Boule 2 RNA-binding protein

Overview
NameBoule 2 RNA-binding protein
Smed IDSMED30017509
Length (bp)1027
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Boule 2 RNA-binding protein (SMED30017509) t-SNE clustered cells

Violin plots show distribution of expression levels for Boule 2 RNA-binding protein (SMED30017509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
ovarySMED30017509SMESG000061507.1 KT709533.1smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30017509SMESG000061507.1 KT709533.1smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30017509SMESG000061507.1 KT709533.1smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30017509SMESG000061507.1 KT709533.1smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30017509SMESG000061507.1 KT709533.1smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism juvenile colorimetric in situ hybridization evidence
oogonial stem cellSMED30017509SMESG000061507.1 KT709533.1smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism juvenile colorimetric in situ hybridization evidence
oogonial stem cellSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27149082
Steiner et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oocyteSMED30017509SMESG000061507.1 Contig54838newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30017509SMESG000061507.1 Contig54838uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30017509SMESG000061507.1 Contig54838newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30017509SMESG000061507.1 Contig54838uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogonial stem cellSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatidSMED30017509SMESG000061507.1 KU519617smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Boule 2 RNA-binding protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 102.449 bits (254), Expect = 1.730e-24
Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGFVTF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   38 RYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 124          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 102.064 bits (253), Expect = 1.849e-24
Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGFVTF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   26 RYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 112          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 102.064 bits (253), Expect = 1.849e-24
Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGFVTF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   26 RYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 112          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 101.679 bits (252), Expect = 7.598e-24
Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGFVTF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   26 RYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 112          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Human
Match: DAZL (deleted in azoospermia like [Source:HGNC Symbol;Acc:HGNC:2685])

HSP 1 Score: 78.9518 bits (193), Expect = 1.149e-16
Identity = 40/103 (38.83%), Postives = 60/103 (58.25%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLP 391
            ++PN +FVGG      E E++SFF +YG +K+VKII D+ G +KG YGFV+F +    ++I+  Q     F  +KL +G A++KQ L         L+ N  P
Sbjct:   75 IMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFFNDVDVQKIVESQIN---FHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPP 173          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Celegans
Match: daz-1 (DAZ protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20870])

HSP 1 Score: 99.3673 bits (246), Expect = 8.263e-23
Identity = 56/126 (44.44%), Postives = 74/126 (58.73%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKK------QPLTGKSELQNTLILNTLPLSY---GSVYPYQDYSY 433
            LIPNRIFVGGFP +TTE EL+  F K+  +KDVK++    GQ+KG YGF+TF +++ AE I     + L FR RKLN+G A++K      QP    +     +  +  P SY    S  PY  YSY
Sbjct:   63 LIPNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKG-YGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATPSQLVAASPGPFSYAIPASPSPYSGYSY 187          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 57.3806 bits (137), Expect = 4.518e-9
Identity = 23/58 (39.66%), Postives = 39/58 (67.24%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERII 268
            ++F+GG    +T E++K +F  YG+++D  ++ DKA Q    +GFVTF S EVA+++ 
Sbjct:  135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVC 192          

HSP 2 Score: 51.2174 bits (121), Expect = 4.441e-7
Identity = 18/67 (26.87%), Postives = 37/67 (55.22%), Query Frame = 2
Query:   89 PNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETL 289
            P ++F+GG    TT E L+ +F ++GE+ +  ++ D A +    +GF+TF      ++++  +   L
Sbjct:   44 PGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHEL 110          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 51.6026 bits (122), Expect = 6.116e-8
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAER 262
            +IFVGG P +T+++ L  +F ++G+I++  +I D+  Q    YGFVT   +  AER
Sbjct:   36 KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAER 91          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 52.7582 bits (125), Expect = 1.033e-7
Identity = 25/74 (33.78%), Postives = 42/74 (56.76%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNI 316
            +IFVGG P +T+++ L  +F ++G+I++  +I D+  Q    YGFVT   +  AER   +     +   RK N+
Sbjct:   36 KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD--PNPIIDGRKANV 107          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Celegans
Match: rbm-3.1 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45712])

HSP 1 Score: 49.2914 bits (116), Expect = 1.162e-7
Identity = 28/78 (35.90%), Postives = 42/78 (53.85%), Query Frame = 2
Query:   98 IFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVK 331
            ++VG  P  TTEEEL +FF   G+I +V+I+ D+       + F+ FA +  A+R + EQ     F  R L +  A K
Sbjct:    7 VYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAV-EQMNGAEFNGRPLRVNLANK 83          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076538)

HSP 1 Score: 100.908 bits (250), Expect = 9.457e-25
Identity = 56/114 (49.12%), Postives = 73/114 (64.04%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVY 412
            K  TLIPNRIFVGG   +TTE +L   F  YG +K  KII D+AG +KG YGFVTF +++ A+R+  +  E +V RDRKLNI  A+KKQP    + LQ+ +  N      G+VY
Sbjct:   26 KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQRLQAD-GECVVLRDRKLNIAPAIKKQP----NPLQSIVATN------GAVY 127          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0344979)

HSP 1 Score: 100.908 bits (250), Expect = 9.457e-25
Identity = 56/114 (49.12%), Postives = 73/114 (64.04%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVY 412
            K  TLIPNRIFVGG   +TTE +L   F  YG +K  KII D+AG +KG YGFVTF +++ A+R+  +  E +V RDRKLNI  A+KKQP    + LQ+ +  N      G+VY
Sbjct:   26 KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQRLQAD-GECVVLRDRKLNIAPAIKKQP----NPLQSIVATN------GAVY 127          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076540)

HSP 1 Score: 100.908 bits (250), Expect = 9.457e-25
Identity = 56/114 (49.12%), Postives = 73/114 (64.04%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVY 412
            K  TLIPNRIFVGG   +TTE +L   F  YG +K  KII D+AG +KG YGFVTF +++ A+R+  +  E +V RDRKLNI  A+KKQP    + LQ+ +  N      G+VY
Sbjct:   26 KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQRLQAD-GECVVLRDRKLNIAPAIKKQP----NPLQSIVATN------GAVY 127          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0331858)

HSP 1 Score: 100.908 bits (250), Expect = 1.111e-24
Identity = 56/114 (49.12%), Postives = 73/114 (64.04%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVY 412
            K  TLIPNRIFVGG   +TTE +L   F  YG +K  KII D+AG +KG YGFVTF +++ A+R+  +  E +V RDRKLNI  A+KKQP    + LQ+ +  N      G+VY
Sbjct:   26 KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQRLQAD-GECVVLRDRKLNIAPAIKKQP----NPLQSIVATN------GAVY 127          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076539)

HSP 1 Score: 98.9821 bits (245), Expect = 1.553e-24
Identity = 56/114 (49.12%), Postives = 73/114 (64.04%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVY 412
            K  TLIPNRIFVGG   +TTE +L   F  YG +K  KII D+AG +KG YGFVTF +++ A+R+  +  E +V RDRKLNI  A+KKQP    + LQ+ +  N      G+VY
Sbjct:   26 KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQRLQAD-GECVVLRDRKLNIAPAIKKQP----NPLQSIVATN------GAVY 127          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 70.4774 bits (171), Expect = 6.786e-14
Identity = 44/119 (36.97%), Postives = 64/119 (53.78%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ--------PLTGKSELQNTLILNTLPLSYGSVYP 415
            + PN +FVGG      E E++ FF KYG +K+VKII  + G  KG YGFV F S++V  + I +Q   + F+ +KL +G A+ K+        P+ G S+      +N  P  Y S  P
Sbjct:   27 MTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYF-SEDVDIQTIVDQP--ISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQW-----VNPPPYMYCSCCP 136          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 70.4774 bits (171), Expect = 8.969e-14
Identity = 44/119 (36.97%), Postives = 64/119 (53.78%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ--------PLTGKSELQNTLILNTLPLSYGSVYP 415
            + PN +FVGG      E E++ FF KYG +K+VKII  + G  KG YGFV F S++V  + I +Q   + F+ +KL +G A+ K+        P+ G S+      +N  P  Y S  P
Sbjct:   27 MTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYF-SEDVDIQTIVDQP--ISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQW-----VNPPPYMYCSCCP 136          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 70.0922 bits (170), Expect = 1.427e-13
Identity = 44/119 (36.97%), Postives = 64/119 (53.78%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ--------PLTGKSELQNTLILNTLPLSYGSVYP 415
            + PN +FVGG      E E++ FF KYG +K+VKII  + G  KG YGFV F S++V  + I +Q   + F+ +KL +G A+ K+        P+ G S+      +N  P  Y S  P
Sbjct:   44 MTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYF-SEDVDIQTIVDQP--ISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQW-----VNPPPYMYCSCCP 153          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 70.0922 bits (170), Expect = 1.427e-13
Identity = 44/119 (36.97%), Postives = 64/119 (53.78%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ--------PLTGKSELQNTLILNTLPLSYGSVYP 415
            + PN +FVGG      E E++ FF KYG +K+VKII  + G  KG YGFV F S++V  + I +Q   + F+ +KL +G A+ K+        P+ G S+      +N  P  Y S  P
Sbjct:   44 MTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYF-SEDVDIQTIVDQP--ISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQW-----VNPPPYMYCSCCP 153          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 68.1662 bits (165), Expect = 3.792e-13
Identity = 41/119 (34.45%), Postives = 61/119 (51.26%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ--------PLTGKSELQNTLILNTLPLSYGSVYP 415
            + PN +FVGG      E E++ FF KYG +K+VKII  + G  KG YGFV F+     + I+    + + F+ +KL +G A+ K+        P+ G S+      +N  P  Y S  P
Sbjct:   27 MTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIV----DPISFKGKKLKLGPAIMKERSSRSVSSPMIGPSQW-----VNPPPYMYCSCCP 135          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Xenopus
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:394676])

HSP 1 Score: 67.781 bits (164), Expect = 2.792e-12
Identity = 34/84 (40.48%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKK 334
            +IPN +FVGG      E  + + F KYG++KD+KII D+ G +KG YGFV+F  +   ++I+  Q   + F  +KL +G A++K
Sbjct:   27 VIPNTVFVGGIDITMDEMAIGNLFEKYGKVKDLKIITDRTGVSKG-YGFVSFYDEVDVQKIVKSQ---INFHGKKLKLGPAIRK 106          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 58.5362 bits (140), Expect = 4.602e-9
Identity = 29/92 (31.52%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNT 370
            ++FVGG  ++T E  L+ +F +YG+I+ ++II DK    K  +GFVTF   +  ++I+ ++  T+        + +A+ KQ +    ++QNT
Sbjct:  101 KLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTI--NGHNAEVRKALSKQEM---QDVQNT 187          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 57.7658 bits (138), Expect = 9.007e-9
Identity = 29/92 (31.52%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNT 370
            ++FVGG  ++T E  L+ +F +YG+I+ ++II DK    K  +GFVTF   +  ++I+ ++  T+        + +A+ KQ +    ++QNT
Sbjct:  101 KLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTI--NGHNAEVRKALSKQEM---QDVQNT 187          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 57.3806 bits (137), Expect = 1.108e-8
Identity = 29/92 (31.52%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNT 370
            ++FVGG  ++T E  L+ +F +YG+I+ ++II DK    K  +GFVTF   +  ++I+ ++  T+        + +A+ KQ +    ++QNT
Sbjct:  101 KLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTI--NGHNAEVRKALSKQEM---QDVQNT 187          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 57.3806 bits (137), Expect = 1.176e-8
Identity = 29/92 (31.52%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNT 370
            ++FVGG  ++T E  L+ +F +YG+I+ ++II DK    K  +GFVTF   +  ++I+ ++  T+        + +A+ KQ +    ++QNT
Sbjct:  101 KLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTI--NGHNAEVRKALSKQEM---QDVQNT 187          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 101.293 bits (251), Expect = 7.185e-26
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 2
Query:   65 GNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPL 343
            G +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGF+TF +QE A++I+ E AE L ++D+KLNIG A++KQ +
Sbjct:   36 GPRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQQV 126          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 103.219 bits (256), Expect = 5.645e-25
Identity = 49/92 (53.26%), Postives = 70/92 (76.09%), Query Frame = 2
Query:   62 NGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +G +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGF+TF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   22 SGPRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 111          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 103.219 bits (256), Expect = 6.977e-25
Identity = 49/92 (53.26%), Postives = 70/92 (76.09%), Query Frame = 2
Query:   62 NGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +G +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGF+TF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   35 SGPRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 124          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Mouse
Match: Dazl (deleted in azoospermia-like [Source:MGI Symbol;Acc:MGI:1342328])

HSP 1 Score: 77.7962 bits (190), Expect = 7.410e-16
Identity = 40/100 (40.00%), Postives = 60/100 (60.00%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILN 382
            ++PN +FVGG      E E++SFF +YG +K+VKII D+ G +KG YGFV+F +    ++I+  Q   + F  +KL +G A++KQ L         LI N
Sbjct:   37 IMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFYNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNLCTYHVQPRPLIFN 132          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Mouse
Match: Dazl (deleted in azoospermia-like [Source:MGI Symbol;Acc:MGI:1342328])

HSP 1 Score: 77.0258 bits (188), Expect = 1.097e-15
Identity = 40/99 (40.40%), Postives = 59/99 (59.60%), Query Frame = 2
Query:   86 IPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILN 382
            +PN +FVGG      E E++SFF +YG +K+VKII D+ G +KG YGFV+F +    ++I+  Q   + F  +KL +G A++KQ L         LI N
Sbjct:    1 MPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFYNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNLCTYHVQPRPLIFN 95          
BLAST of Boule 2 RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q924M5|BOLL_MOUSE (Protein boule-like OS=Mus musculus OX=10090 GN=Boll PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 5.151e-24
Identity = 49/92 (53.26%), Postives = 70/92 (76.09%), Query Frame = 2
Query:   62 NGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +G +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGF+TF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   23 SGPRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 112          
BLAST of Boule 2 RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q8WP23|BOLL_MACFA (Protein boule-like OS=Macaca fascicularis OX=9541 GN=BOLL PE=2 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 8.880e-24
Identity = 49/92 (53.26%), Postives = 69/92 (75.00%), Query Frame = 2
Query:   62 NGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +  +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGFVTF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   23 SAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 112          
BLAST of Boule 2 RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q8N9W6|BOLL_HUMAN (Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 8.880e-24
Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            +  T+IPNRIFVGG    T E +L+ FF +YG +K+VKI+ D+AG +KG YGFVTF +QE A++I+ E AE L ++D+KLNIG A++KQ
Sbjct:   26 RYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQE-AEKLNYKDKKLNIGPAIRKQ 112          
BLAST of Boule 2 RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q24207|BOULE_DROME (Protein boule OS=Drosophila melanogaster OX=7227 GN=bol PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.480e-24
Identity = 56/114 (49.12%), Postives = 73/114 (64.04%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVY 412
            K  TLIPNRIFVGG   +TTE +L   F  YG +K  KII D+AG +KG YGFVTF +++ A+R+  +  E +V RDRKLNI  A+KKQP    + LQ+ +  N      G+VY
Sbjct:   26 KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQRLQAD-GECVVLRDRKLNIAPAIKKQP----NPLQSIVATN------GAVY 127          
BLAST of Boule 2 RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q20870|DAZ1_CAEEL (DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN=daz-1 PE=2 SV=3)

HSP 1 Score: 99.3673 bits (246), Expect = 1.016e-21
Identity = 56/126 (44.44%), Postives = 74/126 (58.73%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKK------QPLTGKSELQNTLILNTLPLSY---GSVYPYQDYSY 433
            LIPNRIFVGGFP +TTE EL+  F K+  +KDVK++    GQ+KG YGF+TF +++ AE I     + L FR RKLN+G A++K      QP    +     +  +  P SY    S  PY  YSY
Sbjct:   64 LIPNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKG-YGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATPSQLVAASPGPFSYAIPASPSPYSGYSY 188          
BLAST of Boule 2 RNA-binding protein vs. TrEMBL
Match: A0A172RVR3 (Boule 2 RNA-binding protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 318/318 (100.00%), Postives = 318/318 (100.00%), Query Frame = 2
Query:    5 SEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYXXXXXXXXXXMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK 958
            SEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK
Sbjct:   87 SEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK 404          
BLAST of Boule 2 RNA-binding protein vs. TrEMBL
Match: A0A172M655 (Boule-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.930e-113
Identity = 179/179 (100.00%), Postives = 179/179 (100.00%), Query Frame = 2
Query:  185 IIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYXXXXXXXXXXMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDA 721
            IIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDA
Sbjct:    1 IIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDA 179          
BLAST of Boule 2 RNA-binding protein vs. TrEMBL
Match: A0A4Z2DGF6 (Protein boule-like isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001426 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 4.200e-37
Identity = 72/132 (54.55%), Postives = 96/132 (72.73%), Query Frame = 2
Query:   62 NGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLIL--NTLPLSYG---SVYPY--QDYSYL 436
            N  K  TLIPNRIFVGG P NTTE+ELKSFF  +G++KDVKII D+ G +KGSYGFVTF SQE+AE+II +++ETLVF+DRKLNIG A++KQ +  + +L   L     T+P ++    +++P   Q+Y  L
Sbjct:   34 NPPKFGTLIPNRIFVGGIPSNTTEQELKSFFSSFGQVKDVKIINDRVGVSKGSYGFVTFESQEMAEKIIRDESETLVFKDRKLNIGHAIRKQQMFPRPDLTTALFFTGGTIPYTFQNGMAIFPLPSQEYPIL 165          
BLAST of Boule 2 RNA-binding protein vs. TrEMBL
Match: A0A4Z2DFS6 (Protein boule-like isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_001426 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.274e-36
Identity = 72/132 (54.55%), Postives = 96/132 (72.73%), Query Frame = 2
Query:   62 NGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLIL--NTLPLSYG---SVYPY--QDYSYL 436
            N  K  TLIPNRIFVGG P NTTE+ELKSFF  +G++KDVKII D+ G +KGSYGFVTF SQE+AE+II +++ETLVF+DRKLNIG A++KQ +  + +L   L     T+P ++    +++P   Q+Y  L
Sbjct:   34 NPPKFGTLIPNRIFVGGIPSNTTEQELKSFFSSFGQVKDVKIINDRVGVSKGSYGFVTFESQEMAEKIIRDESETLVFKDRKLNIGHAIRKQQMFPRPDLTTALFFTGGTIPYTFQNGMAIFPLPSQEYPIL 165          
BLAST of Boule 2 RNA-binding protein vs. TrEMBL
Match: A0A5K4EPW2 (Boule-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.288e-36
Identity = 69/116 (59.48%), Postives = 85/116 (73.28%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPY 418
            K  TLIPNRIFVGG P NT E+ELKSFF  +G +KDVKII D+ G +KGSYGFVTF SQE+AE+II  ++ETL+F+DRKLNIG A++KQ +  + EL  TL+        GS  PY
Sbjct:   37 KFGTLIPNRIFVGGIPSNTNEQELKSFFSSFGHVKDVKIINDRLGASKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQIFPRPELTTTLLFT------GSAIPY 146          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000005184.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:7750630:7761219:-1 gene:ENSAMXG00000005058.2 transcript:ENSAMXT00000005184.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 5.243e-22
Identity = 43/86 (50.00%), Postives = 63/86 (73.26%), Query Frame = 2
Query:   80 TLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            T+IPNRIFVGG      E +L+ FF +YG I++V I+ D+ G +KG YGFVTF +QE A++I+   A+ L FRD+++N+G+A +KQ
Sbjct:   33 TVIPNRIFVGGIGGKAKENDLRCFFSEYGVIREVNIVTDRDGISKG-YGFVTFETQEDAQKIL-HDADRLSFRDKRINVGQAFRKQ 116          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Cavefish
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:103038434])

HSP 1 Score: 69.707 bits (169), Expect = 1.245e-13
Identity = 41/101 (40.59%), Postives = 58/101 (57.43%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ--------PLTGKSEL 361
            L PN +FVGG      E E++ FF +YG +K+VKII  + G  KG YGFV F S++V  + I EQ   + F+ +KL +G A+ K+        PL G S+ 
Sbjct:   28 LTPNTLFVGGIDMKVEENEIRDFFARYGAVKEVKIITYRGGICKG-YGFVYF-SEDVDIQTIVEQ--QISFKGKKLKLGPAIMKERSSRSLQSPLIGPSQW 124          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 56.225 bits (134), Expect = 1.818e-8
Identity = 21/72 (29.17%), Postives = 43/72 (59.72%), Query Frame = 2
Query:   74 ISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETL 289
             + +   +IFVGG  ++T E  L+ +F ++G I+ ++I+ D+    K  + FVTF+  +  +RI+ ++  T+
Sbjct:   99 FAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTI 170          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 56.225 bits (134), Expect = 1.818e-8
Identity = 21/72 (29.17%), Postives = 43/72 (59.72%), Query Frame = 2
Query:   74 ISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETL 289
             + +   +IFVGG  ++T E  L+ +F ++G I+ ++I+ D+    K  + FVTF+  +  +RI+ ++  T+
Sbjct:   99 FAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTI 170          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Cavefish
Match: rbm24a (RNA binding motif protein 24 [Source:NCBI gene;Acc:103027480])

HSP 1 Score: 54.6842 bits (130), Expect = 2.157e-8
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 2
Query:   92 NRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDK-AGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNI 316
             +IFVGG P +TT+  L+ +F  +GEI++  +I D+  G+++G YGFVT A +  A+R   +     +   RK N+
Sbjct:   11 TKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRG-YGFVTMADRSAADRACKD--PNPIIDGRKANV 83          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Sea Lamprey
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 103.605 bits (257), Expect = 7.918e-26
Identity = 55/112 (49.11%), Postives = 77/112 (68.75%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ-------PLTGKSELQNTLILNT 385
            +  T+IPNRIFVGG      E ELK +F ++G +KDVKII D+AG +KG YGFVTF SQE A++ I ++AE ++++D+KLNIG A++KQ       PLT  S    +++L T
Sbjct:   35 RYGTVIPNRIFVGGIDFKVNEAELKKYFTQFGVVKDVKIINDRAGVSKG-YGFVTFESQEDAQK-IQQEAEKIMYKDKKLNIGPAIRKQQVGFPQFPLTPAS---GSMVLTT 141          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Sea Lamprey
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 61.2326 bits (147), Expect = 3.928e-11
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 2
Query:   92 NRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDK-AGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIG------RAVKKQPLTGKSELQNTLILNTLPLSYGSVYP 415
             +IFVGG P +TT+  L++FF  +GEI +  +I D+ +G+++G YGFVT A +  AER   +    +  R   +N+       R ++     G  ++Q T I     +    VYP
Sbjct:   12 TKIFVGGLPYHTTDASLRAFFEAFGEIDEAVVITDRQSGKSRG-YGFVTMADRASAERACKDPNPIIDGRKANVNLAYIGAKPRVIQPGFAFGVQQIQPTFIQRPYGIPAQYVYP 125          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 60.077 bits (144), Expect = 1.924e-10
Identity = 25/83 (30.12%), Postives = 49/83 (59.04%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPL 343
            +IFVGG   NT E+ L+ +F +YG ++ V ++ D+    K  +GFVTF+  +  ++++ ++  T+     K  + +A+ KQ +
Sbjct:  125 KIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTI--NGHKAEVRKALSKQEM 205          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 56.9954 bits (136), Expect = 7.410e-10
Identity = 25/89 (28.09%), Postives = 52/89 (58.43%), Query Frame = 2
Query:   77 STLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPL 343
            + L   +IFVGG   +T E+ L+ +F  YG+++  +++ D++   K  +GFVTF+  +  +++I ++  T+     K  + +A+ KQ +
Sbjct:   95 AHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTI--NGHKAEVRKALSKQEM 181          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009806.1 (pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 gene:ENSPMAG00000008859.1 transcript:ENSPMAT00000009806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.965e-9
Identity = 32/90 (35.56%), Postives = 52/90 (57.78%), Query Frame = 2
Query:   92 NRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSEL 361
            NRIFVG  P++ T E+L+SFF ++G++ DV I      +   S+GFVTFA++ VA+ +     + ++ +   ++I  A  K  L   S L
Sbjct:  197 NRIFVGRCPEDITPEDLRSFFGQFGDVTDVYIP-----KPFRSFGFVTFANEHVAQSLC---GQDVIVKGASVHIASAEPKNQLKRSSRL 278          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 60.4622 bits (145), Expect = 1.270e-10
Identity = 30/78 (38.46%), Postives = 50/78 (64.10%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDK-AGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRA 325
            +IFVGG   +   +E + FF ++G I D +++ DK  GQ++G +GFVT+ S +  +R+   Q + + F+DRK+ I RA
Sbjct:  244 KIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRG-FGFVTYDSADAVDRVC--QNKFIDFKDRKIEIKRA 318          

HSP 2 Score: 53.1434 bits (126), Expect = 2.597e-8
Identity = 28/89 (31.46%), Postives = 53/89 (59.55%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKA-GQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKK--QPLTGK 352
            ++F+GG   +TTE+ L+ +F KYG + D+KI+ D A G+++G +GF++F      + ++  Q    +   + ++  RA+ +  Q  TGK
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRG-FGFLSFEKPSSVDEVVKTQH---ILDGKVIDPKRAIPRDEQDKTGK 244          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 49.6766 bits (117), Expect = 2.307e-7
Identity = 19/47 (40.43%), Postives = 29/47 (61.70%), Query Frame = 2
Query:   98 IFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTF 238
            IF+G  P +  E EL+ +F K+GEI+ ++I+ DK  Q    Y F+ F
Sbjct:  109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVF 155          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Yeast
Match: RIE1 (Putative RNA binding protein; localizes to stress granules induced by glucose deprivation; interacts with Rbg1p in a two-hybrid assay; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003482])

HSP 1 Score: 47.7506 bits (112), Expect = 1.832e-6
Identity = 32/91 (35.16%), Postives = 44/91 (48.35%), Query Frame = 2
Query:    2 MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITE 274
            +SE LKS   G+  +    I  NK +   P  IFVGG  ++ +  EL   F KYG I  +K+I DK       YGF+++     A   I E
Sbjct:  166 ISELLKSEPIGQ-HIDKWSIGVNKHALTYPGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Nematostella
Match: EDO43157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ6])

HSP 1 Score: 77.0258 bits (188), Expect = 8.816e-17
Identity = 41/83 (49.40%), Postives = 55/83 (66.27%), Query Frame = 2
Query:   89 PNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            PN+IFVGG P  TT EEL +FF  +G + + K+I D  G +KG YGFV+F SQE  +    +   TL  R++KLN+G AVKK+
Sbjct:   12 PNKIFVGGLPPLTTAEELANFFANFGHVVESKVIFDHDGISKG-YGFVSFRSQE--DVSCVKAMGTLFLRNKKLNLGPAVKKE 91          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Nematostella
Match: EDO31802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW5])

HSP 1 Score: 66.2402 bits (160), Expect = 2.790e-14
Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = 2
Query:   86 IPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAE 259
            I  RIFV GF + TTE EL++FF +YG +K+ KI+ DK G +KG Y F+TF SQEVA+
Sbjct:    6 ISKRIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKG-YAFITFESQEVAD 62          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Nematostella
Match: EDO40536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6X1])

HSP 1 Score: 68.5514 bits (166), Expect = 6.937e-14
Identity = 30/86 (34.88%), Postives = 55/86 (63.95%), Query Frame = 2
Query:   80 TLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
             + P R+FVGG  + TTE EL++FF  +G + DV+I+ D+       +GF+TF+ +E A+++I  +   + F+ R L + +A++K+
Sbjct:   13 VIYPTRVFVGGLARGTTELELETFFSNFGPVADVRIVCDRRTGLNKGFGFITFSLEEPAKKLI--EQNNIDFKGRSLRLRQAIRKK 96          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Nematostella
Match: EDO45185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC5])

HSP 1 Score: 68.5514 bits (166), Expect = 9.284e-14
Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = 2
Query:   89 PNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTL 373
            PNRIFVGG    TT  EL+  F  YG ++DVKI  D  G ++G YGFVTF   + A+++   +  T+ ++ ++L IG A +K   T  S +   L
Sbjct:    9 PNRIFVGGVAFQTTAIELRELFESYGAVRDVKIARDGEGVSRG-YGFVTFFRDDDAKKVF--KLGTVFYKGKRLVIGEAYRKLQFTYHSHVPRAL 100          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Nematostella
Match: EDO40104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S851])

HSP 1 Score: 54.6842 bits (130), Expect = 1.005e-9
Identity = 26/86 (30.23%), Postives = 46/86 (53.49%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGR-AVKKQPLTG 349
            ++FVGG P  + ++ L+ FF ++GEI++  +I D+  +    YGFVT A+ + AE     +   +  R   +N+     K +P  G
Sbjct:   11 KLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIEGRQANVNLAYLGAKPKPTRG 96          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Medaka
Match: boll (boule homolog, RNA binding protein [Source:NCBI gene;Acc:100302724])

HSP 1 Score: 80.8777 bits (198), Expect = 1.412e-16
Identity = 45/127 (35.43%), Postives = 72/127 (56.69%), Query Frame = 2
Query:   56 FINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTG------KSELQNTLILNTLPLSYGSVYPY 418
             + G+   T+IPNRIFVGG     TE  L   F  YG + +VKI+ +++G +KG YGFVTF + E    I+++ A  + +RD+K +I +AV+K    G      K  + +    +T+ L+  + +PY
Sbjct:   28 LLMGHAPGTIIPNRIFVGGVDYKVTENHLHHIFSHYGTVTEVKIVTNRSGMSKG-YGFVTFEAPEDVVNILSK-ANRICYRDKKFSISQAVQKSQAPGPGSIVHKPFIHHDPTCDTVYLTTPAGFPY 152          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Medaka
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:101173434])

HSP 1 Score: 62.3882 bits (150), Expect = 1.704e-10
Identity = 24/67 (35.82%), Postives = 40/67 (59.70%), Query Frame = 2
Query:   89 PNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETL 289
            P ++F+GG    TT+E LK +FCKYGE+K+  ++ D   +    +GFVTF  Q   ++++ +    L
Sbjct:   19 PCKMFIGGLSWQTTQEGLKEYFCKYGEVKECMVMRDPVTKRSRGFGFVTFVDQAGVDKVLAQSRHEL 85          

HSP 2 Score: 51.9878 bits (123), Expect = 4.298e-7
Identity = 22/59 (37.29%), Postives = 38/59 (64.41%), Query Frame = 2
Query:   92 NRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERII 268
             +IFVGG   NTT E++K +F ++G++ D  ++ DK       +GFVTF +++V E++ 
Sbjct:  109 KKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVC 167          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 59.6918 bits (143), Expect = 4.383e-10
Identity = 34/85 (40.00%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            L PN +FVGG      E E+K FF +YG +++VKII  + G  KG YGFV F +++V  +  +   + ++F  RKL +G A+ K+
Sbjct:   29 LTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDVDIQ--SIIEQQIIFMGRKLKLGPAILKE 109          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 59.6918 bits (143), Expect = 4.383e-10
Identity = 34/85 (40.00%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            L PN +FVGG      E E+K FF +YG +++VKII  + G  KG YGFV F +++V  +  +   + ++F  RKL +G A+ K+
Sbjct:   29 LTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDVDIQ--SIIEQQIIFMGRKLKLGPAILKE 109          
BLAST of Boule 2 RNA-binding protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 59.3066 bits (142), Expect = 4.856e-10
Identity = 34/85 (40.00%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   83 LIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 337
            L PN +FVGG      E E+K FF +YG +++VKII  + G  KG YGFV F +++V  +  +   + ++F  RKL +G A+ K+
Sbjct:   29 LTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDVDIQ--SIIEQQIIFMGRKLKLGPAILKE 109          
BLAST of Boule 2 RNA-binding protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 2
Query:    2 MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYXXXXXXXXXXMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK 958
            MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK
Sbjct:    1 MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK 319          
BLAST of Boule 2 RNA-binding protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 439.499 bits (1129), Expect = 5.738e-157
Identity = 228/231 (98.70%), Postives = 229/231 (99.13%), Query Frame = 2
Query:  266 ITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYXXXXXXXXXXMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK 958
            I  +AETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK
Sbjct:    3 IVNKAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDLNALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLPLSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTISNNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKHEETNTVTKCSEPIHYTFPK 233          
BLAST of Boule 2 RNA-binding protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 191.43 bits (485), Expect = 3.117e-61
Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 2
Query:    2 MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQ 277
            MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQ
Sbjct:    1 MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQ 92          
BLAST of Boule 2 RNA-binding protein vs. Planmine SMEST
Match: SMESG000018666.1 (SMESG000018666.1)

HSP 1 Score: 148.673 bits (374), Expect = 6.253e-41
Identity = 77/132 (58.33%), Postives = 95/132 (71.97%), Query Frame = 2
Query:   71 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYG-----SVY--PYQDYSYLFNQ 445
            KI TLIPNRIFVGG   NTTEEELK FF  YG IKDVKII D+ G +KGSYGFVTF +QE AE+II  +AETL+F++RKLNIG AV+KQ L  + E+  T++ N  P+ Y      +++  P QDYS L +Q
Sbjct:   37 KIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNG-PVPYALQNGLTLFQVPGQDYSVLASQ 167          
BLAST of Boule 2 RNA-binding protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.570e-10
Identity = 37/102 (36.27%), Postives = 59/102 (57.84%), Query Frame = 2
Query:   95 RIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDK-AGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLS 397
            +IFVGG P +TT+E L+ FF  +G I++  +I D+ +G+++G YGFVT  + E A R I+     +    RK N+  A+    L  K  +   + LN++ LS
Sbjct:   35 KIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRG-YGFVTMVNCEDAYRAISNPNPCI--DGRKANVNLAI----LGAKPRILPGVNLNSMALS 129          
The following BLAST results are available for this feature:
BLAST of Boule 2 RNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOLL1.730e-2455.06boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL1.849e-2455.06boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL1.849e-2455.06boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL7.598e-2455.06boule homolog, RNA binding protein [Source:HGNC Sy... [more]
DAZL1.149e-1638.83deleted in azoospermia like [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daz-18.263e-2344.44DAZ protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
msi-14.518e-939.66MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
sup-126.116e-839.29SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
sup-121.033e-733.78SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
rbm-3.11.162e-735.90RNA Binding Motif protein homolog [Source:UniProt... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bol9.457e-2549.12gene:FBgn0011206 transcript:FBtr0076538[more]
bol9.457e-2549.12gene:FBgn0011206 transcript:FBtr0344979[more]
bol9.457e-2549.12gene:FBgn0011206 transcript:FBtr0076540[more]
bol1.111e-2449.12gene:FBgn0011206 transcript:FBtr0331858[more]
bol1.553e-2449.12gene:FBgn0011206 transcript:FBtr0076539[more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dazl6.786e-1436.97deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl8.969e-1436.97deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl1.427e-1336.97deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl1.427e-1336.97deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl3.792e-1334.45deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dazl2.792e-1240.48deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
hnrnpa2b14.602e-931.52heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b19.007e-931.52heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b11.108e-831.52heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b11.176e-831.52heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Boll7.185e-2652.69boule homolog, RNA binding protein [Source:MGI Sym... [more]
Boll5.645e-2553.26boule homolog, RNA binding protein [Source:MGI Sym... [more]
Boll6.977e-2553.26boule homolog, RNA binding protein [Source:MGI Sym... [more]
Dazl7.410e-1640.00deleted in azoospermia-like [Source:MGI Symbol;Acc... [more]
Dazl1.097e-1540.40deleted in azoospermia-like [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q924M5|BOLL_MOUSE5.151e-2453.26Protein boule-like OS=Mus musculus OX=10090 GN=Bol... [more]
sp|Q8WP23|BOLL_MACFA8.880e-2453.26Protein boule-like OS=Macaca fascicularis OX=9541 ... [more]
sp|Q8N9W6|BOLL_HUMAN8.880e-2455.06Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL... [more]
sp|Q24207|BOULE_DROME9.480e-2449.12Protein boule OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q20870|DAZ1_CAEEL1.016e-2144.44DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVR30.000e+0100.00Boule 2 RNA-binding protein OS=Schmidtea mediterra... [more]
A0A172M6551.930e-113100.00Boule-like protein (Fragment) OS=Schmidtea mediter... [more]
A0A4Z2DGF64.200e-3754.55Protein boule-like isoform 2 OS=Schistosoma japoni... [more]
A0A4Z2DFS61.274e-3654.55Protein boule-like isoform 1 OS=Schistosoma japoni... [more]
A0A5K4EPW21.288e-3659.48Boule-related OS=Schistosoma mansoni OX=6183 PE=4 ... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000005184.25.243e-2250.00pep primary_assembly:Astyanax_mexicanus-2.0:10:775... [more]
dazl1.245e-1340.59deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
hnrnpa1a1.818e-829.17heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa1a1.818e-829.17heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
rbm24a2.157e-836.84RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOLL7.918e-2649.11boule homolog, RNA binding protein [Source:HGNC Sy... [more]
rbm24a3.928e-1132.17RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
HNRNPA01.924e-1030.12heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA07.410e-1028.09heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ENSPMAT00000009806.13.965e-935.56pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 g... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HRP11.270e-1038.46Subunit of cleavage factor I; cleavage factor I is... [more]
SNP12.307e-740.43Component of U1 snRNP required for mRNA splicing v... [more]
RIE11.832e-635.16Putative RNA binding protein; localizes to stress ... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431578.816e-1749.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318022.790e-1456.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405366.937e-1434.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451859.284e-1440.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401041.005e-930.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boll1.412e-1635.43boule homolog, RNA binding protein [Source:NCBI ge... [more]
msi11.704e-1035.82musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
dazl4.383e-1040.00deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
dazl4.383e-1040.00deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
dazl4.856e-1040.00deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Boule 2 RNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061507.10.000e+0100.00SMESG000061507.1[more]
SMESG000061507.15.738e-15798.70SMESG000061507.1[more]
SMESG000061507.13.117e-61100.00SMESG000061507.1[more]
SMESG000018666.16.253e-4158.33SMESG000018666.1[more]
SMESG000006741.11.570e-1036.27SMESG000006741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017509 ID=SMED30017509|Name=Boule 2 RNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1027bp
AATGTCAGAAGATTTGAAATCAAATGATAGTGGCAAAACTGCACTTCAAA
CGGTGTTTATAAATGGTAATAAAATCAGCACATTAATTCCTAATCGAATA
TTTGTTGGGGGATTTCCACAGAATACTACAGAAGAAGAATTGAAAAGCTT
TTTCTGTAAATATGGAGAAATAAAAGATGTTAAGATTATTCCGGACAAAG
CTGGACAAGCTAAAGGAAGCTATGGTTTTGTAACATTTGCAAGCCAAGAA
GTTGCGGAAAGAATTATTACCGAACAGGCGGAAACATTAGTATTCAGGGA
TCGGAAGTTGAACATTGGTAGAGCGGTAAAAAAGCAACCGTTGACTGGTA
AATCTGAGCTACAAAACACTCTGATATTGAATACATTGCCTCTTTCGTAT
GGATCAGTTTATCCATATCAAGATTATTCTTACCTTTTCAATCAAGATTT
GAATGCATTATATCAAAACTATTCAAATCAATTATCCCAAATGAATTTTT
TGCCGGCTTATTCATCTTCATTATTGTCTTCGTTTGTTGGAAATAATGAA
ACATTGGGTCTTTCTATAAATCCTTATCAGCAGTTACAGTCGTTATTACC
ACTATCAATGGCAACACCTCAAAGTAATTCACCATTTTCATTGGATTCAG
CCACTTATTTGAATGAGCAATTATCAAACAGCCAGCCTGCTTCTGTAGAA
GCAAATAGCTCAATTGATGCCAGTAGAACCGTTGAAACAACAACTATTTC
CAACAACTTTCAGAGCTATGATAATAGTTATTCTCAAACAAAACTTCATG
GTAAAACTCCATTTAGTTCTCTCACCAATCAAATGTTTAATAACATATCA
AACAAACAAGAGAAAGATGAGTGTGAAATACCGAAAAAGAAAATAAAACA
CGAAGAAACAAATACGGTGACAAAATGTAGCGAGCCAATTCATTATACAT
TTCCTAAGTGATAAAATCTTTATAAAATCGTGTTTAAAATGGTTTTTCAT
GTTAAAATAAATTGTTTATATTTTGAG
back to top

protein sequence of SMED30017509-orf-1

>SMED30017509-orf-1 ID=SMED30017509-orf-1|Name=SMED30017509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MSEDLKSNDSGKTALQTVFINGNKISTLIPNRIFVGGFPQNTTEEELKSF
FCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRD
RKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYGSVYPYQDYSYLFNQDL
NALYQNYSNQLSQMNFLPAYSSSLLSSFVGNNETLGLSINPYQQLQSLLP
LSMATPQSNSPFSLDSATYLNEQLSNSQPASVEANSSIDASRTVETTTIS
NNFQSYDNSYSQTKLHGKTPFSSLTNQMFNNISNKQEKDECEIPKKKIKH
EETNTVTKCSEPIHYTFPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0000223oogonial stem cell
PLANA:0000231vitelline gland
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR034988DAZ_BOULE_RRM
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 31..105
e-value: 2.0E-18
score: 77.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 32..90
e-value: 8.0E-16
score: 57.6
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 30..109
score: 16.364
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 23..126
e-value: 2.8E-23
score: 83.9
NoneNo IPR availablePANTHERPTHR11176:SF14PROTEIN BOULEcoord: 23..241
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 23..241
IPR034988DAZ/BOULE, RNA recognition motifCDDcd12412RRM_DAZL_BOULEcoord: 28..110
e-value: 2.2346E-38
score: 128.93
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 27..114