G QG  G+ G KG++G KGN GK GP   + IKG  G+ G  G QG  G  G+ G  G+C G    G+RG+ G KG  G KG+ G  GDKGE G     G  G +G++G  G KGN G  GDRG  G+ G  G  G  G KG+ G KG QG+ G KG  G  G+QGE G  TKG++G  G  G +G  G KG +G+  +RG KGD G    G  GE+G  G  G KG  G++G KG+ GPIG  GP G KG KG KG+IG+ G+ G  G +G  G KGERG+ GKDG  G+ G  G KG+ G  + G  G +GD+G                     ++G++G++GE G+KG+KG+               LGPKGN+G +GD      QG +G+ G +G  G  GD GE+G+ GNVG KG+KG  G C  G+ G  G  G  G  GIKGE+G+EGLPGK G  G KG    G +G +GDIG +GR G +G  G +G++G+ G +G  G KG KG  G  GN G  G  G  G+KG  G+KG +G  G RG+ G +G  G  G KG  GS G +G KG+ GD+G  G KG++GM+G++  G RG IGE GD G VG KG+ GE   RG KG KG +G+ G +  E   QG  GDKGSIG +G                        P    + ST LFT H Q+ + K + CP  S KI+ GYSFVM NG  +++ M++GT SSCL  FNIMPF  C RDGSC   IR+D+SYWL+SL P +   ++V  + K +S+CV CE P +PYAFHSQT   +D+ CPEDW ELW GYSFVMH++    GGQSLSSPGSC+ YFRF PL+ECNNGM  C+HW D  +Y+LR +  EF     + +Y++      K +   +SRC VC K
Sbjct:   27 FSNASNCRERCDGSSCRCIPNDGQKGDNGKRGRDGVKGRRGFTGDIGMFGSQGIQGDIGKLGIVGESGDHGLSGIIGINGEDGDSGEPGSKGSIGDTGLKGCNGTKGEKGNVGLIGKQGLNGKIGYKGIKGDIGDTGD---SQTKEKGFMGEVGETGSPGLQGERGLQGKPGDNGETGDHGSQGIQGDRGMPGIPGDSGFVNSNLQIKGFKGKSGIPGEPGSNCYLAYLNG-TRSNKNGDYGDKGFQGQKGLPGRKGIQGIYGIDGNIGNSGPKGDPGFRGKIGPKGNTGSHGAKGRKGVSGIDGYLGSKGKIGYKGQRGTAGIDGNRGLKGDRGEPGDNTDCTKMKEGMIGEIGVQGDKGNNGGTGLMGKKGNKGFRGNQGKRGDIGDPGASCIHAPKGRIGAIGDKGIIGTNGRPGPRGLKGINGDEGEEGEVSY---YIKGGKGETGDAGAIGITGDQGKKGVKGRKGYAGDGVLGKFGEKGIKGISGLNGFPGKTGKPGSKGFKGENGTMCNSCIIGKKGEIGSKGSKGNKGIEGKKGINGKDGRQGLKGIKGSFGKSGKVGKQGDAGDIGKSGIKGMKGEPGSS-NNLTNTVREQNGNKGETGEFGKKGEKGIAGKIGNFGRIGSNG---LIGFKGDPGDPGAQSEKGEIGDKGLSGKSFTLIYGEKGELGNKGNKGLSGVSGEKGNLGECIVTHLENQTSIDTGDVGEIGSVGEPGIPGKVGLKGEKGIIGKSGIEGQKGSSGKSGMKGIKGANGEPGEAGLNGKIGETGSIGFKGEPGEKGQKGDIGFEGSKGVKGNKGLIGVTKNGEQGKQGEPGDIGESGKRGMKGDVGEQGIQGSTGYQGIYGDPGEKGYQGPKGNKGKQGPKNAEDIKGEIGEKGAQGAQGKTGIKGDEGSIGDCIGIPSKGDRGNFGEKGSLGDKGKIGEKGDKGEPGPSNDFGRQGVEGNKGNPGNKGNKGEAGDRGFQGEEGKQGIIGEPGLKGLKGSKGLQGIFGSKGLKGVNGNQGELGPITKGEKGIMGEQGTVGRKGDKGNMGDGKIRGIKGDRGNPTTGFIGENGDKGILGQKGIFGLKGSKGNQGPIGFLGPKGEKGYKGIKGEIGDKGNIGYPGISGFQGSKGERGDLGKDGVPGMKGEIGNKGVPGNFVIGIRGDLGDSG---------------------KKGSDGEVGETGDKGIKGQRGVMGLFGEKGNKGYLGPKGNIGEKGDFGELGAQGRQGDPGKQGMQGQIGDPGENGEIGNVGIKGDKGKMGECILGKVGEVGIEGEIGLTGIKGEKGIEGLPGKHGYKGQKGFSVAGNKGIEGDIGFEGRRGTKGDHGINGDQGDRGNNGSIGPKGFKGFQGENGNKGLKGIKGVIGLKGLEGEKGKQGYTGRRGEQGPHGNNGTTGVKGNFGSPGPIGEKGVSGDKGEKGEKGFKGMIGKETNGERGRIGEVGDQGNVGQKGEFGELPDRGRKGEKGSKGIIGVTDSEIGIQGEEGDKGSIGIKGK--IGKSGEVGKKGIKGTIGSFGRPASITITSTLLFTFHIQDSDTKKLECPGKSQKIYAGYSFVMVNGGGQLHSMDIGTPSSCLQTFNIMPFAHCLRDGSCSTGIRSDKSYWLSSLEPESLTPVDVSKMYKALSQCVVCEIPTQPYAFHSQTERYNDISCPEDWVELWRGYSFVMHSSASKSGGQSLSSPGSCIQYFRFHPLIECNNGMSSCHHWADGNAYYLRSLSGEFFNSTKEAQYLEQTTKNMKEILDSISRCVVCTK 1762          
BLAST of Collagen alpha-2(IV) chain vs. Planmine SMEST
Match: SMESG000071508.1 (SMESG000071508.1)

HSP 1 Score: 324.324 bits (830), Expect = 2.185e-89
Identity = 540/1406 (38.41%), Postives = 712/1406 (50.64%), Query Frame = 1
Query:  205 CN-TVCTQNTCRCVGIPGPKGDYGRIGN---------------PGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAK---KGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKG-KTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKG---NQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKG---ERGPSGRPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTA--CKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRG---RPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGS---------DXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGD--IGDKGRSGAKGDTGAIGNPG----IGIKGNEGSRGEEGETGMRG------LPGITGD-----IGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDKTIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERG---DVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGD---QGLNGPKGNVGVIGDRGETGKPGPIGP-----DGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELG------------EPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVG-----------PQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGL---------SGPCQQGRSGNRGEMGAPGKVGI-------KGEQGLEGLPGKIGRMGDKGKPGN----GIEGPDGDIGNKG 4089
            CN + CT+  C C G+ GPKG+ G  G+               PG +G KG  G  G+ G +G++GD G  G  G+ G +G  G  G  G           G+ G  G PG  G  G +G DG+ G  G+ G+KG KG KG+         A+   KG KGF+G +G  GE G+ G  G +GM G QGDKG      D G +G  GE G+  K I+    +G    IGD G    +   KG + PP   GD G+ G  G +G+          G  GA G +G +GD G +G  G PG  G PG  G  GI G  G  G    EG +G +G  G  GN G KG  G  G +    GN+ G +G  G+KG+KG   ++GIPG +G+ G+ G +G  G  G  G       PG++G  G+KG  G  G  G RG+ G+                 KG+KGD G  GL G KG +G  G  G   E+G  G   T + G +G KG KG  G  G+ G  G +G  G  G+   C     G+ G+KG  G  GE+G DGL G DG  G RG++G   +PG DG  G++G  GD GD G+ G KG      ++R E      GE+GD G  G++G +G+ G  G  G+ GI GD G+ G+ G  G    KG+KGE G+ G  G +A+ + G++G+QG+ G     G KGEKG + N  +   K         +GD GE G++G  G  G  G++G+KG           G  G  G+ G+ GN G KG  G DG+ G+ G RG  G  GEKGDIG  G+ GD   G  G  G KGD G IG  G    IGIKG +G  G++G TG+RG        G+ GD     IG +G  G QG+IG  G  G KG KGN+G P    D T+KG KG  GE G +G +G  GE G KGE    G  G RG   D GP+G +G++G++GI G  GE G  G  G+ GE+G    QG  G KGN G +G +G  G  GP G       G  GP+G  G  G +G+ G+ G+ GPKG  G+  + +KG++G KG MG +G  G KG++G            + G RG KGD G TG  + G  G+ G  G KG +G +G  G  G  G  G  G    + E+GD GE G +G++G  G  G +G  G  G +GPKG  G +GE G+     KG  GP G+NGP G  G  G  G           G  GD G KG KG+KG  G KG+VG            +G +GP+GNTG KGE   KG+FG+ G +G  GP G++G+           P   G  G RG  G  G  G        +GE G++G  G++G +G  G PG+    G  G +GD+G+KG
Sbjct:   29 CNRSNCTE--CSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINGKKGAPGLKGPKG---------YTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG------DIGELGFKGEKGEPVKMISLDKSRG---EIGDKGDKVMIKGQKGIRGPPGPDGDMGDNGAKGYEGRA---------GSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKPGIDGIPGQRGPPG---PEGYQGPEGDIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSEPGEKGPKGEKGLRGLDGKTGKRGEQGY-----------------KGLKGDKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQGSKGIKGRPGGMGRRGVPGERGFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNGEDGEQGERGEQGPDGKPGFDGEKGKKGDLGDKGDMGIKGIKGETIIINNNRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSG---PKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTK--------YKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPVGDKGDKGDVGVIGEKGDKGDIGIKGEKGQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFP----DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSPGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRMGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKGSTG--RPGSLGTRGPDGYKGPRGKDGPPGVPGDKGSVGDSGDSPKEAERGDKGETGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGM-----KGNIGPKGENGPKGLEGEKGLIG---------ETGILGDKGNKGVKGIKGIEGIKGDVGLRGISGRSSNGERGQRGPQGNTGEKGE---KGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKG 1351          

HSP 2 Score: 278.485 bits (711), Expect = 3.912e-75
Identity = 480/1257 (38.19%), Postives = 626/1257 (49.80%), Query Frame = 1
Query:  244 GIPGPKGDYGRIGNPGPIGPKGYTGNMGELG--ARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPGCNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKGIAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCI----GNIQGPQGPFGDKGD------KGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKG--------ISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGD-----IGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSG--LDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDK---TIKGIKGDSGEPGVQGLKGFTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGL---ETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQ---KGESGSNGEFGSKGQKG-MXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQ--GNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPK 3894
            G  GP+GD G  GN G  G KG  G+  ++     G+ GD G  G+ G+ GDRG                  + GD G  G  G  G  GEKGN G +  +   G+KG KG+KG  G  G     K+GE+G+ G +G  G            ++G  G KG  GD G+ GPIG  G+ GD    I        PG  G  G   +   +  +  P +RG  GEKG                   DG  G+RG KG  G  G RG  G  G+ G +G +G +G DG  GF G +G+KG         + G KG++G  G  G+ I       +G +GP G++GD      +G +G+ GY G  GE G                       GD G+KG  G SG  G +G+ G  G  G E +     K ++G  G+ GD+G +GEKG        ++  KG  GE+G  G   T G  G KG KGE GLSG+ GK+GKVG  G  G  G                  N G KG++GL G +G  G RG  G PG  G IG  G  GD     +GD+G  GD G+ G KGD  +      KG+ GD G  G  G  G KG  GL G PGI   +G+ G KG +GN G +G  G  G KG  G     ++G +G+ GE G K   G  GEKG  G         L   + GD+G  G  G+QG  G +G+ G+ G+ G  G +G++G  G  G +G KG +G  G+ G+ G +G +G  + G KG IG QG KG+ G KG  G  GD G  G PG  I G++G +G +G  G  G+ G  GDIG  G  G  G  G  G +G KG KG+TG+PG +G +     KG +G  G PGV G KG  G+SGD  + +      ERGD   KGE G KGE G  GDKG  G+ G+ G+ G KG +G NG  G  G IG +GE G  G  G  G  G  GI G KG +G+ G+KG  G KGD G +G+    + G+RG++G  G  G  G KGE G+ G RG +G  G+ GIG    KGE G  G  G +GQ+G    +      I   GP G  GVKG KG++G +G  G  G  G  G++G  G+ G  G +G  G++GE+GL G   KG+ G  GD G  G+ G  G +G  G KG  G    G++GD G  G++G KGE G  G  GPQGD+G  G  G KGE+  K      G+KG +GP+
Sbjct:  321 GYQGPEGDIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRG------------------IPGDEGSRGDSGLQGPIGEKGNKGRSRGVSEPGEKGPKGEKGLRGLDGK--TGKRGEQGYKGLKGDKG------------VNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSI--------PGAQGSKGIKGRPGGMGRRGVPGERGFIGEKGSCFNCS-------------DGDAGNRGDKGFPGIPGERGIDGLNGEDGEQGERGEQGPDGKPGFDGEKGKKG---------DLGDKGDMGIKGIKGETIIINNNRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGI---------------------HGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG------------------NMGRKGENGLDGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPVGDKGDKGDVGVIGEKGDKGDIGIKGEKGQLGDKGFTGLRGESGDKGFEGLVGDPGILA-IGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRK-GDQGPQGYKGVQGQKGIIGMIGEMGSPGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRMGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKGSTGRPGSLGTRGPDGYKGPRGKDGPPGVPGDKGSVGDSGDSPKEA------ERGD---KGETGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIGPKGENGPKGLEGEKGLIGETGILGDKGNKGVKGIKGIEGIKGDVGLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERGLKG--FKGDIGFKGDQGDKGERGFQGGRGFGGEKGSIGISIPGDKGDKGLLGSEGDKGEKGNPGITGPQGDKGKVGERGEKGESAFK------GEKGFIGPQ 1457          

HSP 3 Score: 267.7 bits (683), Expect = 7.956e-72
Identity = 408/1118 (36.49%), Postives = 531/1118 (47.50%), Query Frame = 1
Query:  961 PGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGSKGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKG-------ISGSKGVKGERGPSG--RPTTGLVGPKGPKGEKGLSGLDGKNGKVGPKGMKGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVG--------VKGDQGAKG--------------SDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGL---DGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGI----------------GIKGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGD------IGNFGPKGFKGIKGNTGKPGPVGDKTI--KGIKGDSGEPGVQGLKG-----------FTGESGDKGECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGL---NGPKGNVGVIGDRGETGKPGPIGPDGATGPKG--INGIKGEQGMMGVKGNNGPKGDQGEKGLETKGQRGEKGNMGVIGNVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
            PG  G  GDRG  G  G  GN G  G +G  G  G KG++G+ G+ G            K+G  G +G KG  GE G  GK      G +G  G +G  G QGIPG QG  G KG KG   P           LP +RGD G KG +G  G  G  GD G                  +G KGD G+ G +GEKG       +  S+G  G++G     +   G+ GP GP G+ G +G  G  G+ G KG +GL G    L         G  G  G+ G++G  G+ G  GI G RG PG +G  G EG  G  G+ GL   KG KG KGD+ + +  ++ G +GD G  G++G  G +G PG  G  G SG  G +G KG++G                    ++P  GE+G +GEKG++ +DG+ G++G+ G   +   K +N    G +GDTG+ G  GPIG+ G        + G QG+KG               +     +       + G  G +G  G PGIPG+RG  GL   DGE+G+ G QG  G  G  G  G KGD G  G+ GI                G KG  G RG+ GE G +GL G+ G  G +GESG  GD       G  GPKG KG +G+TG PG   +K    KGI+GD GE G +G KG            T   GD GE   +G  G +G  G  G +G KGE G++G  G+ G +G +G++GEKG+ G    NG  G  GV GDRG  G PG  G  G TG  G  I G  G++G  G  G  G KGD+G+ G+     +GEKG +G  G  G +GE G+ G  G  GD G   IG+KG  G  G  G +G  G++G KG+ G       G            GEI                        GPKG  G+ GEKG      KGE GP G +G                      +G +GD G +G KGV+G+ G  G +G  G  G KG+TG +G  G +G  GE G++G++G KG KG  GP   G  G +G +G  G+   KGE G +G+ G  G  G KG PG  I G  G+ GNKGR
Sbjct:   58 PGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGING------------KKGAPGLKGPKGYTGEEGCCGK-----PGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQE-------GVLPAERGDKGAKGFSGLKGEIGEFGDVG--------EPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKVMIKGQKGIRGPPGPDGDMGDNGAKGYEGRAGSKGAEGLKGIRGDL---------GPIGKHGKPGENGSPGKPGIDGIPGQRGPPGPEGYQGPEGDIGAAGNSGL---KGYKGLKGDTIDISG-NVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGV---------------SEP--GEKGPKGEKGLRGLDGKTGKRGEQGYKGLKGDKGVNGL-TGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQGSKGIKGRPGGMGRRGVPGERGFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNGEDGEQGERGEQGPDGKPGFDGEKGKKGDLGDKGDMGIKGIKGETIIINNNRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGE---KGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPVGDKGDKGDVGVIGEKGDKGDIGI-----KGEKGQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIP-------GEI------------------------GPKGFQGLPGEKGF-----KGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSPGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQ---KGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR 1044          

HSP 4 Score: 218.394 bits (555), Expect = 1.089e-56
Identity = 429/1213 (35.37%), Postives = 560/1213 (46.17%), Query Frame = 1
Query: 1213 NIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRP-TTGLVGPKGPKGEKGLSGLDGKNGKVGPKGM----KGLLGTACKLCXXXXXXXXXXXXNQGEKGKDGLAGRDGNPGIRGDRGRPGNDGAIGREGSYGDIGDRGLPGDKGIKGAKGDSREETFPSIKGEKGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQGPIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGIKGNE-GSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKGNTGKPGPVGDK--------TIKGIKGDSG---------EPGVQGLKGFTGESGDKGECSGRGEFGERGDVG---PKGERGI---KGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGET---------GKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE----TKGQRGEKGNMGVIGNVGAK-----------GELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKDGPKGLSGISGEKGLSGIT-LKGES--GPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGPKGNTG--------SKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQ---------QGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPG-NGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTG-----ILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGA 4614
            +  G  GP G+ G  G++G PG++G  G++G                       G +G+KG  G  G  GP+G  G                  KG++G+SG  G +G  G+ G KG  GE G  G+P   G  G +G  G +G+ G+ G+ G+ GPKG     +G+L                    +G+KG  G +G  G  G  GD G PGN G IG +G  GDIG+ G  G+KG        +  +    +GE GD G         IKG  G+ G PG  GDMG  G KG EG  G                 +K  +G +G++G+ G     G+ GE G  G   I+ +        G RG  G  G QGP G +G  G+ G KG                         D    + G RG  G  GEKG  G++G+ GD G +G SG +G  G  GN G     +E G +G +GE G+RGL G TG  G QG  G +GD G  G  G KG  G+ G+ GP+G+K        +I G +G  G           GV G +GF GE G    CS  G+ G RGD G     GERGI    GE G  G++GE G  G+ G +GEKG +G  G KG++G+ G +GET         G  GP G  G  G  G  G++G  G  G KG +G  GD+GEKGL      KG +GE+G+ G+ G    K           GELG+ G +G KG N    +      G NGE G KG +G  G  G+ G  G  G  G+ G  G+   +G  G  G+ G  G  G+ G  G  G  G +G  G  GEKG  G+T + G+S  GP+GD G  GD+G+                G +GD G+ G KG KG+LG KG  G +G+ G KG  G        + GE GPKG  G  G++GN G KG KG SG             G  G +G  G PG+ G KGE G  G  G  GR GD+G  G  G++G  G IG  G  G  G KG++GE+G  G  G QG KG +G +G KG  G  G  G                 GP+G  G +G KGVQG  G+ G  G     I+G+KG                    +KGN+G +GE   +G  G KGD+      GP G+ G  G  G  GQ +G+ GDKGS G  G+
Sbjct:   38 SCNGLLGPKGEMGFGGHEGKPGFRGVKGDRG---------------------PPGALGEKGNEGYKGDQGPKGMIG-----------------DKGVQGNSGINGKKGAPGLKGPKGYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVL-----------------PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-----VKMISLDKSRGEIGDKGDKVM-----IKGQKGIRGPPGPDGDMGDNGAKGYEGRAG-----------------SKGAEGLKGIRGDLGPIGKHGKPGENGSPGKPGIDGIP-------GQRGPPGPEGYQGPEGDIGAAGNSGLKGY----------------KGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSEPGEKGPKGEKGLRGLDGKTGKRGEQGYKGLKGDKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQGSKGIKGRPGGMGRRGVPGERGFIGEKGSCFNCS-DGDAGNRGDKGFPGIPGERGIDGLNGEDGEQGERGEQGPDGKPGFDGEKGKKGDLGDKGDMGIKGIKGETIIINNNRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGK---VGNSGKDGEKGNMGRKGENGLDGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPVGDKGDKGDVGVI---------------GEKGDKGDIGIKGEKGQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSPGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLI-------GPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKG--------------------EKGNKGRMGE---MGVKGFKGDI------GPIGLPGSIGFQGQEGQ-RGLKGDKGSTGRPGS 1089          

HSP 5 Score: 205.297 bits (521), Expect = 1.185e-52
Identity = 154/388 (39.69%), Postives = 223/388 (57.47%), Query Frame = 1
Query: 4270 ENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVGSKGDVGEPAVRGPKGVKGEQGLSGYSGQEQGMVGDKGSIGPQGARXXXXXXXXXXXXXXXXXXXXXXXXXXALEST-FLFTRHFQNREEKPVCPIGSNKIFEGYSFVMANGNHEVNVMNLGTHSSCLNYFNIMPFQQCSRDGSCKQKIRADRSYWLASLAPVTGDM-IEVQNVEKYISRCVTCESPAEPYAFHSQTNNLSDVVCPEDWTELWNGYSFVMHT-TGGNGGGQSLSSPGSCLPYFRFSPLLECNNGMDRCNHWHDAKSYFLRHVDS--EFEVPKGKYIKAEDDKSKNVYKELSRCKVCMKKKLQPLL-YI 5415
            + G RG  GL G +G++G+KG++G  G  G KG +G +G  G  G +G +G    G++G+    G +G  G KG+ G P + GP+G KG+ G  G  G E    G+KG IGPQG  GKPG KGD GP G  G  G  G  G+   +T  +F  H Q+ +  P CP  +  +++GYSF+   G+   ++ +L +  SCL  F+ +PF  C +   C   +R DR+YWL+S   +   M I V  V+ Y+SRCV CE+P++PYAFHSQ+       CP  WT LW+G SF+M+T  G  GGGQ LSSPGSCL  F+    LEC      C ++ + K ++L   DS   F++  G  IK    +S+++   +++C VCM+   QP++ YI
Sbjct: 1349 DKGVRGPQGLAGERGLKGFKGDIGFKGDQGDKGERGFQGGRGFGGEKGSIGISIPGDKGD---KGLLGSEGDKGEKGNPGITGPQGDKGKVGERGEKG-ESAFKGEKGFIGPQGLGGKPGPKGDPGPVGDPGIRGHPGNQGETRGNTGSIFATHSQSTK-IPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPK--CPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLEC-TAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTM--QSEDL---IAKCLVCMRN--QPMVGYI 1721          

HSP 6 Score: 190.274 bits (482), Expect = 5.115e-48
Identity = 349/948 (36.81%), Postives = 472/948 (49.79%), Query Frame = 1
Query:  280 GNPGPIGPKGYTGNMGELGARGLVGDSGSNGQDGLPGDRGESXXXXXXXXXXXXXXXXLFGDRGDVGLPG----------------------------------------CNGTNGEKGNDGLAGKMGLSGDKGVKGDKGYIGEPGDFFQAKKGEKGFAXXXXXXXXXXXXXXXXXXXMDGDQGDKGIRGDVGDQGPIGMSGEPGDQPKG-IAQKGEKGFPGPIGDAGTDCKLFVLKGKTPPDQRGDSXXXXXXXXXXXXXXXXXXXXPGLDGAVGDRGQKGDTGNVGNRGTPGPKGQPGS--------KGAKGIRGSDGVIGFXXXXXXXXXXXXXXXXXNRGSKGEVGEAGGSGKCIGNIQGPQGPFGDKGDKGNQGIPGYQGNLGEKGFKXXXXXXXXXXXXXXSCLPGKRGDIGDKGENGESGAHGPRGDFGFNXXXXXXXXXXXXXKTVKGIKGDSGDEGLQGEKGISGSKGVKGERGPSGRPTTGLVGPKGPKGEKGLSG---LDGKNGKVGPKGMKGLLG---TACKLCXXXXXXXXXXXXNQGEKGKDGLAG---RDGNPGIRGDRGRPGNDGAIGREGSYGD---------IGDRGLPGDKGIKGAKGDSREETFPSIKGE---KGDNGPDGKEGPKGIKGSPGLNGKPGISGDMGKMGVKGDEGNPXXXXXXXXXXXXXXXXXDAKPVQGERGLQGEKGIKPIDGEKGEKGDSGNCTINFVKPLNATEMGDRGDTGEPGLQG-------------------PIGKVGVKGDQGAKGSDXXXXXXXXXXXXXXXXXXXXXXFDGVPGIPGKRGQSGLDGEKGDIGNQGMKGDIGDKGRSGAKGDTGAIGNPGIGI---KGNEGSRGEEGETGMRGLPGITGDIGNQGESGEQGDIGNFGPKGFKGIKG---------NTGKPGPVGDKTIKGIKGDSGE 2820
            G+ GP G +G  G +GE G RGL G SG  G+ G+ GD+GE G  G  G  G      + G+RGD GLPG                                          G NGEKG  G  G  G  G+KG KG+ G  G PG     K G+ G +G +G  G  G KG  G  G++G +GD+G  G  G++G IG++G PGD   G +  KG+KG  G IG+ G    + +   K    Q GD G  G  G+ G  G +G+ G+PG+  A+G++G KG  GN+G RG PG KG  G+        KG KGI G  G  GF+G+ G             +G KGE+G  G SG  +   +G QGP G KG +G +GI G  G +G                      PG +GD G++G  G  G  G +G+ G  G  G +G+ G  G  +KG+KG  G +G +GE G  G +G+ G++GP G P   ++G KG KG KG  G   + G  G +GP G+ G +G      +   KGD G  G  G+ G +G DG  G   +DG PG+ GD+G  G+ G   +E   GD         +G++G  G++G+ G  GD   + +    GE   KG+ GP G+ GPKG++G  GL G+ GI GD G  GVKG +G  G+KG  G  G  G      +  +G +G  GEKG K   G+ G++G  G      +  L     G+RGD G  G +G                   P G+ GVKG +G  GS G +G  G  G+ G +G++G  G  GV G  G  G+ GL G KGDIG +G +GD G++G  G +G  G  G+ GI I   KG++G  G EG+ G +G PGITG  G++G+ GE+G+ G    KG KG  G           G PGPVGD  I+G  G+ GE
Sbjct:  591 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKG------IKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG-----KHGKVGNSGKDGEKGNMGRKGENGLDGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPVGDKGDKGDVGVIGEKGDKGDIGI---KGEKGQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPG------------EKGFKGEIGPTGTSG--LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------------------PGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRMGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKGSTGRPGSLGTRGPDGYKGPRGKDGPPGVPGDKGSVGDSGDSPKEAERGDKGETGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIGPKGENGPKGLEGEKGLIGETGILGDKGNKGVKGIKGIEGIKGDVGLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVK--GERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERGLKGFKGDIGFKGDQGDKGERGFQGGRGFGGEKGSIGISIPGDKGDKGLLGSEGDKGEKGNPGITGPQGDKGKVGERGEKGESAFKGEKGFIGPQGLGGKPGPKGDPGPVGDPGIRGHPGNQGE 1486          

HSP 7 Score: 91.6633 bits (226), Expect = 5.329e-18
Identity = 153/422 (36.26%), Postives = 204/422 (48.34%), Query Frame = 1
Query: 2872 ECSGRGEFGERGDVGPKGERGIKGEQGINGDKGESGMIGRTGENGEKGDQGLNGPKGNVGVIGDRGETGKPGPIGPDGATGPKGINGIKGEQGMMGVKGNNGPKGDQGEKGLE-TKGQRGEKGNMGVIG-NVGAKGELGEPGMRGSKGDNGETGIGQKGESGSNGEFGSKGQKGMXXXXXXXXXXXXXXXXXXXXXXXXXXDIGEIXXXXXXXXXXXXXXXXXXXXXXKD-GPKGLSGISGEKGLSGITLKGESGPIGDNGPTXXXXXXXXXXXXXXXXXXXRQGNEGDIGEKGNKGVKGELGPKGNVGPQGDQGP------------KGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPCQQGRSGNRGEMGAPGKVGIKGEQGLEGLPGKIGRMGDKGKPGNGIEGPDGDIGNKGR 4092
            ECS  G  G +G++G  G  G  G +G+ GD+G  G +G  G  G KGDQG   PKG   +IGD+G  G  G  G  GA G KG  G  GE+G  G  G  G  G QG  G++   G +GEKG  G  G ++  +G L  P  RG KG  G +G+  KGE G  G+ G  G KGM G +GD G                  DIGE+G +G+ G+   +    +      D G K +  I G+KG+ G    G  G +GDNG  G                   +G  G  G +G KG++G+LGP G  G  G+ G             +G  G +G  GP+GD G  G+ G  G KG KG +       +G RG+ G  G+ GI G++   G+PG  G  GD     +G++GP G+ GNKGR
Sbjct:   36 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG---PKG---MIGDKGVQGNSGINGKKGAPGLKGPKGYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVL--PAERGDKGAKGFSGL--KGEIGEFGDVGEPGNKGMIGYQGDKG------------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKVM--IKGQKGIRGPP--GPDGDMGDNGAKG------------------YEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKPGIDGIPGQRGPPGPEGYQGPEGDIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDR---GIPGDEGSRGD-----SGLQGPIGEKGNKGR 399          

HSP 8 Score: 53.1434 bits (126), Expect = 2.712e-6
Identity = 118/351 (33.62%), Postives = 155/351 (44.16%), Query Frame = 1
Query: 3712 QGNEGDIGEKGNKGVKGELGPKGN------VGPQGDQGPKGNTGSKGETGPKGDFGEDGDKGNVGPKGNKGLSGPC----QQGRSGNRGEMGAPGKVG--IKGEQGLEGL------------PGKIGRMGDKGKPGNGIEGPDGDIGNKGRXXXXXXXXXXXXXXXXXXXXRQGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPRGDVGLNGIKGVQGYKGEMGSTGILGAKXXXXXXXXXXXXXXXXXXXEDKKGNRGEIGEPGDIGKVG------------------SKGDVGEPAVRGPKGVKGEQGLSGYSGQE-------QGMVGDKGSIGPQGAR 4617
            +G  GD G +G+ G++G +G KGN      V   G++GPKG  G +G  G  G  GE G KG  G KG  GL+GP       G +G  GE G  G VG  I G QG +G+            PG+ G +G+KG   N     DGD GN+G +G  GI GE G  G +GE G QG +G                                 E GP G  G +G KG +G  G+ G  GI G KG                  E  KG  GE G+PG++G+ G                   KG+ G     GPKG+KGE+G +G  G+E       +G+ GD G +G +G +
Sbjct:  373 RGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSEPGEKGPKGEKGLRGLDGKTGKRGEQGYKGLKGDKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQGSKGIKGRPGGMGRRGVPGERGFIGEKGSCFNC---SDGDAGNRGDKGFPGIPGERGIDGLNGEDGEQGERG---------------------------------EQGPDGKPGFDGEKGKKGDLGDKGDMGIKGIKGETIIINNNRT--------EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFK 679          
The following BLAST results are available for this feature:
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL4A23.156e-8132.31collagen type IV alpha 2 chain [Source:HGNC Symbol... [more]
COL24A15.685e-6133.01collagen type XXIV alpha 1 chain [Source:HGNC Symb... [more]
COL4A68.855e-5735.17collagen type IV alpha 6 chain [Source:HGNC Symbol... [more]
COL4A51.728e-5540.51collagen type IV alpha 5 chain [Source:HGNC Symbol... [more]
COL4A51.940e-5540.51collagen type IV alpha 5 chain [Source:HGNC Symbol... [more]
back to top
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-28.152e-5841.74Collagen alpha-2(IV) chain [Source:UniProtKB/Swis... [more]
let-28.152e-5841.74Collagen alpha-2(IV) chain [Source:UniProtKB/Swis... [more]
let-28.718e-5841.74Collagen alpha-2(IV) chain [Source:UniProtKB/Swis... [more]
let-28.718e-5841.74Collagen alpha-2(IV) chain [Source:UniProtKB/Swis... [more]
col-1353.574e-5738.36COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
back to top
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col4a12.273e-13635.26gene:FBgn0000299 transcript:FBtr0079003[more]
Col4a12.273e-13635.26gene:FBgn0000299 transcript:FBtr0079002[more]
Col4a12.273e-13635.26gene:FBgn0000299 transcript:FBtr0079001[more]
vkg1.037e-6332.91gene:FBgn0016075 transcript:FBtr0333541[more]
vkg1.037e-6332.91gene:FBgn0016075 transcript:FBtr0079036[more]
back to top
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col4a53.703e-5843.97collagen, type IV, alpha 5 (Alport syndrome) [Sour... [more]
col4a54.399e-5843.97collagen, type IV, alpha 5 (Alport syndrome) [Sour... [more]
col4a36.534e-5838.66collagen, type IV, alpha 3 [Source:ZFIN;Acc:ZDB-GE... [more]
col4a27.836e-5836.54collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GE... [more]
col4a23.009e-5736.60collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Collagen alpha-2(IV) chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5