Metalloendopeptidase

Overview
NameMetalloendopeptidase
Smed IDSMED30017508
Length (bp)2270
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metalloendopeptidase (SMED30017508) t-SNE clustered cells

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30017508) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metalloendopeptidase (SMED30017508) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30017508) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017508

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017508h1SMcG0014108 SmedASXL_017738SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30017508h1SMcG0014108 dd_Smed_v4_11993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017508h1SMcG0014108 dd_Smed_v4_11993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017508h1SMcG0014108 dd_Smed_v4_11993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017508h1SMcG0014108 dd_Smed_v6_11993_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017508h1SMcG0014108 dd_Smed_v4_11993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 130.568 bits (327), Expect = 1.891e-30
Identity = 111/437 (25.40%), Postives = 190/437 (43.48%), Query Frame = 2
Query:  194 KSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLL-INFMKLESRSAEPVPNSQIEI--RMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            K  K     P    N L+ W++    RKK Q  +S+ + +    L+ ++ E +R   E+R LI   +P       + + S FW + E +G      + MT T+T++G   P+ H+   + I+ E    L    D   R  ++       R +EL  I+ EL+    D   L V+G      A + ++ ++F  S G + +++           +  S        GP LL         R + P    Q+ I   + F     +K   +L   N GT  I Y W++    D F +L+   ++RFYF   +G++LP E       FKS  +G+F E W+  T P L  G  + + L  ++L  DV    R+ ++S +    A  + R +L E++  +   +    P D++  T+ D F  +N    YE + + SL +L
Sbjct:  183 KEEKRPPWAPPPQHNFLKNWQRNTALRKKQQEALSEHLKKPVSELLMHTGETYRRIQEERELIDCTLPTRRDRKSWEN-SGFWSRLEYLGDEMTGLV-MTKTKTQRGLMEPITHIRKPHSIRVE--TGLPAQRDASYRYTWDRSLFLIYRRKELQRIMEELDFSQQDIDGLEVVGKGWPFSAVTVEDYTVFERSQGSSSEDTAYLGT------LASSSDVSMPILGPSLLFCGKPACWIRGSNPQDKRQVGIAAHLTFETLEGEKTSSELTVVNNGTVAIWYDWRRQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVDAY-LTEEDLFRHRNPPLHYEHQVVQSLHQL 608          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 130.183 bits (326), Expect = 2.251e-30
Identity = 111/437 (25.40%), Postives = 190/437 (43.48%), Query Frame = 2
Query:  194 KSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLL-INFMKLESRSAEPVPNSQIEI--RMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            K  K     P    N L+ W++    RKK Q  +S+ + +    L+ ++ E +R   E+R LI   +P       + + S FW + E +G      + MT T+T++G   P+ H+   + I+ E    L    D   R  ++       R +EL  I+ EL+    D   L V+G      A + ++ ++F  S G + +++           +  S        GP LL         R + P    Q+ I   + F     +K   +L   N GT  I Y W++    D F +L+   ++RFYF   +G++LP E       FKS  +G+F E W+  T P L  G  + + L  ++L  DV    R+ ++S +    A  + R +L E++  +   +    P D++  T+ D F  +N    YE + + SL +L
Sbjct:  189 KEEKRPPWAPPPQHNFLKNWQRNTALRKKQQEALSEHLKKPVSELLMHTGETYRRIQEERELIDCTLPTRRDRKSWEN-SGFWSRLEYLGDEMTGLV-MTKTKTQRGLMEPITHIRKPHSIRVE--TGLPAQRDASYRYTWDRSLFLIYRRKELQRIMEELDFSQQDIDGLEVVGKGWPFSAVTVEDYTVFERSQGSSSEDTAYLGT------LASSSDVSMPILGPSLLFCGKPACWIRGSNPQDKRQVGIAAHLTFETLEGEKTSSELTVVNNGTVAIWYDWRRQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVDAY-LTEEDLFRHRNPPLHYEHQVVQSLHQL 614          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 130.183 bits (326), Expect = 2.288e-30
Identity = 111/437 (25.40%), Postives = 190/437 (43.48%), Query Frame = 2
Query:  194 KSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLL-INFMKLESRSAEPVPNSQIEI--RMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            K  K     P    N L+ W++    RKK Q  +S+ + +    L+ ++ E +R   E+R LI   +P       + + S FW + E +G      + MT T+T++G   P+ H+   + I+ E    L    D   R  ++       R +EL  I+ EL+    D   L V+G      A + ++ ++F  S G + +++           +  S        GP LL         R + P    Q+ I   + F     +K   +L   N GT  I Y W++    D F +L+   ++RFYF   +G++LP E       FKS  +G+F E W+  T P L  G  + + L  ++L  DV    R+ ++S +    A  + R +L E++  +   +    P D++  T+ D F  +N    YE + + SL +L
Sbjct:  226 KEEKRPPWAPPPQHNFLKNWQRNTALRKKQQEALSEHLKKPVSELLMHTGETYRRIQEERELIDCTLPTRRDRKSWEN-SGFWSRLEYLGDEMTGLV-MTKTKTQRGLMEPITHIRKPHSIRVE--TGLPAQRDASYRYTWDRSLFLIYRRKELQRIMEELDFSQQDIDGLEVVGKGWPFSAVTVEDYTVFERSQGSSSEDTAYLGT------LASSSDVSMPILGPSLLFCGKPACWIRGSNPQDKRQVGIAAHLTFETLEGEKTSSELTVVNNGTVAIWYDWRRQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVDAY-LTEEDLFRHRNPPLHYEHQVVQSLHQL 651          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 130.183 bits (326), Expect = 2.476e-30
Identity = 111/437 (25.40%), Postives = 190/437 (43.48%), Query Frame = 2
Query:  194 KSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLI-NFMKLESRSAEPVPNSQIEI--RMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            K  K     P    N L+ W++    RKK Q  +S+ + +    L+ ++ E +R   E+R LI   +P       + + S FW + E +G      + MT T+T++G   P+ H+   + I+ E    L    D   R  ++       R +EL  I+ EL+    D   L V+G      A + ++ ++F  S G + +++           +  S        GP LL         R + P    Q+ I   + F     +K   +L   N GT  I Y W++    D F +L+   ++RFYF   +G++LP E       FKS  +G+F E W+  T P L  G  + + L  ++L  DV    R+ ++S +    A  + R +L E++  +   +    P D++  T+ D F  +N    YE + + SL +L
Sbjct:  183 KEEKRPPWAPPPQHNFLKNWQRNTALRKKQQEALSEHLKKPVSELLMHTGETYRRIQEERELIDCTLPTRRDRKSWEN-SGFWSRLEYLGDEMTGLV-MTKTKTQRGLMEPITHIRKPHSIRVE--TGLPAQRDASYRYTWDRSLFLIYRRKELQRIMEELDFSQQDIDGLEVVGKGWPFSAVTVEDYTVFERSQGSSSEDTAYLGT------LASSSDVSMPILGPSLLFCGKPACWIRGSNPQDKRQVGIAAHLTFETLEGEKTSSELTVVNNGTVAIWYDWRRQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVDAY-LTEEDLFRHRNPPLHYEHQVVQSLHQL 608          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: mycbpap (mycbp associated protein [Source:ZFIN;Acc:ZDB-GENE-080923-1])

HSP 1 Score: 124.405 bits (311), Expect = 8.227e-29
Identity = 98/430 (22.79%), Postives = 188/430 (43.72%), Query Frame = 2
Query:  233 TNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK-KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADN-ISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYD 1516
            ++AL+ W + M +R++ Q+ I++ + +   +L+ N +  FR   E+R LI + +      +G R GSEFW   +  G +    I  T TQTE+G P  +  +      + E       A +   ++  Y  +R +EL  ++ + +P  PD   L V+G  +        +     +   + +     ++       ++        G   C   +    + +         + +R++F           L  +N G+++I Y W+K        L   + + FYF     ++LP+   ++ + FKSA +GI TEVW++ T P+L  G  + +IL+G+AL  D +A  R  +   ++ +      SR ILD ++  +   +    P D    TD ++F   N    ++   + +L+ L  E+   E   +D
Sbjct:  193 SHALQHWFRHMTDRRRQQDFIARFLQKPAGSLLMNRSSRFRSVQEQRTLIDRGLAAVYTEHGRRVGSEFWSVPQHYG-DEMSGITATLTQTERGNPAELTRIAQPISTRLETGDVQGDAVNSVWQQSLYLQQRRRELKDMLRDFSP--PDVDGLEVLGCGLPVPPSPLLDERQEKEEEEQKENQDPLAQFDDIIMDVELRPALSVCGEALCWTGSSSSHQGQEG-------VSVRLMFETVTGQSVNADLELKNEGSTVIYYSWEK--------LTPTHTQHFYFNNTTAVILPSSTKHICVTFKSASAGILTEVWRLNTHPVLMGGASVHVILRGVALDQDKSAEQRMALQKELEQKACVCFCSRLILD-LLTGVESPERPRSP-DELYITDEERFHTHNPNLQFQRGPVEALQSLYAEVKRSEEQRWD 602          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: kif11 (kinesin family member 11 [Source:Xenbase;Acc:XB-GENE-978999])

HSP 1 Score: 139.043 bits (349), Expect = 2.486e-33
Identity = 114/440 (25.91%), Postives = 203/440 (46.14%), Query Frame = 2
Query:  191 IKSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK--KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCL-----LINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKN----IRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            ++ NK     P    ++L  W+  M  RK+    +S+ + +   +L+ N  E FR   E++ LI  +I     G G + GSEFW+  + +G +    + +T  ++++GYP P+  +G  + +K+E    L+ A D+   K +  E RR  EL  ++ ELN   PD       G  +    + + + S     L E  + +   E  +        +   +   GP L     L  +++ +    + V    I  R+ F   A +K    L   N G++ I Y W+++    P  L+       ++RFYF T  G++LP E    P  FKS  +GIF E W+  T P+L  G  + + L GIAL  D TA +R+ +   ++ + A  +++ I++E+++ +   +    P  S   T+ + F   N   +Y+ + +  LK L
Sbjct:  168 LQQNKDDSVLPIKQDSSLINWQHHMSLRKQQVETLSRRLGKPADSLVMNLGEGFRSVQEEKQLIDLSISAAEHGKGRQLGSEFWKLPQRIG-DELSGLTLTLPRSDRGYPVPITRIGKPHNVKEETGATLHSAYDRSWDKSLYLEQRR-HELRAVMEELNFPKPDID-----GLEVIGHGHPFTSVSAEQFPLSEEPEEAFSEEKENMDPLKDFPDVVPEFVLGPSLIFCGQLAQWVEDDVSHRDKV---GISTRITFEALAGEKASSVLEVVNNGSAAIWYEWRRLPP--PARLQRSRKEPRVQRFYFNTSSGVILPGETRIFPFHFKSPTAGIFGENWEFCTHPVLLAGALLEVSLWGIALHEDKTAPLREALQRELEAREALVVAQHIVEELLEGVRSPERPQSPVRSV--TEEEAFSTVNPKLYYKHQTVQELKHL 593          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: kif11 (kinesin family member 11 [Source:Xenbase;Acc:XB-GENE-978999])

HSP 1 Score: 139.043 bits (349), Expect = 2.892e-33
Identity = 114/440 (25.91%), Postives = 203/440 (46.14%), Query Frame = 2
Query:  191 IKSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK--KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCL-----LINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKN----IRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            ++ NK     P    ++L  W+  M  RK+    +S+ + +   +L+ N  E FR   E++ LI  +I     G G + GSEFW+  + +G +    + +T  ++++GYP P+  +G  + +K+E    L+ A D+   K +  E RR  EL  ++ ELN   PD       G  +    + + + S     L E  + +   E  +        +   +   GP L     L  +++ +    + V    I  R+ F   A +K    L   N G++ I Y W+++    P  L+       ++RFYF T  G++LP E    P  FKS  +GIF E W+  T P+L  G  + + L GIAL  D TA +R+ +   ++ + A  +++ I++E+++ +   +    P  S   T+ + F   N   +Y+ + +  LK L
Sbjct:  169 LQQNKDDSVLPIKQDSSLINWQHHMSLRKQQVETLSRRLGKPADSLVMNLGEGFRSVQEEKQLIDLSISAAEHGKGRQLGSEFWKLPQRIG-DELSGLTLTLPRSDRGYPVPITRIGKPHNVKEETGATLHSAYDRSWDKSLYLEQRR-HELRAVMEELNFPKPDID-----GLEVIGHGHPFTSVSAEQFPLSEEPEEAFSEEKENMDPLKDFPDVVPEFVLGPSLIFCGQLAQWVEDDVSHRDKV---GISTRITFEALAGEKASSVLEVVNNGSAAIWYEWRRLPP--PARLQRSRKEPRVQRFYFNTSSGVILPGETRIFPFHFKSPTAGIFGENWEFCTHPVLLAGALLEVSLWGIALHEDKTAPLREALQVELEAREALVVAQHIVEELLEGVRSPERPQSPVRSV--TEEEAFSTVNPKLYYKHQTVQELKHL 594          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Mycbpap (MYCBP associated protein [Source:MGI Symbol;Acc:MGI:2388726])

HSP 1 Score: 122.865 bits (307), Expect = 3.457e-28
Identity = 109/441 (24.72%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  221 PDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIG-----DSIKNQAY--------SYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLI---NFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            P    N L+ W + +  RKK Q  +SK + +    L+ ++ E +R+  E+R +I +A+P    G   ++ S FW   E +G      + MT  +T++G   P+ H+     I+ E    L    D   R  ++       R +EL  I++EL+    D   L V+G      S+  + +        S   +++F DSL                     S+       GP LL        +   + E   N  I +R+ F     ++   +L   N GT  I Y W++    D F +L+    +RFYF   +G++LP E  +    FKS  +GIF E W+  T P L  G  + + L  I+L  D+    R+ +++ +    A  I++++L ++++ I   +    P D++  T+ D F  +N    Y+ + + +L +L
Sbjct:  183 PPPQHNFLKNWRRHIALRKKQQEALSKHLKKPASELLMHTGESYRKIQEEREVIDRALPTQHDG---KATSWFWSPLEYLGDEMTGLL-MTKKKTQRGLVEPITHIRKPLSIQVETG--LPAQKDAWYRYTWDRSLFLIYRRKELQSIMAELDFSQQDIDGLEVVGHGKPFSSVTVEEHLPPEKIQKSSSEDTVFLDSLTNL------------------SDMVPMPILGPSLLFCGKPACWVRGSNPEDKKNIGIGVRLTFETLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQRFYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVDAY-LTEEDLFNYRNPRLHYQHQVVQNLHQL 598          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Mycbpap (MYCBP associated protein [Source:MGI Symbol;Acc:MGI:2388726])

HSP 1 Score: 122.479 bits (306), Expect = 3.885e-28
Identity = 109/441 (24.72%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  221 PDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIG-----DSIKNQAY--------SYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLI---NFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            P    N L+ W + +  RKK Q  +SK + +    L+ ++ E +R+  E+R +I +A+P    G   ++ S FW   E +G      + MT  +T++G   P+ H+     I+ E    L    D   R  ++       R +EL  I++EL+    D   L V+G      S+  + +        S   +++F DSL                     S+       GP LL        +   + E   N  I +R+ F     ++   +L   N GT  I Y W++    D F +L+    +RFYF   +G++LP E  +    FKS  +GIF E W+  T P L  G  + + L  I+L  D+    R+ +++ +    A  I++++L ++++ I   +    P D++  T+ D F  +N    Y+ + + +L +L
Sbjct:  193 PPPQHNFLKNWRRHIALRKKQQEALSKHLKKPASELLMHTGESYRKIQEEREVIDRALPTQHDG---KATSWFWSPLEYLGDEMTGLL-MTKKKTQRGLVEPITHIRKPLSIQVETG--LPAQKDAWYRYTWDRSLFLIYRRKELQSIMAELDFSQQDIDGLEVVGHGKPFSSVTVEEHLPPEKIQKSSSEDTVFLDSLTNL------------------SDMVPMPILGPSLLFCGKPACWVRGSNPEDKKNIGIGVRLTFETLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQRFYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVDAY-LTEEDLFNYRNPRLHYQHQVVQNLHQL 608          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|Q8TBZ2|MYBPP_HUMAN (MYCBP-associated protein OS=Homo sapiens OX=9606 GN=MYCBPAP PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 1.167e-29
Identity = 111/437 (25.40%), Postives = 190/437 (43.48%), Query Frame = 2
Query:  194 KSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLI-NFMKLESRSAEPVPNSQIEI--RMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            K  K     P    N L+ W++    RKK Q  +S+ + +    L+ ++ E +R   E+R LI   +P       + + S FW + E +G      + MT T+T++G   P+ H+   + I+ E    L    D   R  ++       R +EL  I+ EL+    D   L V+G      A + ++ ++F  S G + +++           +  S        GP LL         R + P    Q+ I   + F     +K   +L   N GT  I Y W++    D F +L+   ++RFYF   +G++LP E       FKS  +G+F E W+  T P L  G  + + L  ++L  DV    R+ ++S +    A  + R +L E++  +   +    P D++  T+ D F  +N    YE + + SL +L
Sbjct:  189 KEEKRPPWAPPPQHNFLKNWQRNTALRKKQQEALSEHLKKPVSELLMHTGETYRRIQEERELIDCTLPTRRDRKSWEN-SGFWSRLEYLGDEMTGLV-MTKTKTQRGLMEPITHIRKPHSIRVETG--LPAQRDASYRYTWDRSLFLIYRRKELQRIMEELDFSQQDIDGLEVVGKGWPFSAVTVEDYTVFERSQGSSSEDTAYLGT------LASSSDVSMPILGPSLLFCGKPACWIRGSNPQDKRQVGIAAHLTFETLEGEKTSSELTVVNNGTVAIWYDWRRQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVDAY-LTEEDLFRHRNPPLHYEHQVVQSLHQL 614          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|Q5SUV2|MYBPP_MOUSE (MYCBP-associated protein OS=Mus musculus OX=10090 GN=Mycbpap PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.418e-27
Identity = 109/441 (24.72%), Postives = 193/441 (43.76%), Query Frame = 2
Query:  221 PDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENR-----RLQELNGIISELNPHDPDFSRLVVIG-----DSIKNQAY--------SYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLI---NFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            P    N L+ W + +  RKK Q  +SK + +    L+ ++ E +R+  E+R +I +A+P    G   ++ S FW   E +G      + MT  +T++G   P+ H+     I+ E    L    D   R  ++       R +EL  I++EL+    D   L V+G      S+  + +        S   +++F DSL                     S+       GP LL        +   + E   N  I +R+ F     ++   +L   N GT  I Y W++    D F +L+    +RFYF   +G++LP E  +    FKS  +GIF E W+  T P L  G  + + L  I+L  D+    R+ +++ +    A  I++++L ++++ I   +    P D++  T+ D F  +N    Y+ + + +L +L
Sbjct:  183 PPPQHNFLKNWRRHIALRKKQQEALSKHLKKPASELLMHTGESYRKIQEEREVIDRALPTQHDG---KATSWFWSPLEYLGDEMTGLL-MTKKKTQRGLVEPITHIRKPLSIQVETG--LPAQKDAWYRYTWDRSLFLIYRRKELQSIMAELDFSQQDIDGLEVVGHGKPFSSVTVEEHLPPEKIQKSSSEDTVFLDSLTNL------------------SDMVPMPILGPSLLFCGKPACWVRGSNPEDKKNIGIGVRLTFETLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQRFYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVDAY-LTEEDLFNYRNPRLHYQHQVVQNLHQL 598          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|Q69CM7|MYBPP_RAT (MYCBP-associated protein OS=Rattus norvegicus OX=10116 GN=Mycbpap PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.626e-27
Identity = 112/460 (24.35%), Postives = 194/460 (42.17%), Query Frame = 2
Query:  167 KENIKSHRIKSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQE------KKIFLNGASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDS-------------IKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLI---NFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPF-NLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKL 1477
            KE  K    K  K     P    N L+ W + +  RKK Q  +S+ + +    L+ NS E +R+  E+R  I +A+P     +  ++ + FW   E +G +    + MT  + ++G   P+ H+     I+ E      K  +     D+   + Y  + LQ    I++EL+    D   L V+G               ++    S   +++F DSL                     S+       GP LL        +   + E   N  I +R+ F     +K   +L   N GT  I Y W++    D F +L+    +RFYF   +G++LP E  +    FKS  +GIF E W+  T P L  G  + I L  I+L  D+    R+ ++S +    A  I++++L ++++ +   +    P D++  T+ D F  +N    Y+   + +L +L
Sbjct:  163 KEEPKPKSPKEEKRPPWAPPLQHNFLKNWRRHITLRKKQQEVLSEHLKKPASELLMNSGEGYRKIQEEREAIDRALP---TQHDRKAMNCFWSPLEYLG-DEKSGLLMTKKKKQRGLVEPITHIRKPFSIQMETGLPVQKDAWYRYTWDRSLFLIYRRKGLQ---NIMAELDFSQQDIDGLEVVGHGKPFSSVTVEEPLPLEKSQKSSSEDTVFLDSLTNL------------------SDMVPMPILGPSLLFCGKPACWIRGSNPEDKKNIGIGVRLTFETLEGEKTSSELTVVNNGTVAIWYDWRRRPQQDFFQDLKQNRTQRFYFNNREGVILPGETKHFTFFFKSRNAGIFMESWEFGTHPTLLGGAALQITLHAISLTQDIFMDERKLLESKLAAHEAVTIAQSVLQDLLRGVSTPERAPSPVDAY-LTEEDLFHYRNPRLHYQHRVVQNLHQL 596          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2R2MRE4 (MYCBP-associated protein-like isoform X5 OS=Lingula unguis OX=7574 GN=LOC106180241 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.888e-70
Identity = 164/530 (30.94%), Postives = 267/530 (50.38%), Query Frame = 2
Query:  230 DTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK----KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQE--------SERTHQSGGGPCLLINFMKLESRSAEPVPNS-------QIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRXXXXXXXXXXXXXXXXXFQKFYKHMDKATM-VNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDL 1759
            +TNAL  W+++M+ERKK Q +ISK + ++   L+ N  + +R+  E+RYLI + IP    G G+R GSEFW+Q E +G +  + +HMT TQTE+GYPPP+ HVGV  +IK+EK ++ +  S        R  +  +R Q+L  ++ EL+PH PD S L + G         +       D   E ++    SE        QE         +   +   GP +L        R A    +S         E R+ F  Y+  +    L   N GT+ I Y WKK+   +PF++ N  ++RFYF T  G++LP + +  P +FKS  +G+FTE W+ ET P++  G  +V+ L+G+ALQ D     R  I+  + ++ A+ I R I+D++++ +   D    P D++  T  D F +KN G  +  E +  L +L + +  +E      W +    LR+ I+        K     Q+F + ++ A + ++F      ++ +YK+ Y+ LLE    +V     IR+   L
Sbjct:  195 ETNALVNWQKKMLERKKQQGYISKLLQKSEDTLLMNHGDNYRKKQEERYLIDRTIPSMDYGKGYRVGSEFWKQQERIGDD-LEGMHMTLTQTERGYPPPIEHVGVPTMIKEEKGVYWSKPSTPVHYPWDRSAFLKQRKQQLQTVMDELDPHKPDMSSLAITG---------FKQGPKLVDKEDEREEPRTMSEFEDSVLEDQENLDPLKDHPDVVPEPIFGPSIL-----FAGRPARWTGDSYSFQGQQAFEARVTFEGYSGQRKTSFLEVVNNGTTSIYYDWKKLPKSNPFDIVNSRVQRFYFNTSGGVILPGDTMKFPFVFKSPNAGVFTEQWQFETRPVVCGGASLVVTLRGVALQEDKFKHQRSEIEKELAHKQAEQIIRQIVDDVVEGVQTPDRARSPVDAY-ITREDIFERKNQGMHFSNETVTELNELYKNLFPEEERDDVEWDLSLETLREAIMEMDEDDEQK-----QEFLQQLNSAVISLSFPPFSPIQQEMYKVAYQALLETIDSIVGQSMMIRQVLGL 703          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2R2MRE5 (MYCBP-associated protein-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180241 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.093e-70
Identity = 164/530 (30.94%), Postives = 267/530 (50.38%), Query Frame = 2
Query:  230 DTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK----KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQE--------SERTHQSGGGPCLLINFMKLESRSAEPVPNS-------QIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRXXXXXXXXXXXXXXXXXFQKFYKHMDKATM-VNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDL 1759
            +TNAL  W+++M+ERKK Q +ISK + ++   L+ N  + +R+  E+RYLI + IP    G G+R GSEFW+Q E +G +  + +HMT TQTE+GYPPP+ HVGV  +IK+EK ++ +  S        R  +  +R Q+L  ++ EL+PH PD S L + G         +       D   E ++    SE        QE         +   +   GP +L        R A    +S         E R+ F  Y+  +    L   N GT+ I Y WKK+   +PF++ N  ++RFYF T  G++LP + +  P +FKS  +G+FTE W+ ET P++  G  +V+ L+G+ALQ D     R  I+  + ++ A+ I R I+D++++ +   D    P D++  T  D F +KN G  +  E +  L +L + +  +E      W +    LR+ I+        K     Q+F + ++ A + ++F      ++ +YK+ Y+ LLE    +V     IR+   L
Sbjct:  217 ETNALVNWQKKMLERKKQQGYISKLLQKSEDTLLMNHGDNYRKKQEERYLIDRTIPSMDYGKGYRVGSEFWKQQERIGDD-LEGMHMTLTQTERGYPPPIEHVGVPTMIKEEKGVYWSKPSTPVHYPWDRSAFLKQRKQQLQTVMDELDPHKPDMSSLAITG---------FKQGPKLVDKEDEREEPRTMSEFEDSVLEDQENLDPLKDHPDVVPEPIFGPSIL-----FAGRPARWTGDSYSFQGQQAFEARVTFEGYSGQRKTSFLEVVNNGTTSIYYDWKKLPKSNPFDIVNSRVQRFYFNTSGGVILPGDTMKFPFVFKSPNAGVFTEQWQFETRPVVCGGASLVVTLRGVALQEDKFKHQRSEIEKELAHKQAEQIIRQIVDDVVEGVQTPDRARSPVDAY-ITREDIFERKNQGMHFSNETVTELNELYKNLFPEEERDDVEWDLSLETLREAIMEMDEDDEQK-----QEFLQQLNSAVISLSFPPFSPIQQEMYKVAYQALLETIDSIVGQSMMIRQVLGL 725          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2R2MRQ8 (MYCBP-associated protein-like isoform X4 OS=Lingula unguis OX=7574 GN=LOC106180241 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.254e-70
Identity = 164/530 (30.94%), Postives = 267/530 (50.38%), Query Frame = 2
Query:  230 DTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK----KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQE--------SERTHQSGGGPCLLINFMKLESRSAEPVPNS-------QIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRXXXXXXXXXXXXXXXXXFQKFYKHMDKATM-VNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDL 1759
            +TNAL  W+++M+ERKK Q +ISK + ++   L+ N  + +R+  E+RYLI + IP    G G+R GSEFW+Q E +G +  + +HMT TQTE+GYPPP+ HVGV  +IK+EK ++ +  S        R  +  +R Q+L  ++ EL+PH PD S L + G         +       D   E ++    SE        QE         +   +   GP +L        R A    +S         E R+ F  Y+  +    L   N GT+ I Y WKK+   +PF++ N  ++RFYF T  G++LP + +  P +FKS  +G+FTE W+ ET P++  G  +V+ L+G+ALQ D     R  I+  + ++ A+ I R I+D++++ +   D    P D++  T  D F +KN G  +  E +  L +L + +  +E      W +    LR+ I+        K     Q+F + ++ A + ++F      ++ +YK+ Y+ LLE    +V     IR+   L
Sbjct:  217 ETNALVNWQKKMLERKKQQGYISKLLQKSEDTLLMNHGDNYRKKQEERYLIDRTIPSMDYGKGYRVGSEFWKQQERIGDD-LEGMHMTLTQTERGYPPPIEHVGVPTMIKEEKGVYWSKPSTPVHYPWDRSAFLKQRKQQLQTVMDELDPHKPDMSSLAITG---------FKQGPKLVDKEDEREEPRTMSEFEDSVLEDQENLDPLKDHPDVVPEPIFGPSIL-----FAGRPARWTGDSYSFQGQQAFEARVTFEGYSGQRKTSFLEVVNNGTTSIYYDWKKLPKSNPFDIVNSRVQRFYFNTSGGVILPGDTMKFPFVFKSPNAGVFTEQWQFETRPVVCGGASLVVTLRGVALQEDKFKHQRSEIEKELAHKQAEQIIRQIVDDVVEGVQTPDRARSPVDAY-ITREDIFERKNQGMHFSNETVTELNELYKNLFPEEERDDVEWDLSLETLREAIMEMDEDDEQK-----QEFLQQLNSAVISLSFPPFSPIQQEMYKVAYQALLETIDSIVGQSMMIRQVLGL 725          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2R2MRF3 (MYCBP-associated protein-like isoform X6 OS=Lingula unguis OX=7574 GN=LOC106180241 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.296e-70
Identity = 164/530 (30.94%), Postives = 267/530 (50.38%), Query Frame = 2
Query:  230 DTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK----KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQE--------SERTHQSGGGPCLLINFMKLESRSAEPVPNS-------QIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRXXXXXXXXXXXXXXXXXFQKFYKHMDKATM-VNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDL 1759
            +TNAL  W+++M+ERKK Q +ISK + ++   L+ N  + +R+  E+RYLI + IP    G G+R GSEFW+Q E +G +  + +HMT TQTE+GYPPP+ HVGV  +IK+EK ++ +  S        R  +  +R Q+L  ++ EL+PH PD S L + G         +       D   E ++    SE        QE         +   +   GP +L        R A    +S         E R+ F  Y+  +    L   N GT+ I Y WKK+   +PF++ N  ++RFYF T  G++LP + +  P +FKS  +G+FTE W+ ET P++  G  +V+ L+G+ALQ D     R  I+  + ++ A+ I R I+D++++ +   D    P D++  T  D F +KN G  +  E +  L +L + +  +E      W +    LR+ I+        K     Q+F + ++ A + ++F      ++ +YK+ Y+ LLE    +V     IR+   L
Sbjct:  217 ETNALVNWQKKMLERKKQQGYISKLLQKSEDTLLMNHGDNYRKKQEERYLIDRTIPSMDYGKGYRVGSEFWKQQERIGDD-LEGMHMTLTQTERGYPPPIEHVGVPTMIKEEKGVYWSKPSTPVHYPWDRSAFLKQRKQQLQTVMDELDPHKPDMSSLAITG---------FKQGPKLVDKEDEREEPRTMSEFEDSVLEDQENLDPLKDHPDVVPEPIFGPSIL-----FAGRPARWTGDSYSFQGQQAFEARVTFEGYSGQRKTSFLEVVNNGTTSIYYDWKKLPKSNPFDIVNSRVQRFYFNTSGGVILPGDTMKFPFVFKSPNAGVFTEQWQFETRPVVCGGASLVVTLRGVALQEDKFKHQRSEIEKELAHKQAEQIIRQIVDDVVEGVQTPDRARSPVDAY-ITREDIFERKNQGMHFSNETVTELNELYKNLFPEEERDDVEWDLSLETLREAIMEMDEDDEQK-----QEFLQQLNSAVISLSFPPFSPIQQEMYKVAYQALLETIDSIVGQSMMIRQVLGL 725          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2R2MRF0 (MYCBP-associated protein-like isoform X7 OS=Lingula unguis OX=7574 GN=LOC106180241 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.710e-70
Identity = 164/530 (30.94%), Postives = 267/530 (50.38%), Query Frame = 2
Query:  230 DTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK----KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQE--------SERTHQSGGGPCLLINFMKLESRSAEPVPNS-------QIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRXXXXXXXXXXXXXXXXXFQKFYKHMDKATM-VNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDL 1759
            +TNAL  W+++M+ERKK Q +ISK + ++   L+ N  + +R+  E+RYLI + IP    G G+R GSEFW+Q E +G +  + +HMT TQTE+GYPPP+ HVGV  +IK+EK ++ +  S        R  +  +R Q+L  ++ EL+PH PD S L + G         +       D   E ++    SE        QE         +   +   GP +L        R A    +S         E R+ F  Y+  +    L   N GT+ I Y WKK+   +PF++ N  ++RFYF T  G++LP + +  P +FKS  +G+FTE W+ ET P++  G  +V+ L+G+ALQ D     R  I+  + ++ A+ I R I+D++++ +   D    P D++  T  D F +KN G  +  E +  L +L + +  +E      W +    LR+ I+        K     Q+F + ++ A + ++F      ++ +YK+ Y+ LLE    +V     IR+   L
Sbjct:  193 ETNALVNWQKKMLERKKQQGYISKLLQKSEDTLLMNHGDNYRKKQEERYLIDRTIPSMDYGKGYRVGSEFWKQQERIGDD-LEGMHMTLTQTERGYPPPIEHVGVPTMIKEEKGVYWSKPSTPVHYPWDRSAFLKQRKQQLQTVMDELDPHKPDMSSLAITG---------FKQGPKLVDKEDEREEPRTMSEFEDSVLEDQENLDPLKDHPDVVPEPIFGPSIL-----FAGRPARWTGDSYSFQGQQAFEARVTFEGYSGQRKTSFLEVVNNGTTSIYYDWKKLPKSNPFDIVNSRVQRFYFNTSGGVILPGDTMKFPFVFKSPNAGVFTEQWQFETRPVVCGGASLVVTLRGVALQEDKFKHQRSEIEKELAHKQAEQIIRQIVDDVVEGVQTPDRARSPVDAY-ITREDIFERKNQGMHFSNETVTELNELYKNLFPEEERDDVEWDLSLETLREAIMEMDEDDEQK-----QEFLQQLNSAVISLSFPPFSPIQQEMYKVAYQALLETIDSIVGQSMMIRQVLGL 701          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: mycbpap (mycbp associated protein [Source:ZFIN;Acc:ZDB-GENE-080923-1])

HSP 1 Score: 97.8265 bits (242), Expect = 8.434e-21
Identity = 88/371 (23.72%), Postives = 152/371 (40.97%), Query Frame = 2
Query:  224 DFDTNALRLWEQRMMERKKLQNHISKTVNRAPVN-LIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKK-KRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFN--LENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISR 1324
            D   +AL+ W   M ER++ QN I+  +   PV  L+ N +  +RE  E+R +IS+ +P    G+G R GSEFW   +  G +    I  T TQT+KG PPP+  +  +  +   ++   +G   +   + +Y + R  EL  I++E++ + P         D ++           FYD +                  ++        G   C   N    E           + +R+LF     +    +L  +N G++ + Y W ++ +   F      ++ + FYF T                         TEVW++ T P+L  G  + + L+G+AL  D TA  R  I+ +   Q  + + R
Sbjct:  153 DPQGHALQHWNYHMAERRRQQNFIA--LLEKPVEELLMNQSNRYREIQEQREIISRGLPALHPGHGRRVGSEFWSVPQRFG-DELSGITATLTQTQKGNPPPITRI--TQPLSARRESNEDGVVSRAWSQSQYLHYRQHELRDILTEMDYNQP---------DPLE-----------FYDDV---------------MMEVELIPALRLCGELACWTGNATSNEEEVG-------VAVRLLFEAAVGESVSSELELKNEGSTAVYYSWHRLAAPPSFTHTRAQRHSQNFYFNTA------------------------TEVWQLHTHPVLLGGASLQVTLRGVALYQDKTAEKRAAIELHYHSQPVEALKR 452          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003378.1 (pep scaffold:Pmarinus_7.0:GL477807:7072:30008:1 gene:ENSPMAG00000003088.1 transcript:ENSPMAT00000003378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 7.653e-23
Identity = 94/335 (28.06%), Postives = 143/335 (42.69%), Query Frame = 2
Query:  326 LIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNG---ASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLINFMKLESRSAEPVPNSQIEI--RMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNL----------ENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGID 1285
            L+   +   R   E+R LI +AIP    G   + GSEFWQ  + +G +    I +T TQTE+G P  V HVG     ++E  +   G    +   +R EY  +R Q+L  ++ EL+ + PD   L V+G S   Q +S  +   F  +  E  +  +E E  +        +   Q   GP +            EP+   ++ I  R+ F   A  +   +L  +  G         KI +    NL                R       G+ LP   L +P  FKS  +GIF E W++   PLL +G  + + L+G+AL  D TAA R  I+
Sbjct:    1 LVMCQSGRHRHVQEERELIDRAIPQLDYG---KVGSEFWQLPQRLG-DELGGISLTLTQTERGQPWSVTHVGKPVSTQRETGLTATGQHWVTFTWERSEYLQQRKQQLWDVLRELDFNQPDIDGLEVLGTS---QPFSSTSAEKFL-THEEILEAQMEEERENDDPLRSYPDVVPQPIIGPSIRFCGQPARWTGGEPIHEDELGIAARITFEALAGTRSGFELSLKIHG---------KISTLHDKNLTRYVNISTGETTDEASRLAVAVRAGVALPGATLLVPFTFKSPSAGIFGERWRLRARPLLLSGAALQLTLRGVALHEDRTAARRDSIE 318          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO31470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXU7])

HSP 1 Score: 205.297 bits (521), Expect = 4.158e-55
Identity = 130/420 (30.95%), Postives = 216/420 (51.43%), Query Frame = 2
Query:  230 DTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYE-------NRRLQELNGIISELNPHDPDFSRLVVIGD-SIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLINFMKLE--SRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLE-NKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTD-RDQFVQKNNGFFYEIE 1453
            ++NAL  W+Q+M++RK+ QNH+S  +  +   L+ N +E++R+  E+R++I +AIP    G G+R GSEFW+Q E +G N    I MT TQTE+GYPPP+ H+     IK E  I  + ++ +K  + Y          R ++LN +++E++PH P    L V+G   + +Q+           ++ E ++   E     R      ++   Q   GP L I+    +    S   +    +  R+ F     ++ V  L   N GT+ I + WK++   +    +     +RFYF T  G++LP E L  P IFKS  +GIF+E W++ T P+L  G  I + L+GIA++ DV A  R+ I+  + ++ A   +  IL EI+  +   +    P D++     +D+ VQ     F E+E
Sbjct:  238 ESNALNNWQQQMLQRKRQQNHLSALLQTSTDMLVMNQSEDYRKNQEQRHVIDRAIPSVDYGKGYRVGSEFWKQVEQIG-NDETGITMTLTQTERGYPPPIEHISKPITIKNEMGIEWS-STHRKAAVHYPWQASGFLQERKEQLNSVMNEIDPHQPYMDELEVVGGRELPHQSKHA------MSTVPEEEEPMAEQSPHLRDPLASYADVIPQPIFGPSLTIDGQTAQWTGSSTNGLGRVGVASRVTFEANTGERVVSLLHICNDGTTAIYFSWKRVPKANTLGTKLAGRTQRFYFDTNSGVILPGETLKFPFIFKSLNAGIFSENWELLTEPVLCGGGAIRVCLRGIAIEEDVYADARREIEKELAHREAIEAAARILQEILDGVRTPERSRSPVDAYITMHFQDEAVQSLKEIFVEVE 649          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: ENSORLT00000038124.1 (MYCBP associated protein [Source:NCBI gene;Acc:101173282])

HSP 1 Score: 77.411 bits (189), Expect = 2.459e-14
Identity = 57/228 (25.00%), Postives = 100/228 (43.86%), Query Frame = 2
Query:  896 SAEPVPNSQ---IEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIE---SFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAG-----KELNAYDNWRMDCGLLR 1546
            +A+P+P  +     +++LF     +     L   N G ++I Y W+++    SF   + +++    FYF +  G++ P+ED+ + +IF S K GI TE W++ T      G  + + L G+ LQ D T  +R  + + +  +      + IL + ++ I        P       D D+            EN+ S K   E + G     KE+N  D W +    LR
Sbjct:  167 AAKPIPKQRHVGAGVQVLFETLTGEPAWSVLNLHNGGCTVISYCWQRLSKRWSFQQLHSQDEK-SHFYFNSSSGVICPSEDVRVEVIFMSEKPGIQTEHWQLNT-----TGVSLQVSLIGVCLQRDPTTELRLHLRAKLDKKAVRETCQLILSQTLEKIYTP---RRPSSPPYLLDLDE------------ENLGSTKGEAESLEGLKIMWKEVNGRDEWDLSVDTLR 373          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: ENSORLT00000037470.1 (MYCBP associated protein [Source:NCBI gene;Acc:101173282])

HSP 1 Score: 77.411 bits (189), Expect = 2.806e-14
Identity = 57/228 (25.00%), Postives = 100/228 (43.86%), Query Frame = 2
Query:  896 SAEPVPNSQ---IEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIE---SFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAG-----KELNAYDNWRMDCGLLR 1546
            +A+P+P  +     +++LF     +     L   N G ++I Y W+++    SF   + +++    FYF +  G++ P+ED+ + +IF S K GI TE W++ T      G  + + L G+ LQ D T  +R  + + +  +      + IL + ++ I        P       D D+            EN+ S K   E + G     KE+N  D W +    LR
Sbjct:  167 AAKPIPKQRHVGAGVQVLFETLTGEPAWSVLNLHNGGCTVISYCWQRLSKRWSFQQLHSQDEK-SHFYFNSSSGVICPSEDVRVEVIFMSEKPGIQTEHWQLNT-----TGVSLQVSLIGVCLQRDPTTELRLHLRAKLDKKAVRETCQLILSQTLEKI---YTPRRPSSPPYLLDLDE------------ENLGSTKGEAESLEGLKIMWKEVNGRDEWDLSVDTLR 373          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000045572.1 (SMESG000045572.1)

HSP 1 Score: 1315.06 bits (3402), Expect = 0.000e+0
Identity = 682/686 (99.42%), Postives = 685/686 (99.85%), Query Frame = 2
Query:   71 KEIPSEYHHALGFGPPKRPLSAMIPTKTADKNKENIKSHRIKSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRXXXXXXXXXXXXXXXXXFQKFYKHMDKATMVNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDLPDITFKIANDRRRANISRQKTNFXXXXXXXXXXXXXXXXELSNLARESTDNLMNDSEEVDKFGSQNFSEIDETIPVESEQLSHSNSNLVEIKCHSKTYQLVYSMLDKALDNIIECWEEITSND 2128
            +EIPSEYHHALGFGPPKRPLSA IPTKTADKNKENIKSH+IKSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKNSLESENLSRSESIQESERTHQSGGGPCLLINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEI+QNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRKNIVSAKSIKSVKKEEIFQKFYKHMDKATMVNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDLPDITFKIANDRRRANISRQKTNFSQVSKKSTSTQKSKSKELSNLARESTDNLMNDSEEVDKFGSQNFSEIDETIPVESEQLSHSNSNLVEIKCHSKTYQLVYSMLDKALDNIIECWEEITSND
Sbjct:   63 EEIPSEYHHALGFGPPKRPLSATIPTKTADKNKENIKSHKIKSNKSIKCKPDFDTNALRLWEQRMMERKKLQNHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNGASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKNSLESENLSRSESIQESERTHQSGGGPCLLINFMKLESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIVQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGLLRKNIVSAKSIKSVKKEEIFQKFYKHMDKATMVNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDLPDITFKIANDRRRANISRQKTNFSQVSKKSTSTQKSKSKELSNLARESTDNLMNDSEEVDKFGSQNFSEIDETIPVESEQLSHSNSNLVEIKCHSKTYQLVYSMLDKALDNIIECWEEITSND 748          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000023252.1 (SMESG000023252.1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.256e-13
Identity = 83/352 (23.58%), Postives = 147/352 (41.76%), Query Frame = 2
Query:  239 ALRLWEQRMMERKKLQNHISKTVNRAPVNL-IYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSEFWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQE-KKIFLNGASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYDNNSIFYDSLGETKKXXXXXXXXXXXXXIQESERTHQSGGGPCLLIN----FMKLESRSA-EPVPNSQ-IEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIE-----SFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQND 1255
            +L  W+ RM+ER+KL+  ++K +   P +L I  SA+    +  +  +    +P +  G G       W   E         +H+   + +   P      G   +I  E  +   +  S +K +I+ E     +    + + + H PD S L++   + + +    +N ++                +    E I       +S  GP LLIN    F +L  +      PN Q + I         ++ ++ L F NRG+  I + WKKIE       D F+        F+FK   GI+LP+ ++ +P+ F+S   G F E+W++ T P+L     I+     I+L+ D
Sbjct:  159 SLENWKLRMLERRKLKTSLAKRLQTNPESLLISKSAQSSLFSSHQDEIFKIILPCFQNGTGAPITHSIWPVQE----ETKSKLHVQCYKWKPHIPLQTSMTGYHELILHEMNETTKDLESSEKIKIKNEVLNKTKYQRFLKDYHYHTPDISELIICSKTYQKEQPKKENTTL----------------SNFEEEEILTELENTKSVRGPILLINDELIFERLNDKDQILSKPNDQYLHIHFPATIMGVNE-IKNLYFANRGSCTINFSWKKIEIERHLKTDDFH------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLT-SKKIIFHFHAISLRPD 482          
The following BLAST results are available for this feature:
BLAST of Metalloendopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MYCBPAP1.891e-3025.40MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
MYCBPAP2.251e-3025.40MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
MYCBPAP2.288e-3025.40MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
MYCBPAP2.476e-3025.40MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metalloendopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mycbpap8.227e-2922.79mycbp associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kif112.486e-3325.91kinesin family member 11 [Source:Xenbase;Acc:XB-GE... [more]
kif112.892e-3325.91kinesin family member 11 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mycbpap3.457e-2824.72MYCBP associated protein [Source:MGI Symbol;Acc:MG... [more]
Mycbpap3.885e-2824.72MYCBP associated protein [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8TBZ2|MYBPP_HUMAN1.167e-2925.40MYCBP-associated protein OS=Homo sapiens OX=9606 G... [more]
sp|Q5SUV2|MYBPP_MOUSE2.418e-2724.72MYCBP-associated protein OS=Mus musculus OX=10090 ... [more]
sp|Q69CM7|MYBPP_RAT4.626e-2724.35MYCBP-associated protein OS=Rattus norvegicus OX=1... [more]
back to top
BLAST of Metalloendopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MRE41.888e-7030.94MYCBP-associated protein-like isoform X5 OS=Lingul... [more]
A0A2R2MRE52.093e-7030.94MYCBP-associated protein-like isoform X2 OS=Lingul... [more]
A0A2R2MRQ82.254e-7030.94MYCBP-associated protein-like isoform X4 OS=Lingul... [more]
A0A2R2MRF32.296e-7030.94MYCBP-associated protein-like isoform X6 OS=Lingul... [more]
A0A2R2MRF02.710e-7030.94MYCBP-associated protein-like isoform X7 OS=Lingul... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mycbpap8.434e-2123.72mycbp associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003378.17.653e-2328.06pep scaffold:Pmarinus_7.0:GL477807:7072:30008:1 ge... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO314704.158e-5530.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000038124.12.459e-1425.00MYCBP associated protein [Source:NCBI gene;Acc:101... [more]
ENSORLT00000037470.12.806e-1425.00MYCBP associated protein [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Metalloendopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000045572.10.000e+099.42SMESG000045572.1[more]
SMESG000023252.12.256e-1323.58SMESG000023252.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017508 ID=SMED30017508|Name=Metalloendopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2270bp
TTTACATTATCTAATTGAATTTTGGATAAGTTTCGAAATGGCTTTGATAT
TTTTTTGATTATAAAGCGACAAAGAAATACCATCAGAATATCATCATGCG
TTGGGATTCGGACCCCCAAAAAGACCACTGAGTGCTATGATTCCTACTAA
AACGGCGGATAAAAACAAAGAAAATATTAAATCTCACAGAATTAAGAGTA
ATAAATCCATAAAATGTAAACCTGATTTCGATACAAATGCTTTGAGACTC
TGGGAGCAAAGAATGATGGAAAGAAAGAAACTTCAAAATCATATTTCAAA
AACGGTTAATCGAGCTCCAGTGAATTTAATTTATAATTCAGCTGAAGAAT
TTAGAGAAACAATGGAAAAACGTTACTTAATAAGTAAAGCCATTCCATTT
TATGGTGCTGGATATGGATTTCGATCTGGAAGTGAATTTTGGCAACAGAA
TGAAGTGGTTGGCATCAACCCTAATGATTGTATTCACATGACTAATACTC
AAACTGAAAAAGGTTATCCTCCTCCTGTTCTACATGTTGGCGTGAGTAAC
ATAATCAAACAAGAAAAAAAAATATTTTTAAATGGAGCCAGTGATAAAAA
GAAAAGAATTGAATATGAAAACAGGAGATTGCAAGAATTAAATGGAATTA
TTAGTGAATTGAATCCTCATGATCCAGATTTCAGTCGCTTGGTGGTAATA
GGGGATTCCATTAAAAATCAAGCATATTCATATGATAACAATTCGATTTT
TTATGATTCCCTTGGTGAAACGAAAAAAAACTCTTTGGAAAGTGAAAATT
TAAGCCGATCTGAAAGTATTCAAGAAAGTGAACGAACTCACCAATCTGGT
GGCGGGCCGTGTTTATTAATAAATTTTATGAAATTGGAAAGCAGAAGCGC
GGAACCTGTTCCGAATTCTCAAATAGAAATCAGAATGTTATTTAATTGTT
ATGCAAAAGATAAATGCGTGGAACAGTTATTATTTCAAAATAGAGGAACA
TCTATAATCAGATATTGGTGGAAAAAGATTGAATCATTCGACCCTTTTAA
TTTGGAAAACAAGAACATACGACGTTTCTATTTCAAAACTGAAGACGGCA
TTTTGCTTCCTAATGAAGACCTAAACCTGCCGATAATATTTAAATCAGCC
AAATCTGGGATTTTTACAGAAGTCTGGAAAATCGAAACCATACCTCTTTT
GGCGAATGGCAATGATATTGTTATTATTTTAAAAGGAATTGCTTTGCAAA
ATGACGTGACGGCCGCCATTAGACAAGGGATTGATAGTTACATGAAATAT
CAAGTTGCGGACAATATTTCTCGAACTATCCTGGACGAAATCATACAAAA
TATCGGTAAAACGGATCTTCAACATCACCCTGAAGATTCGTTTGAAAACA
CAGATAGAGACCAATTTGTTCAGAAAAATAATGGATTTTTTTATGAAATT
GAGAATATTAATTCCCTTAAAAAACTAAATGAAGAAATCGCTGGGAAAGA
ACTGAATGCCTACGATAATTGGCGCATGGATTGTGGGCTGTTAAGAAAGA
ATATTGTATCGGCAAAATCTATTAAATCCGTGAAAAAAGAAGAAATATTT
CAGAAATTTTATAAGCACATGGATAAAGCCACGATGGTCAATTTTAAAGC
CTCTATTAATCATCGTGAACATTTGTATAAGATTGGGTACCGAATTTTGC
TGGAATTCTTCGGGAAAATGGTCGAAGGGATTACTGAAATAAGGAGATTT
CACGACTTACCGGATATTACATTTAAAATAGCTAATGATAGAAGACGTGC
CAACATCAGTCGGCAAAAAACCAATTTTTCCCAAGTTTCGAAGAAAAGCA
CAAGCACGCAAAAATCTAAATCTAAAGAGCTGAGCAATCTAGCTCGAGAA
TCAACTGACAATTTGATGAATGATTCTGAAGAAGTCGACAAATTTGGATC
ACAGAATTTCTCAGAAATCGATGAAACAATTCCAGTAGAGAGCGAGCAGC
TGTCCCATTCCAATAGCAATTTAGTTGAAATAAAATGCCATTCAAAAACC
TATCAGCTGGTTTATTCAATGTTGGATAAAGCTCTTGACAATATCATTGA
ATGTTGGGAAGAAATTACGTCGAATGATTTGTAGATTTTCATGATTTTTT
CCCTATTTAGTTTCATGCATCGAAATAAATATTTTCTGAGTTTTATATTT
TCAAGTTTTCCTCACTTAAGAAAGCGTGAAAATTGAATTTTCTTTCATTT
GTGTGTGTGTGTGTGTGTGT
back to top

protein sequence of SMED30017508-orf-1

>SMED30017508-orf-1 ID=SMED30017508-orf-1|Name=SMED30017508-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=666bp
MIPTKTADKNKENIKSHRIKSNKSIKCKPDFDTNALRLWEQRMMERKKLQ
NHISKTVNRAPVNLIYNSAEEFRETMEKRYLISKAIPFYGAGYGFRSGSE
FWQQNEVVGINPNDCIHMTNTQTEKGYPPPVLHVGVSNIIKQEKKIFLNG
ASDKKKRIEYENRRLQELNGIISELNPHDPDFSRLVVIGDSIKNQAYSYD
NNSIFYDSLGETKKNSLESENLSRSESIQESERTHQSGGGPCLLINFMKL
ESRSAEPVPNSQIEIRMLFNCYAKDKCVEQLLFQNRGTSIIRYWWKKIES
FDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIE
TIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILD
EIIQNIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEE
IAGKELNAYDNWRMDCGLLRKNIVSAKSIKSVKKEEIFQKFYKHMDKATM
VNFKASINHREHLYKIGYRILLEFFGKMVEGITEIRRFHDLPDITFKIAN
DRRRANISRQKTNFSQVSKKSTSTQKSKSKELSNLARESTDNLMNDSEEV
DKFGSQNFSEIDETIPVESEQLSHSNSNLVEIKCHSKTYQLVYSMLDKAL
DNIIECWEEITSNDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032707MYCBPAP
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 106..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 517..547
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..195
NoneNo IPR availablePANTHERPTHR12276EPSIN/ENT-RELATEDcoord: 7..401
NoneNo IPR availablePANTHERPTHR12276:SF54MYCBP-ASSOCIATED PROTEINcoord: 7..401
IPR032707MYCBP-associated proteinPFAMPF14646MYCBPAPcoord: 1..407
e-value: 5.5E-73
score: 246.4