Rho GDP-dissociation inhibitor 1

Overview
NameRho GDP-dissociation inhibitor 1
Smed IDSMED30017501
Length (bp)947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GDP-dissociation inhibitor 1 (SMED30017501) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GDP-dissociation inhibitor 1 (SMED30017501) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GDP-dissociation inhibitor 1 (SMED30017501) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GDP-dissociation inhibitor 1 (SMED30017501) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017501

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017501SMESG000029166.1 Contig5006GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017501SMESG000021482.1 Contig5006GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30017501SMESG000021482.1 dd_Smed_v4_730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017501SMESG000021482.1 dd_Smed_v4_730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30017501SMESG000021482.1 dd_Smed_v6_730_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017501SMESG000021482.1 dd_Smed_v6_730_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017501SMESG000021482.1 dd_Smed_v4_730_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Human
Match: ARHGDIA (Rho GDP dissociation inhibitor alpha [Source:HGNC Symbol;Acc:HGNC:678])

HSP 1 Score: 176.407 bits (446), Expect = 6.479e-54
Identity = 88/196 (44.90%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    V+V  L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKKDW
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Human
Match: ARHGDIA (Rho GDP dissociation inhibitor alpha [Source:HGNC Symbol;Acc:HGNC:678])

HSP 1 Score: 176.407 bits (446), Expect = 6.479e-54
Identity = 88/196 (44.90%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    V+V  L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKKDW
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Human
Match: ARHGDIA (Rho GDP dissociation inhibitor alpha [Source:HGNC Symbol;Acc:HGNC:678])

HSP 1 Score: 176.407 bits (446), Expect = 6.479e-54
Identity = 88/196 (44.90%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    V+V  L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKKDW
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Human
Match: ARHGDIB (Rho GDP dissociation inhibitor beta [Source:HGNC Symbol;Acc:HGNC:679])

HSP 1 Score: 171.4 bits (433), Expect = 4.978e-52
Identity = 86/182 (47.25%), Postives = 120/182 (65.93%), Query Frame = 3
Query:  114 VGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            + YK P +K+L+++ +MD++DESL KYK  LLG  P    P  PN    V+V +L  +C      I +DL GD+  L K  IV+KEG++Y VKI+F + R++VSGL+Y+  +YR  ++VDK T M+GSY P+ E + + +  EEAP G L RGTY  KS FTDDD  D+LSW W + IKK+W
Sbjct:   22 LNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPN----VVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEW 199          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Human
Match: ARHGDIB (Rho GDP dissociation inhibitor beta [Source:HGNC Symbol;Acc:HGNC:679])

HSP 1 Score: 171.4 bits (433), Expect = 4.978e-52
Identity = 86/182 (47.25%), Postives = 120/182 (65.93%), Query Frame = 3
Query:  114 VGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            + YK P +K+L+++ +MD++DESL KYK  LLG  P    P  PN    V+V +L  +C      I +DL GD+  L K  IV+KEG++Y VKI+F + R++VSGL+Y+  +YR  ++VDK T M+GSY P+ E + + +  EEAP G L RGTY  KS FTDDD  D+LSW W + IKK+W
Sbjct:   22 LNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPN----VVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEW 199          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Celegans
Match: rhi-1 (Probable rho GDP-dissociation inhibitor [Source:UniProtKB/Swiss-Prot;Acc:Q20496])

HSP 1 Score: 138.272 bits (347), Expect = 9.149e-40
Identity = 78/195 (40.00%), Postives = 111/195 (56.92%), Query Frame = 3
Query:   75 MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKS--PIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKD 653
            M++ +N  E  +   YK P +K++++++  D+EDESL+ YKA LLG     +      +P  VIV+ + +   G+     DL  D + L  S   + IKEG+ Y +   F +QRE+ SGL Y     R  I V+ +  M+GSYAPK E   YKS  EEAP+G + RG Y + SK TDDDNN YL W W + I K+
Sbjct:    1 MSDHENTGENTSEYQYKQPPQKSIDELLNADKEDESLKVYKAKLLGQGTVIVDE---KNPLRVIVRSVELLINGKTAQSFDL-SDPAKLVNSDLSVSIKEGSNYRLSFAFHVQREITSGLHYKHKVKRSGITVENEKYMMGSYAPKLEIQEYKSPNEEAPSGMMHRGKYKVYSKITDDDNNVYLDWQWTLHITKE 191          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Fly
Match: RhoGDI (gene:FBgn0036921 transcript:FBtr0331800)

HSP 1 Score: 195.282 bits (495), Expect = 1.238e-61
Identity = 97/191 (50.79%), Postives = 131/191 (68.59%), Query Frame = 3
Query:   84 RDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
             D+D+   N   Y+AP +KT+E+I+  DQEDESL++YK ALLG+  ++     PNDPR VIV+KLA+   GR D+E+DL GD+S L K   VIKEG +Y V+I F +QRE+V GL+Y+  + RL + VDK   M+GSY PK E   Y +  EEAP+G  +RGTY + S FTDDD + +L W+W  +IKKDW
Sbjct:   13 HDDDVHDAN---YQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKLALVVEGRDDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW 200          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Fly
Match: RhoGDI (gene:FBgn0036921 transcript:FBtr0074896)

HSP 1 Score: 195.282 bits (495), Expect = 1.238e-61
Identity = 97/191 (50.79%), Postives = 131/191 (68.59%), Query Frame = 3
Query:   84 RDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
             D+D+   N   Y+AP +KT+E+I+  DQEDESL++YK ALLG+  ++     PNDPR VIV+KLA+   GR D+E+DL GD+S L K   VIKEG +Y V+I F +QRE+V GL+Y+  + RL + VDK   M+GSY PK E   Y +  EEAP+G  +RGTY + S FTDDD + +L W+W  +IKKDW
Sbjct:   13 HDDDVHDAN---YQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKLALVVEGRDDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW 200          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Zebrafish
Match: arhgdig (Rho GDP dissociation inhibitor (GDI) gamma [Source:ZFIN;Acc:ZDB-GENE-040426-1493])

HSP 1 Score: 173.326 bits (438), Expect = 5.985e-53
Identity = 91/201 (45.27%), Postives = 130/201 (64.68%), Query Frame = 3
Query:   75 MAERDNDL-----EYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            MA+++ D+     E E  + Y+ P +K+L++I +MD++DESL KYK  LLGS P    P  PN    V V +L + C      I +DL GD++ L K    +KEG +Y VKI+F + R++VSGL+Y+  +Y+  +R+DK   M+GSY P+AE H + +  EEAP G + RGTY IKS FTDDD  D+LSW+W + IKKDW+
Sbjct:    1 MADKEKDVPVVEDEDEPDLNYQPPAQKSLQEIQEMDKDDESLTKYKQTLLGSGPVVADPTIPN----VQVTRLTLMCDQAPGPITMDLTGDLNALKKKCFTMKEGVEYRVKIHFKVNRDIVSGLKYVHQTYKKGLRLDKAVYMVGSYGPRAEEHEFMTPVEEAPKGMIVRGTYHIKSFFTDDDKTDHLSWDWNLLIKKDWD 197          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Zebrafish
Match: arhgdia (Rho GDP dissociation inhibitor (GDI) alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2816])

HSP 1 Score: 172.17 bits (435), Expect = 2.095e-52
Identity = 83/182 (45.60%), Postives = 122/182 (67.03%), Query Frame = 3
Query:  114 VGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            V YKAP +K+L++I ++DQ+DESL+KYK ALLGS      P  PN    V V +L + C      + +DL GD+ +  K   ++KEG +Y +KI F + +E+VSGL+Y+  ++R  +++DK   M+GSY P+ + + + +  EEAP G L RGTY +KSKFTDDD +D+LSW W ++IKKDW
Sbjct:   24 VNYKAPAQKSLQEIQELDQDDESLRKYKEALLGSCAVAADPNAPN----VQVTRLTLMCETAPAPLVLDLQGDLESFKKQSFILKEGVEYRIKISFKVNKEIVSGLKYVQQTFRKGVKIDKSDYMVGSYGPRPDEYEFLTPLEEAPKGMLARGTYNLKSKFTDDDKHDHLSWEWNLNIKKDW 201          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Zebrafish
Match: arhgdia (Rho GDP dissociation inhibitor (GDI) alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2816])

HSP 1 Score: 172.17 bits (435), Expect = 2.095e-52
Identity = 83/182 (45.60%), Postives = 122/182 (67.03%), Query Frame = 3
Query:  114 VGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            V YKAP +K+L++I ++DQ+DESL+KYK ALLGS      P  PN    V V +L + C      + +DL GD+ +  K   ++KEG +Y +KI F + +E+VSGL+Y+  ++R  +++DK   M+GSY P+ + + + +  EEAP G L RGTY +KSKFTDDD +D+LSW W ++IKKDW
Sbjct:   24 VNYKAPAQKSLQEIQELDQDDESLRKYKEALLGSCAVAADPNAPN----VQVTRLTLMCETAPAPLVLDLQGDLESFKKQSFILKEGVEYRIKISFKVNKEIVSGLKYVQQTFRKGVKIDKSDYMVGSYGPRPDEYEFLTPLEEAPKGMLARGTYNLKSKFTDDDKHDHLSWEWNLNIKKDW 201          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Zebrafish
Match: arhgdig (Rho GDP dissociation inhibitor (GDI) gamma [Source:ZFIN;Acc:ZDB-GENE-040426-1493])

HSP 1 Score: 97.0561 bits (240), Expect = 2.962e-24
Identity = 57/146 (39.04%), Postives = 87/146 (59.59%), Query Frame = 3
Query:   30 NFLNYLYIKIFIF*IMAERDNDL-----EYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASY 449
             FL  L++ +    IMA+++ D+     E E  + Y+ P +K+L++I +MD++DESL KYK  LLGS P    P  PN    V V +L + C      I +DL GD++ L K    +KEG +Y VKI+F + R++VSGL+Y+  +Y
Sbjct:   12 QFLELLWLTVCYRGIMADKEKDVPVVEDEDEPDLNYQPPAQKSLQEIQEMDKDDESLTKYKQTLLGSGPVVADPTIPN----VQVTRLTLMCDQAPGPITMDLTGDLNALKKKCFTMKEGVEYRVKIHFKVNRDIVSGLKYVHQTY 153          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Xenopus
Match: arhgdib (Rho GDP dissociation inhibitor (GDI) beta [Source:NCBI gene;Acc:448583])

HSP 1 Score: 171.785 bits (434), Expect = 3.723e-52
Identity = 86/191 (45.03%), Postives = 124/191 (64.92%), Query Frame = 3
Query:   87 DNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            ++D E +  + YK P +K+L++I ++D++DESL KYK +LLG  P    P  PN    VIV +L  +C      I +DL GD++NL K    +KEG +Y VKI+F + +E+VSGL+Y    YR  +RV K   M+GSY P+ E + + +  EEAP G L RGTY+ KS FTDDDN+++LSW W + I+K+W
Sbjct:   12 EDDDELDGKLNYKPPPQKSLQEIQELDKDDESLAKYKKSLLGDGPVAADPSAPN----VIVTRLTLVCATAPKLITMDLTGDLTNLKKETFALKEGVEYRVKIHFKVTKEIVSGLKYDQYIYRAGVRVTKARFMVGSYGPRQEEYEFLTPLEEAPKGILARGTYLNKSHFTDDDNHNHLSWEWNLTIRKEW 198          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Xenopus
Match: arhgdig (Rho GDP dissociation inhibitor (GDI) gamma [Source:NCBI gene;Acc:493242])

HSP 1 Score: 169.088 bits (427), Expect = 1.183e-50
Identity = 93/217 (42.86%), Postives = 136/217 (62.67%), Query Frame = 3
Query:   30 NFLNYLYIKIFIF*IMAERDN------DLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
              L  +++ +    IMA++D       + E E    YK PE K++++I ++D++DESL KYK ALLG  P+ +    PN    V V +L + C      I +DL GD+S+L     ++KEG  Y VKI + + +E+VSGLRY+  +YR  ++VD +  M+GSY P+AE + Y +  EEAP G + RGTY+IKSKFTDDD +D+LSW W + IKKDW+
Sbjct:   19 QLLQLMWLTVCYRDIMADKDGIKHGEEEAEEEVEPNYKPPEMKSVQEIQELDKDDESLIKYKQALLGQLPAVVDSNAPN----VQVTRLTLLCDEAPEPITMDLSGDISHLKDKVYLLKEGCSYRVKISYKVNKEIVSGLRYVHLTYRKGVKVDSENYMVGSYGPRAEEYEYLTPLEEAPKGMIARGTYLIKSKFTDDDKSDHLSWEWKLAIKKDWK 231          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Xenopus
Match: nhsl1 (NHS like 1 [Source:Xenbase;Acc:XB-GENE-5992635])

HSP 1 Score: 162.925 bits (411), Expect = 1.164e-48
Identity = 82/196 (41.84%), Postives = 123/196 (62.76%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE  ++   E+ V YK P +K++++I ++D++DESL+KYK ALLG  P+   P  PN    V+V KL + C      +E+DL GD+    K    +KEG +Y +KI F + +E+VSGL+Y   +YR  +R+D+ + M+GSY P+ + + + +  EEAP G L RG Y IK  FTDDD + +LSW W + IK +W
Sbjct:   14 IAAENQDE---EHSVDYKPPAQKSIKEIQELDEDDESLRKYKEALLGPVPASTDPGAPN----VMVTKLTLLCDCAPLPLELDLTGDLEKFKKQSFTLKEGVEYRIKISFKVNKEIVSGLKYQQQTYRKGVRLDQTSYMVGSYGPRVDEYEFLTPIEEAPKGMLARGCYSIKCLFTDDDKSKHLSWEWNLHIKNEW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Xenopus
Match: nhsl1 (NHS like 1 [Source:Xenbase;Acc:XB-GENE-5992635])

HSP 1 Score: 140.584 bits (353), Expect = 5.335e-40
Identity = 75/199 (37.69%), Postives = 119/199 (59.80%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLM----GDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE  ++   E+ V YK P +K++++I ++D++DESL+KYK ALLG  P+        + R   ++     P+    +E+ L+    GD+    K    +KEG +Y +KI F + +E+VSGL+Y   +YR  +R+D+ + M+GSY P+ + + + +  EEAP G L RG Y IK  FTDDD + +LSW W + IK +W
Sbjct:   14 IAAENQDE---EHSVDYKPPAQKSIKEIQELDEDDESLRKYKEALLGPVPASTGK---FNNRVAFIRLPCHPPIL---LELQLLSFFSGDLEKFKKQSFTLKEGVEYRIKISFKVNKEIVSGLKYQQQTYRKGVRLDQTSYMVGSYGPRVDEYEFLTPIEEAPKGMLARGCYSIKCLFTDDDKSKHLSWEWNLHIKNEW 203          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Mouse
Match: Arhgdia (Rho GDP dissociation inhibitor (GDI) alpha [Source:MGI Symbol;Acc:MGI:2178103])

HSP 1 Score: 177.178 bits (448), Expect = 2.090e-54
Identity = 88/196 (44.90%), Postives = 128/196 (65.31%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    VIV +L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKK+W
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHLSWEWNLTIKKEW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Mouse
Match: Arhgdia (Rho GDP dissociation inhibitor (GDI) alpha [Source:MGI Symbol;Acc:MGI:2178103])

HSP 1 Score: 177.178 bits (448), Expect = 2.090e-54
Identity = 88/196 (44.90%), Postives = 128/196 (65.31%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    VIV +L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKK+W
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHLSWEWNLTIKKEW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Mouse
Match: Arhgdib (Rho, GDP dissociation inhibitor (GDI) beta [Source:MGI Symbol;Acc:MGI:101940])

HSP 1 Score: 168.318 bits (425), Expect = 5.068e-51
Identity = 89/195 (45.64%), Postives = 125/195 (64.10%), Query Frame = 3
Query:   75 MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            + E D+DL+  + + YK P +K+L+++ +MD++DESL KYK  LLG  P    P  PN    V V +L+ +C      I +DL GD+  L K   V+KEG +Y VKI F + +++VSGL+Y+  +YR  +RVDK T M+GSY P+ E + + +  EEAP G L RGTY  KS FTDDD  D+L+W W + IKKDW
Sbjct:   10 LEEADDDLD--SKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPN----VTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDW 198          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Mouse
Match: Arhgdib (Rho, GDP dissociation inhibitor (GDI) beta [Source:MGI Symbol;Acc:MGI:101940])

HSP 1 Score: 168.318 bits (425), Expect = 5.068e-51
Identity = 89/195 (45.64%), Postives = 125/195 (64.10%), Query Frame = 3
Query:   75 MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            + E D+DL+  + + YK P +K+L+++ +MD++DESL KYK  LLG  P    P  PN    V V +L+ +C      I +DL GD+  L K   V+KEG +Y VKI F + +++VSGL+Y+  +YR  +RVDK T M+GSY P+ E + + +  EEAP G L RGTY  KS FTDDD  D+L+W W + IKKDW
Sbjct:   10 LEEADDDLD--SKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPN----VTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDW 198          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Mouse
Match: Arhgdib (Rho, GDP dissociation inhibitor (GDI) beta [Source:MGI Symbol;Acc:MGI:101940])

HSP 1 Score: 168.318 bits (425), Expect = 5.068e-51
Identity = 89/195 (45.64%), Postives = 125/195 (64.10%), Query Frame = 3
Query:   75 MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            + E D+DL+  + + YK P +K+L+++ +MD++DESL KYK  LLG  P    P  PN    V V +L+ +C      I +DL GD+  L K   V+KEG +Y VKI F + +++VSGL+Y+  +YR  +RVDK T M+GSY P+ E + + +  EEAP G L RGTY  KS FTDDD  D+L+W W + IKKDW
Sbjct:   10 LEEADDDLD--SKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPN----VTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDW 198          
BLAST of Rho GDP-dissociation inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q5XI73|GDIR1_RAT (Rho GDP-dissociation inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Arhgdia PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.462e-53
Identity = 88/196 (44.90%), Postives = 128/196 (65.31%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    VIV +L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKK+W
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHLSWEWNLTIKKEW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q99PT1|GDIR1_MOUSE (Rho GDP-dissociation inhibitor 1 OS=Mus musculus OX=10090 GN=Arhgdia PE=1 SV=3)

HSP 1 Score: 177.178 bits (448), Expect = 1.462e-53
Identity = 88/196 (44.90%), Postives = 128/196 (65.31%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    VIV +L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKK+W
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHLSWEWNLTIKKEW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. UniProt/SwissProt
Match: sp|P19803|GDIR1_BOVIN (Rho GDP-dissociation inhibitor 1 OS=Bos taurus OX=9913 GN=ARHGDIA PE=1 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 2.251e-53
Identity = 87/196 (44.39%), Postives = 128/196 (65.31%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    V+V +L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKK+W
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VVVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDRTDHLSWEWNLTIKKEW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q4R4J0|GDIR1_MACFA (Rho GDP-dissociation inhibitor 1 OS=Macaca fascicularis OX=9541 GN=ARHGDIA PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.112e-53
Identity = 88/196 (44.90%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    V+V  L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKKDW
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. UniProt/SwissProt
Match: sp|P52565|GDIR1_HUMAN (Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 3.112e-53
Identity = 88/196 (44.90%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   72 IMAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            I AE + D   E+ V YK P +K++++I ++D++DESL+KYK ALLG       P  PN    V+V  L  +C      +E+DL GD+ +  K   V+KEG +Y +KI F + RE+VSG++Y+  +YR  +++DK   M+GSY P+AE + + +  EEAP G L RG+Y IKS+FTDDD  D+LSW W + IKKDW
Sbjct:   14 IAAENEED---EHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPN----VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW 202          
BLAST of Rho GDP-dissociation inhibitor 1 vs. TrEMBL
Match: T1FM40 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20209889 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.642e-63
Identity = 103/193 (53.37%), Postives = 136/193 (70.47%), Query Frame = 3
Query:   81 ERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLG-SNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            E  +DL  +   GY+ PE+KTL +I+  D EDESL+KYK  LLG S P +++  +P+DPR VIV KLA+   GRPDIE+DL G++ +L     V++EG  Y VKIYF++QRE+V GLRY+  +YR  I VDK+T M+GSY PK E  S+ +  EEAP+G + RGTY IKS FTDDD  ++L W W +DIKKDW
Sbjct:    5 EHGDDLVPDETPGYQPPEQKTLTEILSADAEDESLRKYKETLLGTSEPVNVEI-FPSDPRRVIVTKLALLVEGRPDIEVDLTGNLEDLKNQTYVLQEGCTYKVKIYFYVQREIVQGLRYVQQTYRAAIPVDKNTFMVGSYGPKKELQSFTTPAEEAPSGLVARGTYKIKSLFTDDDKFEHLKWEWKLDIKKDW 196          
BLAST of Rho GDP-dissociation inhibitor 1 vs. TrEMBL
Match: A0A232F747 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_010846 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.829e-62
Identity = 99/191 (51.83%), Postives = 132/191 (69.11%), Query Frame = 3
Query:   87 DNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            D DLE E+   YK P +K++E I++ D+EDESL+KYK  LLG   +      PNDPR VIV+KLA+C   RPD+E+DL GD++ L K   VIKEG  Y ++I F +QRE+V GL+Y+  +YRL + VDK T M+GSY PK E  SY +  E+AP G + RG+Y + S FTDDD N++L W W+ DIKKDW+
Sbjct:   13 DEDLEVES--NYKPPPEKSIEQILEADKEDESLRKYKETLLGEAKAGGVVVEPNDPRKVIVKKLALCVTDRPDMELDLTGDLTQLKKQTFVIKEGVSYKIRIDFIVQREIVHGLKYVQKTYRLGVPVDKMTHMVGSYPPKKEIQSYTTPAEDAPAGVMARGSYTVSSLFTDDDKNEHLKWEWSFDIKKDWK 201          
BLAST of Rho GDP-dissociation inhibitor 1 vs. TrEMBL
Match: A0A1I8HCX1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 5.488e-62
Identity = 106/199 (53.27%), Postives = 140/199 (70.35%), Query Frame = 3
Query:   75 MAER-DNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVG--RPDIEIDLM-GDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            MAE+ DND       G+K P  K+L++I+  D++D SL+ YK  LLG+    + P +P++PRNVIVQK+ I  +G  R    I LM  D+S L KSPIVIKEG  Y VK++F++QRE+V+GLRY+  SY++ IRV KD +M+GSY PKAE H Y S  +EAP+G + RGTY IKS+FTDDD ND+LSW WAI IK  W+
Sbjct:    1 MAEKGDNDDLVPEDTGFKPPAPKSLDEILNADKDDPSLENYKKQLLGNT---VPPVFPDNPRNVIVQKIQIEFLGESREPANIQLMDADLSVLKKSPIVIKEGVNYRVKVFFYVQREIVAGLRYINCSYKMGIRVAKDDLMVGSYPPKAEPHVYSSPAQEAPSGMMARGTYTIKSRFTDDDRNDFLSWEWAIKIKDSWK 196          
BLAST of Rho GDP-dissociation inhibitor 1 vs. TrEMBL
Match: K1QCM0 (Rho GDP-dissociation inhibitor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10019175 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 7.014e-62
Identity = 103/206 (50.00%), Postives = 140/206 (67.96%), Query Frame = 3
Query:   75 MAERDN------DLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIR-----VDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            MAE +N      DL  ++P  Y+AP +K++++IV+ DQEDESL+KYK +LLG    ++KPP+P+D RNVIV KL++   GR D E+DL GD+S L +    IKEG KY +K+ F++QRE+VSGLRY   + R  I+     VDK   M+GSY PK  AH Y +  +EAP+G L RG+Y ++SKFTDDD N  L W W  +IKKDW+
Sbjct:    1 MAEAENKPTAEEDLHEDDP-NYRAPAQKSVKEIVEADQEDESLRKYKESLLGGAIKEVKPPFPDDKRNVIVSKLSLVVEGRTDKELDLTGDLSKLKEQVFTIKEGAKYRMKVSFYVQREIVSGLRYEQKTSRKGIQDVLGAVDKSKFMVGSYGPKETAHEYLTPIDEAPSGMLVRGSYTVESKFTDDDRNSILEWKWKFEIKKDWD 205          
BLAST of Rho GDP-dissociation inhibitor 1 vs. TrEMBL
Match: A0A267FS27 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000762g1 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 7.316e-62
Identity = 106/199 (53.27%), Postives = 140/199 (70.35%), Query Frame = 3
Query:   75 MAER-DNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVG--RPDIEIDLM-GDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            MAE+ DND       G+K P  K+L++I+  D++D SL+ YK  LLG+    + P +P++PRNVIVQK+ I  +G  R    I LM  D+S L KSPIVIKEG  Y VK++F++QRE+V+GLRY+  SY++ IRV KD +M+GSY PKAE H Y S  +EAP+G + RGTY IKS+FTDDD ND+LSW WAI IK  W+
Sbjct:   12 MAEKGDNDDLVPEDTGFKPPAPKSLDEILNADKDDPSLENYKKQLLGNT---VPPVFPDNPRNVIVQKIQIEFLGESREPANIQLMDADLSVLKKSPIVIKEGVNYRVKVFFYVQREIVAGLRYINCSYKMGIRVAKDDLMVGSYPPKAEPHVYSSPAQEAPSGMMARGTYTIKSRFTDDDRNDFLSWEWAIKIKDSWK 207          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Cavefish
Match: arhgdig (rho GDP-dissociation inhibitor 2 [Source:NCBI gene;Acc:103022852])

HSP 1 Score: 176.792 bits (447), Expect = 4.989e-54
Identity = 94/215 (43.72%), Postives = 132/215 (61.40%), Query Frame = 3
Query:   30 NFLNYLYIKIFIF*IMAERDNDL-----EYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
              L  L++ +    IMA++++ +     E E  + Y+ P +K+L++I ++D++DESL KYK  LLGS P    P  PN    V V +L + C      I +DL GD+  L K   V+KEG  Y VKI+F + R++VSGL+Y+  +YR  +RVDK   M+GSY P+ E H + +  EEAP G + RGTY IKS FTDDD  D+LSW W + IKKDW
Sbjct:   12 QLLELLWLTVCYRGIMADKESTVPVGEEEDETDLNYQPPAQKSLQEIQELDKDDESLNKYKQTLLGSGPVVSDPTIPN----VQVTRLTLMCDQAPGPITMDLTGDLDALKKQNFVMKEGVDYRVKIHFKVNRDIVSGLKYVHLTYRKGLRVDKAVYMVGSYGPRVEEHEFLTPVEEAPKGMIVRGTYHIKSYFTDDDKTDHLSWEWNLQIKKDW 222          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Cavefish
Match: arhgdia (Rho GDP dissociation inhibitor alpha [Source:NCBI gene;Acc:103045827])

HSP 1 Score: 174.096 bits (440), Expect = 3.337e-53
Identity = 85/187 (45.45%), Postives = 123/187 (65.78%), Query Frame = 3
Query:   99 EYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            E    V YK P +K+L++I ++D++DESL+KYK ALLG+   DI P  PN    V V +L + C      + +DL GD+ +  K   ++KEG +Y +KI F + +E+VSGL+Y+  +YR  +++DK   M+GSY P+   + + +  EEAP G L RGTY IKSKFTDDD +D+LSW W ++IKKDW
Sbjct:   19 EESEAVNYKPPAQKSLQEIQELDKDDESLRKYKEALLGAASVDIDPSAPN----VQVTRLTLMCETAPAPLTLDLQGDLESFKKQSFILKEGVEYRIKISFKVNKEIVSGLKYVQQTYRKGVKLDKSDYMVGSYGPRPAEYEFLTPLEEAPKGMLARGTYNIKSKFTDDDKHDHLSWEWNLNIKKDW 201          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Cavefish
Match: arhgdig (rho GDP-dissociation inhibitor 2 [Source:NCBI gene;Acc:103022852])

HSP 1 Score: 173.326 bits (438), Expect = 5.276e-53
Identity = 89/187 (47.59%), Postives = 119/187 (63.64%), Query Frame = 3
Query:   99 EYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            E E  + Y+ P +K+L++I ++D++DESL KYK  LLGS P    P  PN    V V +L + C      I +DL GD+  L K   V+KEG  Y VKI+F + R++VSGL+Y+  +YR  +RVDK   M+GSY P+ E H + +  EEAP G + RGTY IKS FTDDD  D+LSW W + IKKDW
Sbjct:   14 EDETDLNYQPPAQKSLQEIQELDKDDESLNKYKQTLLGSGPVVSDPTIPN----VQVTRLTLMCDQAPGPITMDLTGDLDALKKQNFVMKEGVDYRVKIHFKVNRDIVSGLKYVHLTYRKGLRVDKAVYMVGSYGPRVEEHEFLTPVEEAPKGMIVRGTYHIKSYFTDDDKTDHLSWEWNLQIKKDW 196          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Cavefish
Match: arhgdig (rho GDP-dissociation inhibitor 2 [Source:NCBI gene;Acc:103022852])

HSP 1 Score: 136.346 bits (342), Expect = 8.180e-39
Identity = 69/139 (49.64%), Postives = 89/139 (64.03%), Query Frame = 3
Query:  243 PNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            P  P NV V +L + C      I +DL GD+  L K   V+KEG  Y VKI+F + R++VSGL+Y+  +YR  +RVDK   M+GSY P+ E H + +  EEAP G + RGTY IKS FTDDD  D+LSW W + IKKDW
Sbjct:   44 PTIP-NVQVTRLTLMCDQAPGPITMDLTGDLDALKKQNFVMKEGVDYRVKIHFKVNRDIVSGLKYVHLTYRKGLRVDKAVYMVGSYGPRVEEHEFLTPVEEAPKGMIVRGTYHIKSYFTDDDKTDHLSWEWNLQIKKDW 181          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Yeast
Match: RDI1 (Rho GDP dissociation inhibitor; involved in the localization and regulation of Cdc42p and Rho1p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002294])

HSP 1 Score: 117.472 bits (293), Expect = 2.482e-32
Identity = 79/203 (38.92%), Postives = 110/203 (54.19%), Query Frame = 3
Query:   75 MAERDNDL----EYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKP-PYPNDPRNVIVQKLAICPVGRPD-IEIDLMGD--VSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSY---KSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKK 650
            MAE   D     E  N   YK   KKT+++   +D EDESL K+K +L  S  SD+ P  +P D R V+VQK+ +     P+ I  DL  +  +  L      IKE + Y +KI F +Q E+++GLRY+    +  I VDK    LGSYAP  +   +   +  E EAP+G L RG Y   SKF DDD  ++L+ NW ++I K
Sbjct:    1 MAEESTDFSQFEEERNNDQYKVSAKKTVDEYKNLDAEDESLAKWKESLGLS--SDVLPLEFPGDKRKVVVQKIQLLVNTEPNPITFDLTNEKTIKELASKRYKIKENSIYKLKIVFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKTKPFYEVELPESEAPSGFLARGNYSAVSKFIDDDKTNHLTLNWGVEIVK 201          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Nematostella
Match: EDO36831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH6])

HSP 1 Score: 181.415 bits (459), Expect = 1.476e-56
Identity = 99/198 (50.00%), Postives = 128/198 (64.65%), Query Frame = 3
Query:   87 DNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPV---GRP---DIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFI-QRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            D+D   E P GY  P +KT E+I  +D +DE+L KYK  LLG  P ++    P  P+NV+V+K+AI P    G P    IE+DL+GD+S L  SPI IKEGT Y +KI F +   +++SGLR     YR  IRV KD+ M+GSY PK E H Y +  +EAP G + RG YII+SKF DDD N +L W WAI+IKKDW+
Sbjct:   12 DDDEPEETP-GYVPPAQKTWEEIQNLDADDEALVKYKQTLLGVTPEEL----PKGPKNVVVEKVAIVPTDEKGNPVRDPIELDLIGDISKLKDSPITIKEGTYYKIKIIFKVYNDQIISGLRLHNLFYRKGIRVTKDSFMVGSYGPKFEPHEYLTPIDEAPKGMMARGKYIIRSKFIDDDKNSHLEWEWAIEIKKDWQ 204          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Medaka
Match: ARHGDIA (rho GDP-dissociation inhibitor 1 [Source:NCBI gene;Acc:101174723])

HSP 1 Score: 171.4 bits (433), Expect = 2.745e-52
Identity = 81/182 (44.51%), Postives = 121/182 (66.48%), Query Frame = 3
Query:  111 PVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            PV YK P +K++++I ++D++DESL+KYK ALLG   S+  P   N P   + Q   IC      + +DL G++    K   ++KEG +Y +KI F + RE+VSGL+Y+  +YR  +++DK   M+GSY P+A  + + ++ EEAP G L RG Y+IKSKFTDDD +++LSW W ++IKKDW
Sbjct:   23 PVNYKPPAQKSVKEIQELDKDDESLRKYKEALLGPGISEADP---NAPNVQVTQMTLICETAPNPLILDLQGNLEAFKKQAFILKEGVEYKIKISFKVNREIVSGLKYVQETYRKGMKIDKTDYMVGSYGPRANEYEFFTTVEEAPKGLLARGHYVIKSKFTDDDKHNHLSWEWNLNIKKDW 201          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Medaka
Match: arhgdia (rho GDP-dissociation inhibitor 1 [Source:NCBI gene;Acc:101161729])

HSP 1 Score: 169.859 bits (429), Expect = 1.247e-51
Identity = 88/191 (46.07%), Postives = 126/191 (65.97%), Query Frame = 3
Query:   90 NDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAI-CPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKA-EAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            N  E  + V YK P +K+L++I ++D++DESL+KYK ALLG+  S   P  PN    V V ++ + C      + +DL GD+ N  K+P  +KEG +Y VKI F + +++VSGL+Y   ++R  +RVDK   M+GSY P+  E + Y ++ EE+P G L RGTY IKSKFTDDD ND+LSW W++ IKK+W
Sbjct:   18 NAEESPDSVNYKPPAQKSLQEIQELDKDDESLRKYKEALLGNAGSVADPSVPN----VQVTRMTLLCEQAPAPLILDLQGDLENFRKNPFTLKEGVEYRVKINFKVNKDIVSGLKYTQQTFRKGVRVDKTDYMVGSYGPRPNEEYEYLTAMEESPKGMLARGTYNIKSKFTDDDKNDHLSWEWSLVIKKEW 204          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Medaka
Match: arhgdig (rho GDP-dissociation inhibitor 2 [Source:NCBI gene;Acc:101166052])

HSP 1 Score: 154.451 bits (389), Expect = 1.988e-45
Identity = 80/212 (37.74%), Postives = 126/212 (59.43%), Query Frame = 3
Query:   36 LNYLYIKIFIF*IMAERDN----DLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            L  L++ +    ++A+++N    + E E  + Y  P +K+L++I +MD++DESL KYK  LLG       P  P     V V +L  +C      I +DL GD++ L +    ++EG KY +KI+F + RE+VSGL+Y   +YR  ++++K   M+GSY P+ E   +    ++ P G L+RG Y++KS FTDDD N +L+W W I+I KDW
Sbjct:   14 LELLWLTMCYRGLLADKNNLPVEEEEDEGNLNYNPPTQKSLQEIQQMDKDDESLVKYKQTLLGPEAVTADPSGPE----VKVTRLTLVCDEAPQPITMDLTGDLNALKEKSFTLQEGVKYRLKIHFKVNREIVSGLKYRHVTYRKGVKINKMVFMVGSYGPREEEQEFLCPPDKTPKGVLSRGQYLVKSCFTDDDKNIHLTWEWNINISKDW 221          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Medaka
Match: arhgdig (rho GDP-dissociation inhibitor 2 [Source:NCBI gene;Acc:101166052])

HSP 1 Score: 153.295 bits (386), Expect = 3.492e-45
Identity = 78/200 (39.00%), Postives = 121/200 (60.50%), Query Frame = 3
Query:   72 IMAERDN----DLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLA-ICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDW 656
            ++A+++N    + E E  + Y  P +K+L++I +MD++DESL KYK  LLG       P  P     V V +L  +C      I +DL GD++ L +    ++EG KY +KI+F + RE+VSGL+Y   +YR  ++++K   M+GSY P+ E   +    ++ P G L+RG Y++KS FTDDD N +L+W W I+I KDW
Sbjct:    3 LLADKNNLPVEEEEDEGNLNYNPPTQKSLQEIQQMDKDDESLVKYKQTLLGPEAVTADPSGPE----VKVTRLTLVCDEAPQPITMDLTGDLNALKEKSFTLQEGVKYRLKIHFKVNREIVSGLKYRHVTYRKGVKINKMVFMVGSYGPREEEQEFLCPPDKTPKGVLSRGQYLVKSCFTDDDKNIHLTWEWNINISKDW 198          
BLAST of Rho GDP-dissociation inhibitor 1 vs. Planmine SMEST
Match: SMESG000021482.1 (SMESG000021482.1)

HSP 1 Score: 398.667 bits (1023), Expect = 6.125e-142
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 3
Query:   75 MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 659
            MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE
Sbjct:    1 MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPSDIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGTKYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSYKSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE 195          
The following BLAST results are available for this feature:
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGDIA6.479e-5444.90Rho GDP dissociation inhibitor alpha [Source:HGNC ... [more]
ARHGDIA6.479e-5444.90Rho GDP dissociation inhibitor alpha [Source:HGNC ... [more]
ARHGDIA6.479e-5444.90Rho GDP dissociation inhibitor alpha [Source:HGNC ... [more]
ARHGDIB4.978e-5247.25Rho GDP dissociation inhibitor beta [Source:HGNC S... [more]
ARHGDIB4.978e-5247.25Rho GDP dissociation inhibitor beta [Source:HGNC S... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rhi-19.149e-4040.00Probable rho GDP-dissociation inhibitor [Source:U... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RhoGDI1.238e-6150.79gene:FBgn0036921 transcript:FBtr0331800[more]
RhoGDI1.238e-6150.79gene:FBgn0036921 transcript:FBtr0074896[more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
arhgdig5.985e-5345.27Rho GDP dissociation inhibitor (GDI) gamma [Source... [more]
arhgdia2.095e-5245.60Rho GDP dissociation inhibitor (GDI) alpha [Source... [more]
arhgdia2.095e-5245.60Rho GDP dissociation inhibitor (GDI) alpha [Source... [more]
arhgdig2.962e-2439.04Rho GDP dissociation inhibitor (GDI) gamma [Source... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
arhgdib3.723e-5245.03Rho GDP dissociation inhibitor (GDI) beta [Source:... [more]
arhgdig1.183e-5042.86Rho GDP dissociation inhibitor (GDI) gamma [Source... [more]
nhsl11.164e-4841.84NHS like 1 [Source:Xenbase;Acc:XB-GENE-5992635][more]
nhsl15.335e-4037.69NHS like 1 [Source:Xenbase;Acc:XB-GENE-5992635][more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgdia2.090e-5444.90Rho GDP dissociation inhibitor (GDI) alpha [Source... [more]
Arhgdia2.090e-5444.90Rho GDP dissociation inhibitor (GDI) alpha [Source... [more]
Arhgdib5.068e-5145.64Rho, GDP dissociation inhibitor (GDI) beta [Source... [more]
Arhgdib5.068e-5145.64Rho, GDP dissociation inhibitor (GDI) beta [Source... [more]
Arhgdib5.068e-5145.64Rho, GDP dissociation inhibitor (GDI) beta [Source... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XI73|GDIR1_RAT1.462e-5344.90Rho GDP-dissociation inhibitor 1 OS=Rattus norvegi... [more]
sp|Q99PT1|GDIR1_MOUSE1.462e-5344.90Rho GDP-dissociation inhibitor 1 OS=Mus musculus O... [more]
sp|P19803|GDIR1_BOVIN2.251e-5344.39Rho GDP-dissociation inhibitor 1 OS=Bos taurus OX=... [more]
sp|Q4R4J0|GDIR1_MACFA3.112e-5344.90Rho GDP-dissociation inhibitor 1 OS=Macaca fascicu... [more]
sp|P52565|GDIR1_HUMAN3.112e-5344.90Rho GDP-dissociation inhibitor 1 OS=Homo sapiens O... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FM403.642e-6353.37Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A232F7473.829e-6251.83Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
A0A1I8HCX15.488e-6253.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1QCM07.014e-6250.00Rho GDP-dissociation inhibitor 1 OS=Crassostrea gi... [more]
A0A267FS277.316e-6253.27Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
arhgdig4.989e-5443.72rho GDP-dissociation inhibitor 2 [Source:NCBI gene... [more]
arhgdia3.337e-5345.45Rho GDP dissociation inhibitor alpha [Source:NCBI ... [more]
arhgdig5.276e-5347.59rho GDP-dissociation inhibitor 2 [Source:NCBI gene... [more]
arhgdig8.180e-3949.64rho GDP-dissociation inhibitor 2 [Source:NCBI gene... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RDI12.482e-3238.92Rho GDP dissociation inhibitor; involved in the lo... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO368311.476e-5650.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ARHGDIA2.745e-5244.51rho GDP-dissociation inhibitor 1 [Source:NCBI gene... [more]
arhgdia1.247e-5146.07rho GDP-dissociation inhibitor 1 [Source:NCBI gene... [more]
arhgdig1.988e-4537.74rho GDP-dissociation inhibitor 2 [Source:NCBI gene... [more]
arhgdig3.492e-4539.00rho GDP-dissociation inhibitor 2 [Source:NCBI gene... [more]
back to top
BLAST of Rho GDP-dissociation inhibitor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021482.16.125e-142100.00SMESG000021482.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017501 ID=SMED30017501|Name=Rho GDP-dissociation inhibitor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=947bp
GTTTGTTTAAAATAAATTGTAAATAAATAAACTTCCTAAATTATTTGTAC
ATTAAAATATTTATTTTTTGAATTATGGCAGAACGCGATAACGATCTTGA
ATATGAAAATCCAGTTGGATACAAAGCTCCAGAAAAGAAAACTTTAGAAG
ACATAGTTAAAATGGATCAAGAAGACGAAAGTTTACAGAAATATAAAGCT
GCATTATTGGGAAGTAATCCGTCTGACATTAAACCTCCTTATCCTAATGA
TCCAAGGAACGTCATTGTTCAAAAATTAGCTATATGCCCAGTCGGACGAC
CAGACATCGAAATTGATTTAATGGGTGATGTTTCAAACCTTACTAAATCG
CCTATTGTTATTAAAGAAGGAACAAAATATTTTGTTAAAATTTATTTTTT
TATACAACGAGAATTAGTTAGTGGTCTCAGATACCTAATGGCGTCTTACC
GATTGAAAATTCGAGTCGATAAAGATACGATAATGCTCGGAAGCTATGCT
CCTAAAGCCGAAGCACATTCTTATAAAAGCAGTGAAGAAGAAGCTCCAAC
TGGTGCTCTAACAAGGGGAACTTATATCATTAAAAGCAAATTTACAGATG
ATGATAACAATGATTATTTAAGCTGGAATTGGGCTATAGATATTAAAAAA
GATTGGGAATAATTTCATGAATGGAAATTAATTATCTGTTTGCTTAACAT
TTATAACTTTGCTATATATTTATAAATTTTTTGTAATTAAATGATTTTTA
AAGACCGAGACAACCAAATGGTTTGATAAATTTGAGTATTTTTTTAATGA
AAACAAAAAATATTTAGTATGACATTATTTTGGTTTTTATTCGTTTGTGT
GCATGCGTGATTATGATAATTATGTCAATTTTAAATAAATTTTTATATTG
TAATTTTCTTGACATTAGTAAATATATATTAATTATAATAGATCGGA
back to top

protein sequence of SMED30017501-orf-1

>SMED30017501-orf-1 ID=SMED30017501-orf-1|Name=SMED30017501-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MAERDNDLEYENPVGYKAPEKKTLEDIVKMDQEDESLQKYKAALLGSNPS
DIKPPYPNDPRNVIVQKLAICPVGRPDIEIDLMGDVSNLTKSPIVIKEGT
KYFVKIYFFIQRELVSGLRYLMASYRLKIRVDKDTIMLGSYAPKAEAHSY
KSSEEEAPTGALTRGTYIIKSKFTDDDNNDYLSWNWAIDIKKDWE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000406Rho_GDI
IPR024792RhoGDI_dom_sf
IPR014756Ig_E-set
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0005094Rho GDP-dissociation inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0050790regulation of catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000406Rho protein GDP-dissociation inhibitorPRINTSPR00492RHOGDIcoord: 68..86
score: 28.07
coord: 173..190
score: 57.41
coord: 131..146
score: 58.33
coord: 114..130
score: 42.16
coord: 147..159
score: 32.05
IPR000406Rho protein GDP-dissociation inhibitorPFAMPF02115Rho_GDIcoord: 5..193
e-value: 6.2E-60
score: 202.3
IPR000406Rho protein GDP-dissociation inhibitorPANTHERPTHR10980RHO GDP-DISSOCIATION INHIBITORcoord: 7..195
IPR024792Rho GDP-dissociation inhibitor domain superfamilyGENE3DG3DSA:2.70.50.30coord: 13..195
e-value: 7.0E-66
score: 223.5
NoneNo IPR availablePANTHERPTHR10980:SF8RHO GDP-DISSOCIATION INHIBITOR 3coord: 7..195
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 4..195