tyramine beta-hydroxilase

Overview
Nametyramine beta-hydroxilase (AFD34360.1)
Smed IDSMED30017498
Length (bp)1760
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tyramine beta-hydroxilase (SMED30017498) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tyramine beta-hydroxilase (SMED30017498) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017498

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017498SMESG000005292.1 SmedASXL_008729SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017498SMESG000005292.1 dd_Smed_v4_42610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30017498SMESG000005292.1 dd_Smed_v6_80459_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017498SMESG000005292.1 dd_Smed_v6_42610_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
octopaminergic neuronSMED30017498SMESG000005292.1 JN400361.1smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30017498SMESG000005292.1 Contig51395newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30017498SMESG000005292.1 Contig51395uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30017498SMESG000005292.1 JN400361.1smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
reproductive organSMED30017498SMESG000005292.1 Contig31652newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017498SMESG000005292.1 Contig31652uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tyramine beta-hydroxilase vs. Ensembl Human
Match: DBH (dopamine beta-hydroxylase [Source:HGNC Symbol;Acc:HGNC:2689])

HSP 1 Score: 395.971 bits (1016), Expect = 3.076e-130
Identity = 222/569 (39.02%), Postives = 328/569 (57.64%), Query Frame = 3
Query:   27 VYRTEIMRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGF--DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGND-VKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVF-------------ENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWN 1682
            +Y T +  + L+ +   L+       P  YH      EG  ++ W+V    E I  +L  ++L     F      G SD G+LEN+DL V+       +  D  +++ G+I  D +QDY L       E      +R   TCD  DY I+ GT +++   L+        ++   L   +  +QLL+  IP  E+     +ME+    I+IP+ +TTYWC + +LP    +HHIIKYE +++  ++ +VHHME+F C  +P  D V  F+GPC+S+ KP  L  CR V+AAWA+GA AF YPE+ G   GG   S Y  LE+H++N    +G  D+SG+RL+YT KLR+++AGI+ELGL YT    IPP++ +F L+GYC++KC++ ALP +GI++F SQLHTHLTG +V T   R  RE + +N+D HY PH+QEIR+L K+V+V PGD+L+T+C Y T +R   T GG  I +EMC+NY+ YYP+ +LELCKS+V D  F             E++      +  + F  V W+  N  +L+  Y  AP+   CN S +  F+G+WN
Sbjct:   21 MYSTAVA-IFLVILVAALQGSAPRESPLPYHIPLD-PEGSLELSWNVSYTQEAIHFQLLVRRLKAGVLF------GMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQC--APEMDSVPHFSGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYPQTQLELCKSAV-DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWN 578          
BLAST of tyramine beta-hydroxilase vs. Ensembl Human
Match: MOXD1 (monooxygenase DBH like 1 [Source:HGNC Symbol;Acc:HGNC:21063])

HSP 1 Score: 269.626 bits (688), Expect = 1.030e-81
Identity = 177/564 (31.38%), Postives = 276/564 (48.94%), Query Frame = 3
Query:  117 HATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNII-IFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCS---EKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVV----FENLPE---------------KEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLE 1727
            H T   +EG Y + WS   +  +I  +L      Q     + G GFS  G + ++D+ V  V   +    D  TN    + KD +QDY L+  + N         R+++TCD ND  I   T  +I  +  ++      + H    N     L+LL         +      ++    + IP   TTYWC++ ++P   +KHH+IK E VI    + +VHH+ L+ C  +  + V      C   + P     C  VI AWA+G   F+YP  VG  +G      Y +LE+H++N   ++G+IDNSGLRLFYT  +R+YDAG+IE GL  +  + IPP    F   G+C+    + + +A   +GI+VF   LH HL G  +  RHFRK +E+K L  D  +  ++QE + L +   +LPGD L+T C Y T +R E+T+GG+    EMCL+Y+ YYP+I L  C +S+ D++    F  + E               K+++N  F +  N+  W+ K      +     PV+  C+ +D+  +       + P +E R Y  E
Sbjct:   27 HRTLLDSEGKYWLGWSQRGS--QIAFRL------QVRTAGYVGFGFSPTGAMASADIVVGGVAHGRPYLQDYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDS--NRGTKSLRLLNPEKTSVLSTALPY-FDLVNQDVPIPNKDTTYWCQMFKIPVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRC-ASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTALPPDIE-RPYKAE 577          
BLAST of tyramine beta-hydroxilase vs. Ensembl Human
Match: MOXD1 (monooxygenase DBH like 1 [Source:HGNC Symbol;Acc:HGNC:21063])

HSP 1 Score: 259.225 bits (661), Expect = 1.969e-78
Identity = 159/494 (32.19%), Postives = 247/494 (50.00%), Query Frame = 3
Query:  321 DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNII-IFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCS---EKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVV----FENLPE---------------KEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLE 1727
            D  TN    + KD +QDY L+  + N         R+++TCD ND  I   T  +I  +  ++      + H    N     L+LL         +      ++    + IP   TTYWC++ ++P   +KHH+IK E VI    + +VHH+ L+ C  +  + V      C   + P     C  VI AWA+G   F+YP  VG  +G      Y +LE+H++N   ++G+IDNSGLRLFYT  +R+YDAG+IE GL  +  + IPP    F   G+C+    + + +A   +GI+VF   LH HL G  +  RHFRK +E+K L  D  +  ++QE + L +   +LPGD L+T C Y T +R E+T+GG+    EMCL+Y+ YYP+I L  C +S+ D++    F  + E               K+++N  F +  N+  W+ K      +     PV+  C+ +D+  +       + P +E R Y  E
Sbjct:   21 DYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDS--NRGTKSLRLLNPEKTSVLSTALPY-FDLVNQDVPIPNKDTTYWCQMFKIPVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRC-ASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTALPPDIE-RPYKAE 509          
BLAST of tyramine beta-hydroxilase vs. Ensembl Human
Match: DBH (dopamine beta-hydroxylase [Source:HGNC Symbol;Acc:HGNC:2689])

HSP 1 Score: 105.916 bits (263), Expect = 5.928e-25
Identity = 83/294 (28.23%), Postives = 130/294 (44.22%), Query Frame = 3
Query:   27 VYRTEIMRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGND-VKRFNGPCNSESKPMGLTMCRKVIAAWAMGA 902
            +Y T +  + L+ +   L+       P  YH      EG  ++ W+V    E I  +L  ++L     F      G SD G+LEN+DL V+                                                 D +      GT +++   L+        ++   L   +  +QLL+  IP  E+     +ME+    I+IP+ +TTYWC + +LP    +HHIIKYE +++  ++ +VHHME+F C  +P  D V  F+GPC+S+ KP  L  CR V+AAWA+GA
Sbjct:   19 MYSTAVA-IFLVILVAALQGSAPRESPLPYHIPLD-PEGSLELSWNVSYTQEAIHFQLLVRRLKAGVLF------GMSDRGELENADLVVL-----------------------------------------------WTDGDTAYFADGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQC--APEMDSVPHFSGPCDSKMKPDRLNYCRHVLAAWALGA 255          
BLAST of tyramine beta-hydroxilase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 86.2705 bits (212), Expect = 5.650e-17
Identity = 81/304 (26.64%), Postives = 132/304 (43.42%), Query Frame = 3
Query:  651 PASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRF--NGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNN----QDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPK----IELELCKSSVSDVVFENLP 1532
            P    TY+C  +++P +D++  +I ++      S   VHHM LF C          F   G C  ++          ++ AWA  AP    P+ VG  +GGE  S Y +L++H+ +    +D  K   D SG+ L  T   +   AG+    L  +    IP  +K           C  +  P   ++VF  ++HTH  G +V + +  ++ +   + R     P  Q    +   V+V  GD+L   C++    RTE T  G   +DEMC  YI YY +    +    C  +V+  +F  +P
Sbjct:   68 PKQSDTYFCMSMRIP-VDEEAFVIDFKP---RASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKAN---------ILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNK---DCSGVSLHLTRLPQPLIAGMY---LMMSVDTVIPAGEKVVN----SDISCHYKNYP---MHVFAYRVHTHHLG-KVVSGYRVRNGQWTLIGRQSPQLP--QAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIP 342          
BLAST of tyramine beta-hydroxilase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 325.094 bits (832), Expect = 1.146e-103
Identity = 189/546 (34.62%), Postives = 298/546 (54.58%), Query Frame = 3
Query:  228 FPIWSG--------IGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLL----KDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVL----LQLLXXXXXXXXXXXXXXXMEITVNYI--------EIPASQTTYWCKVIQLPY--LDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSD----VVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPV---HQSCNMSDSDSFEGD-------WNAIITPILETRDYDLEKQSFEC 1745
            F IW G        +GFSD G   NSD+ +    K    D +TN+  +I  D +QD+ L    KD+I+        ++RK+ TCD  DY    GTT   I +     N+     VD  +   V+     +++        I     ++E  V  +         IP  +TTY C + ++P+  ++  +H+++ E  ++  ++ +VHHME+F C     ++V+ ++G CN   KP     C  VIAAWAMG     YP++ G PIGG+  + Y ++EIH+NN +  KG+ID+SG + F T +LR+YDAGI+ELGL Y++ N +PP QK++A++GYC  +C++  LP  GI +F SQLH HLTG ++ T  +R    +  +NRD+HY PH+Q ++ L  +V V+PGD LVTTC+Y T  R++VTFGG  I DEMC+NYI+YYP  ++E+CKS++S+      F      + +  + +    N  D  + + E FY+   V   + +C  S+ + FE +       W  +  P   +  +   +  F+C
Sbjct:   48 FSIWFGASTPDVLFLGFSDFGDTNNSDVLMYYNSKKEIKDAYTNRDFKITSDLQQDFQLLRKRKDHIV--------VRRKLTTCDSRDYAFLPGTTQFYIAASWGSTNL-----VDIRDKRWVVDKKFGKVIEGPTDQPNIEEEPAALEKDVKVVIVNSNSPDPIPNVETTYKCIIRKMPFDTVNNMYHVVRMEPYVTPGNEHLVHHMEIFMC----RDEVEEWSGSCNDPKKPPKSKSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHKGVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKN-LPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYYPASDVEVCKSAISNSTLRAYFSERHGMDGKRMQISDMYSNVKDWGNGVDEEFYNVLNVGNMNMNCLKSNGEPFEFESKDSRQSWENMARPTFVSGSFITTRDRFQC 575          
BLAST of tyramine beta-hydroxilase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 325.865 bits (834), Expect = 1.294e-103
Identity = 189/546 (34.62%), Postives = 298/546 (54.58%), Query Frame = 3
Query:  228 FPIWSG--------IGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLL----KDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVL----LQLLXXXXXXXXXXXXXXXMEITVNYI--------EIPASQTTYWCKVIQLPY--LDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSD----VVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPV---HQSCNMSDSDSFEGD-------WNAIITPILETRDYDLEKQSFEC 1745
            F IW G        +GFSD G   NSD+ +    K    D +TN+  +I  D +QD+ L    KD+I+        ++RK+ TCD  DY    GTT   I +     N+     VD  +   V+     +++        I     ++E  V  +         IP  +TTY C + ++P+  ++  +H+++ E  ++  ++ +VHHME+F C     ++V+ ++G CN   KP     C  VIAAWAMG     YP++ G PIGG+  + Y ++EIH+NN +  KG+ID+SG + F T +LR+YDAGI+ELGL Y++ N +PP QK++A++GYC  +C++  LP  GI +F SQLH HLTG ++ T  +R    +  +NRD+HY PH+Q ++ L  +V V+PGD LVTTC+Y T  R++VTFGG  I DEMC+NYI+YYP  ++E+CKS++S+      F      + +  + +    N  D  + + E FY+   V   + +C  S+ + FE +       W  +  P   +  +   +  F+C
Sbjct:   69 FSIWFGASTPDVLFLGFSDFGDTNNSDVLMYYNSKKEIKDAYTNRDFKITSDLQQDFQLLRKRKDHIV--------VRRKLTTCDSRDYAFLPGTTQFYIAASWGSTNL-----VDIRDKRWVVDKKFGKVIEGPTDQPNIEEEPAALEKDVKVVIVNSNSPDPIPNVETTYKCIIRKMPFDTVNNMYHVVRMEPYVTPGNEHLVHHMEIFMC----RDEVEEWSGSCNDPKKPPKSKSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHKGVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKN-LPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYYPASDVEVCKSAISNSTLRAYFSERHGMDGKRMQISDMYSNVKDWGNGVDEEFYNVLNVGNMNMNCLKSNGEPFEFESKDSRQSWENMARPTFVSGSFITTRDRFQC 596          
BLAST of tyramine beta-hydroxilase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 325.479 bits (833), Expect = 5.361e-103
Identity = 189/546 (34.62%), Postives = 298/546 (54.58%), Query Frame = 3
Query:  228 FPIWSG--------IGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLL----KDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVL----LQLLXXXXXXXXXXXXXXXMEITVNYI--------EIPASQTTYWCKVIQLPY--LDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSD----VVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPV---HQSCNMSDSDSFEGD-------WNAIITPILETRDYDLEKQSFEC 1745
            F IW G        +GFSD G   NSD+ +    K    D +TN+  +I  D +QD+ L    KD+I+        ++RK+ TCD  DY    GTT   I +     N+     VD  +   V+     +++        I     ++E  V  +         IP  +TTY C + ++P+  ++  +H+++ E  ++  ++ +VHHME+F C     ++V+ ++G CN   KP     C  VIAAWAMG     YP++ G PIGG+  + Y ++EIH+NN +  KG+ID+SG + F T +LR+YDAGI+ELGL Y++ N +PP QK++A++GYC  +C++  LP  GI +F SQLH HLTG ++ T  +R    +  +NRD+HY PH+Q ++ L  +V V+PGD LVTTC+Y T  R++VTFGG  I DEMC+NYI+YYP  ++E+CKS++S+      F      + +  + +    N  D  + + E FY+   V   + +C  S+ + FE +       W  +  P   +  +   +  F+C
Sbjct:  120 FSIWFGASTPDVLFLGFSDFGDTNNSDVLMYYNSKKEIKDAYTNRDFKITSDLQQDFQLLRKRKDHIV--------VRRKLTTCDSRDYAFLPGTTQFYIAASWGSTNL-----VDIRDKRWVVDKKFGKVIEGPTDQPNIEEEPAALEKDVKVVIVNSNSPDPIPNVETTYKCIIRKMPFDTVNNMYHVVRMEPYVTPGNEHLVHHMEIFMC----RDEVEEWSGSCNDPKKPPKSKSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHKGVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKN-LPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYYPASDVEVCKSAISNSTLRAYFSERHGMDGKRMQISDMYSNVKDWGNGVDEEFYNVLNVGNMNMNCLKSNGEPFEFESKDSRQSWENMARPTFVSGSFITTRDRFQC 647          
BLAST of tyramine beta-hydroxilase vs. Ensembl Celegans
Match: pghm-1 (Probable peptidylglycine alpha-hydroxylating monooxygenase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95XM2])

HSP 1 Score: 73.1738 bits (178), Expect = 6.629e-14
Identity = 66/283 (23.32%), Postives = 128/283 (45.23%), Query Frame = 3
Query:  666 TYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGND-----VKRFNGPCNSESKPMGLTMCRK--VIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVE---TRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIEL 1484
            +Y C  ++L   D+++++  ++A+   T++G  HH+ LF C   PG+D         N P   +  P   T   K  ++ AWA+ AP    P+ VG  +GG++   + ++++H+ +  ++    D +GL + +T++ +   A  +   L  T       K +SF  +    E           ++ F  + HTH  G +V     +  +KH +   L   +  Q     + +  + + +  GD++   CI +     +++ G  E  DEMC  YI Y+   E+
Sbjct:   38 SYLCTSLELS--DQENYLTGFKAL---TTKGTAHHILLFGC-EEPGSDELVWDCGEMNKP--DDEMPRAPTCGSKPAILYAWALDAPPLELPQDVGFRVGGDSNIRHLVMQVHYMHSKQEP---DETGLEITHTEEPQPKLAATM---LLVTGGTLPRNKTESFETACMIEEDVV--------MHPFAYRTHTHRHGKEVSGWLVKEDQKHEDHWKLIGRRDPQLAQMFVPVEDQAMTIQQGDMVTARCILQNNENRDISMGATE-EDEMCNFYIMYWTDGEV 297          
BLAST of tyramine beta-hydroxilase vs. Ensembl Fly
Match: Tbh (gene:FBgn0010329 transcript:FBtr0089999)

HSP 1 Score: 373.244 bits (957), Expect = 5.042e-121
Identity = 212/544 (38.97%), Postives = 302/544 (55.51%), Query Frame = 3
Query:  153 IYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDL-FVVNRLKFLGF--DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFL-------NYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPY-LDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFEN----LPEKEFRNF-------KETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEG--DWNAIITPILETR 1712
            + W V+   +++   L    N+Q     W  +GFS  G L ++D+ F  N+  F     D +T+  G+ +   R+DY     +   ++F    +RK +TCD  D ++  GT  ++    + +  +  E H   L          V +LQLLR+   +   +     MEIT+    IP+ +TTYWC V +L   L ++HHI+++E +I   + GIVHHME+FHC      ++  +NG C  E  P    +C KV+  WAMGA  FTYP + G PIGG  F+ Y  LE+HFNN +++ G++DNSG R+  +  LRQYDA ++ELGLEYT+K  IPP Q +F LSGYC   C+R ALPA GI +FGSQLHTHL G++V TRHFR  +EL+ +NRD +Y  H+QE+R L     VLPGD LVTTC Y T +      GG  I+DEMC+NYI YYP  +LE+CKSSVS+   EN    +   E ++           +  + W+      L   Y + P+   CN SD   FEG   W  +    ++ R
Sbjct:  108 LSWMVDWYKQEVLFHLQNAFNEQHR---WFYLGFSKRGGLADADICFFENQNGFFNAVTDTYTSPDGQWV---RRDYQQDCEVFKMDEFTLAFRRKFDTCDPLDLRLHEGTMYVVW--ARGETELALEDHQFALPNVTAPHEAGVKMLQLLRADKILIPETELDH-MEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIR--TPGIVHHMEVFHCEAGEHEEIPLYNGDC--EQLPPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFRGEQELREVNRDDYYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARSSNYRSIEWTQPRIDQLYTMYMQEPLSMQCNRSDGTRFEGRSSWEGVAATPVQIR 638          
BLAST of tyramine beta-hydroxilase vs. Ensembl Fly
Match: Tbh (gene:FBgn0010329 transcript:FBtr0340409)

HSP 1 Score: 373.244 bits (957), Expect = 5.042e-121
Identity = 212/544 (38.97%), Postives = 302/544 (55.51%), Query Frame = 3
Query:  153 IYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDL-FVVNRLKFLGF--DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFL-------NYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPY-LDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFEN----LPEKEFRNF-------KETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEG--DWNAIITPILETR 1712
            + W V+   +++   L    N+Q     W  +GFS  G L ++D+ F  N+  F     D +T+  G+ +   R+DY     +   ++F    +RK +TCD  D ++  GT  ++    + +  +  E H   L          V +LQLLR+   +   +     MEIT+    IP+ +TTYWC V +L   L ++HHI+++E +I   + GIVHHME+FHC      ++  +NG C  E  P    +C KV+  WAMGA  FTYP + G PIGG  F+ Y  LE+HFNN +++ G++DNSG R+  +  LRQYDA ++ELGLEYT+K  IPP Q +F LSGYC   C+R ALPA GI +FGSQLHTHL G++V TRHFR  +EL+ +NRD +Y  H+QE+R L     VLPGD LVTTC Y T +      GG  I+DEMC+NYI YYP  +LE+CKSSVS+   EN    +   E ++           +  + W+      L   Y + P+   CN SD   FEG   W  +    ++ R
Sbjct:  108 LSWMVDWYKQEVLFHLQNAFNEQHR---WFYLGFSKRGGLADADICFFENQNGFFNAVTDTYTSPDGQWV---RRDYQQDCEVFKMDEFTLAFRRKFDTCDPLDLRLHEGTMYVVW--ARGETELALEDHQFALPNVTAPHEAGVKMLQLLRADKILIPETELDH-MEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIR--TPGIVHHMEVFHCEAGEHEEIPLYNGDC--EQLPPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFRGEQELREVNRDDYYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARSSNYRSIEWTQPRIDQLYTMYMQEPLSMQCNRSDGTRFEGRSSWEGVAATPVQIR 638          
BLAST of tyramine beta-hydroxilase vs. Ensembl Fly
Match: CG5235 (gene:FBgn0036565 transcript:FBtr0333599)

HSP 1 Score: 248.054 bits (632), Expect = 4.088e-73
Identity = 158/487 (32.44%), Postives = 236/487 (48.46%), Query Frame = 3
Query:  114 YHATYSRTE-----GVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLG----FDLHTNKY---GRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXX-XXXXXXXXXXXXMEITVNYIEIPASQTT-YWCKVIQLPYLDKKHHIIKYEAVISAT-SQGIVHHMELFHCIRS--PGND-------VKRFNGPCNSES-KPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS 1499
            +H  + R E     G+Y + W +  N   I  ++            ++G+GFS  G+L  +D+ ++      G     D H   +   G  ++D+ Q+Y + D   N        +RK+ TCD  D  +   T  ++ +S+     ++  L     +  V  LQL        S      +  +ITVN + I  S  T YWCK+++LP L  K HII YE ++S    + +VHHM LF C      G+D       V+     CNS    P     C   +A W++G+     P   G P+GG +  +Y +LEIH++N D K+ + D+SG R+ YT  LR YD+GI+  G+  +E   IPP QK +   G C   CS    P +GI +    LH+H  G  +  RH R  +EL P+  D++Y   +Q++  L     VLPGD L+T C Y+T  R   TFGG    +EMCL +I YYPKIE+  C S
Sbjct:   40 HHKNWVRNEMMDSLGLYWLKWWINANENSIYFEVTVHTRG------FAGLGFSKDGRLARADMVLMWVDDATGHPNVLDCHGALHPSSGPPLQDDTQNYDVLDGKQNGTHTILKFKRKIETCDPFDIPLSADTFKVL-WSIGENDPIHGNLDWQGQSRGVKALQLFSPMFTKNSHSIEGIQKWDITVNNVTIDRSMDTLYWCKIVRLPELTGKQHIIGYEPLLSGKYERNVVHHMTLFECQSKIYSGSDPSSWDLWVRSAGTVCNSNLLTPRDWDSCSTPVAVWSLGSDGQFLPPHAGIPMGGASGVSYYMLEIHYDNPDGKESV-DHSGFRIHYTPNLRTYDSGILISGVSISETQLIPPGQKKYRSVGICGPSCSSVMFPKDGIKIISGTLHSHQAGRTISLRHVRSGKELNPIIVDENYDYRHQKVHQLANETVVLPGDYLITDCSYETKYRKRPTFGGYSTKEEMCLTFITYYPKIEMSGCYS 518          
BLAST of tyramine beta-hydroxilase vs. Ensembl Fly
Match: CG5235 (gene:FBgn0036565 transcript:FBtr0075497)

HSP 1 Score: 248.054 bits (632), Expect = 4.088e-73
Identity = 158/487 (32.44%), Postives = 236/487 (48.46%), Query Frame = 3
Query:  114 YHATYSRTE-----GVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLG----FDLHTNKY---GRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXX-XXXXXXXXXXXXMEITVNYIEIPASQTT-YWCKVIQLPYLDKKHHIIKYEAVISAT-SQGIVHHMELFHCIRS--PGND-------VKRFNGPCNSES-KPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS 1499
            +H  + R E     G+Y + W +  N   I  ++            ++G+GFS  G+L  +D+ ++      G     D H   +   G  ++D+ Q+Y + D   N        +RK+ TCD  D  +   T  ++ +S+     ++  L     +  V  LQL        S      +  +ITVN + I  S  T YWCK+++LP L  K HII YE ++S    + +VHHM LF C      G+D       V+     CNS    P     C   +A W++G+     P   G P+GG +  +Y +LEIH++N D K+ + D+SG R+ YT  LR YD+GI+  G+  +E   IPP QK +   G C   CS    P +GI +    LH+H  G  +  RH R  +EL P+  D++Y   +Q++  L     VLPGD L+T C Y+T  R   TFGG    +EMCL +I YYPKIE+  C S
Sbjct:   40 HHKNWVRNEMMDSLGLYWLKWWINANENSIYFEVTVHTRG------FAGLGFSKDGRLARADMVLMWVDDATGHPNVLDCHGALHPSSGPPLQDDTQNYDVLDGKQNGTHTILKFKRKIETCDPFDIPLSADTFKVL-WSIGENDPIHGNLDWQGQSRGVKALQLFSPMFTKNSHSIEGIQKWDITVNNVTIDRSMDTLYWCKIVRLPELTGKQHIIGYEPLLSGKYERNVVHHMTLFECQSKIYSGSDPSSWDLWVRSAGTVCNSNLLTPRDWDSCSTPVAVWSLGSDGQFLPPHAGIPMGGASGVSYYMLEIHYDNPDGKESV-DHSGFRIHYTPNLRTYDSGILISGVSISETQLIPPGQKKYRSVGICGPSCSSVMFPKDGIKIISGTLHSHQAGRTISLRHVRSGKELNPIIVDENYDYRHQKVHQLANETVVLPGDYLITDCSYETKYRKRPTFGGYSTKEEMCLTFITYYPKIEMSGCYS 518          
BLAST of tyramine beta-hydroxilase vs. Ensembl Fly
Match: olf413 (gene:FBgn0037153 transcript:FBtr0333219)

HSP 1 Score: 213.772 bits (543), Expect = 4.449e-60
Identity = 140/466 (30.04%), Postives = 235/466 (50.43%), Query Frame = 3
Query:  198 LCQKLNKQFSFPI------WSGIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYG--RIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKN-DYQIDRGTTNII-IFSLKNKQNMNNELHV--DFLNYF-----VVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTT-YWCKVIQLPYLDKKHHIIKYEAVI-SATSQGIVHHMELFHCIRSPGN--DVKRFNG-PC-NSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNN------QDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPK-IELELCKS 1499
            L Q +N+  +F I      + G GFS  G L  +D+ +  V++ +    D H  + G    + D  QDY+L     N        +RK++TCD + D  I   T  ++ ++  ++  + +       D    F     +VL+Q  +  +P        R +E+    +E+PA     +WCK+ +L  +++KHH+I+YE +  S++S   + H+ L  C  +     ++ R  G PC  + S P+    C  ++A+W+ G+  FTYP + G PI     + Y ++E H+NN      Q   + + DNSGL++++T  LR  DAG + +G++   ++ IPP QK     G C E C+  A P  GI +F   + TH  G +V+ R  R+  EL P+  D +    YQ+ R LP+ V+ +PGD L+  CIY +++R  +T GG+ + +E C     YYP+  +L  C S
Sbjct:  122 LWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPPHGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAHAELEEMAREQGRPCLGARSIPLA---CNAIVASWSRGSEGFTYPHEAGYPIESRQ-AKYYLMETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHS 583          
BLAST of tyramine beta-hydroxilase vs. Ensembl Zebrafish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 385.956 bits (990), Expect = 1.555e-126
Identity = 208/523 (39.77%), Postives = 308/523 (58.89%), Query Frame = 3
Query:  246 IGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGND-VKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFE---------------NLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRR 1757
            +G SD G+  N+DL ++       + G D  ++  GR+  D +QDY L +   + E F    +R  +TCD +DY I+ GT +II   L++     +EL++  L   V  + LLR   P   +    R++E+    + IP  +TTYWC + QLP    K+HI+ YE+VI+  ++ IVHH+E+F C  SP  D V +++G C+S+ KP  L  CR V+AAWAMGA  F YP   G P+GGE  S +  LE+H++N     G  D+SG+RL+Y+  LR++DAGI+ELGL YT    IPP+Q+SF L+GYC+ KC++ ALP  GI++F SQLHTHL G+ V T   R  +E++ +  DKH+  HYQ IR+L K+V VLPGD L+TTC + T +R++VT GG  I +EMC+NY+ YYP+ +LELCKS V     +               + P+    + +E F+ V+W   + ++L   Y  AP    CN S +  F GDW     P++  +   L++  + C + R
Sbjct:   83 LGMSDRGEPTNADLVILWDDGHKSYFG-DAWSDSEGRVTLDTQQDYQLLETHQSTEGFFLLFKRSFSTCDPHDYIIEEGTVHIIYAMLEHPILSLHELNISRLQPGVQRVLLLRPDTPSPHLPKDVRTLEVLAPDVIIPTQETTYWCHIYQLPPNLPKNHIVMYESVITPGNEAIVHHIEVFEC--SPQMDIVPQYSGSCDSKMKPRNLNYCRHVLAAWAMGAEPFYYPADAGLPMGGEGSSRFLRLEVHYHNPLLLSGRRDSSGIRLWYSPSLRRFDAGIMELGLVYTPVMAIPPRQRSFQLTGYCTAKCTQTALPVGGIHIFASQLHTHLAGLGVRTVLVRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTVLPGDALLTTCRFNTEDRSKVTVGGFGIMEEMCVNYVHYYPRTQLELCKSHVDTDYLQKYFSLINRFQGRESCSCPQT---SVEEQFSSVSWDSFSGEVLNSLYVTAPFSMHCNQSTAQLFPGDWEKQEIPVVTAQ---LQRAPYPCEINR 596          
BLAST of tyramine beta-hydroxilase vs. Ensembl Zebrafish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 385.956 bits (990), Expect = 1.694e-126
Identity = 208/523 (39.77%), Postives = 308/523 (58.89%), Query Frame = 3
Query:  246 IGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGND-VKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFE---------------NLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRR 1757
            +G SD G+  N+DL ++       + G D  ++  GR+  D +QDY L +   + E F    +R  +TCD +DY I+ GT +II   L++     +EL++  L   V  + LLR   P   +    R++E+    + IP  +TTYWC + QLP    K+HI+ YE+VI+  ++ IVHH+E+F C  SP  D V +++G C+S+ KP  L  CR V+AAWAMGA  F YP   G P+GGE  S +  LE+H++N     G  D+SG+RL+Y+  LR++DAGI+ELGL YT    IPP+Q+SF L+GYC+ KC++ ALP  GI++F SQLHTHL G+ V T   R  +E++ +  DKH+  HYQ IR+L K+V VLPGD L+TTC + T +R++VT GG  I +EMC+NY+ YYP+ +LELCKS V     +               + P+    + +E F+ V+W   + ++L   Y  AP    CN S +  F GDW     P++  +   L++  + C + R
Sbjct:   83 LGMSDRGEPTNADLVILWDDGHKSYFG-DAWSDSEGRVTLDTQQDYQLLETHQSTEGFFLLFKRSFSTCDPHDYIIEEGTVHIIYTMLEHPILSLHELNISRLQPGVQRVLLLRPDTPSPHLPKDVRTLEVLAPDVIIPTQETTYWCHIYQLPPNLPKNHIVMYESVITPGNEAIVHHIEVFEC--SPQMDIVPQYSGSCDSKMKPRNLNYCRHVLAAWAMGAEPFYYPADAGLPMGGEGSSRFLRLEVHYHNPLLLSGRRDSSGIRLWYSPSLRRFDAGIMELGLVYTPVMAIPPRQRSFQLTGYCTAKCTQTALPVGGIHIFASQLHTHLAGLGVRTVLVRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTVLPGDALLTTCRFNTEDRSKVTVGGFGIMEEMCVNYVHYYPRTQLELCKSHVDTDYLQKYFSLINRFQGRESCSCPQT---SVEEQFSSVSWDSFSGEVLNSLYVTAPFSMHCNQSTAQLFPGDWEKQEIPVVTAQ---LQRAPYPCEINR 596          
BLAST of tyramine beta-hydroxilase vs. Ensembl Zebrafish
Match: moxd1 (monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:570584])

HSP 1 Score: 264.618 bits (675), Expect = 4.998e-80
Identity = 154/501 (30.74%), Postives = 250/501 (49.90%), Query Frame = 3
Query:  243 GIGFSDHGKLENSDLF---VVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS------------------SVSDVVFENLPEKEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSF 1667
            G G S  G + +SD+    V+N   +L  D  T+   ++ +D  Q+Y L     N         R + TCD ND +I  G+T  +I++   +    + L    +N     L+LL      S  + +    ++    + +P   TTYWC++ + P + KKHH+I+ E +I    + +VHH+ L+ C  +           C   + P     C  V+ AWA+G   FTYP  VG  IG      Y  LEIHF+N   + GI+D+SGLRL+Y+  LR+YDAG+IE G+  +  + +PP    +   G+C+++C +++L +   +G++VF   LH HL G  +  RHFR+  EL+PL  D  +  ++QE + L +   +LPGD L+T C Y T  R  +T+GG+   +EMCL+++ YYP++ L  C+S                   V+   F     K++ N  F E  ++  WS K  K       + P++  C+ +  D +
Sbjct:   63 GFGLSPTGAMSSSDIVIGGVLNGSPYL-LDYFTDSNRKVHRDPLQNYELLYGRENDTHTVLAFSRNLQTCDDND-KIITGSTVRVIWAFHTEDVGESGLVYHGMNRGRKSLRLLNPGTGSSIPAGTAF-FDLQNKEVPVPHKDTTYWCQIFRFPEMKKKHHVIRIEPLIQKGHENLVHHILLYQCDSNLNKSEVNRGHECYHPNMPDSFLTCETVLFAWAIGGEGFTYPPHVGMSIGTSIDPVYVQLEIHFDNPSLQGGIVDSSGLRLYYSPSLRRYDAGVIETGVWVSLYHMLPPGMTDYITEGHCTQECLQESLDSEMPSGVHVFAVLLHAHLAGRAITARHFRQQLELQPLASDDQFDFNFQEFQPLSQERLILPGDSLITECRYNTKGRMNMTWGGLSTREEMCLSFLLYYPRVNLAKCESLPEIAGQLKFIGVTEIQEPVTTWPFVIKSPKKYSNLSFTEAMDKYKWSMKKGKSFNDIVRKLPMNVRCSKTGQDEW 560          
BLAST of tyramine beta-hydroxilase vs. Ensembl Zebrafish
Match: moxd1 (monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:570584])

HSP 1 Score: 262.692 bits (670), Expect = 2.616e-79
Identity = 153/501 (30.54%), Postives = 250/501 (49.90%), Query Frame = 3
Query:  243 GIGFSDHGKLENSDLF---VVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS------------------SVSDVVFENLPEKEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSF 1667
            G G S  G + +SD+    V+N   +L  D  T+   ++ +D  Q+Y L     N         R + TCD ND +I  G+T  +I++   +    + L    +N     L+LL      S  + +    ++    + +P   TTYWC++ + P + KKHH+I+ E +I    + +VHH+ L+ C  +           C   + P     C  V+ AWA+G   FTYP  VG  IG      Y  LEIHF+N   + GI+D+SGLRL+Y+  LR+YDAG+IE G+  +  + +PP    +   G+C+++C +++L +   +G++VF   LH HL G  +  RHFR+  EL+PL  D  +  ++QE + L +   +LPGD L+T C Y T  R  +T+GG+   +EMCL+++ YYP++ L  C+S                   V+   F     K++ N  F E  ++  W+ K  K       + P++  C+ +  D +
Sbjct:   63 GFGLSPTGAMSSSDIVIGGVLNGSPYL-LDYFTDSNRKVHRDPLQNYELLYGRENDTHTVLAFSRNLQTCDDND-KIITGSTVRVIWAFHAEDVGESGLVYHGMNRGRKSLRLLNPGTGPSIPAGTAF-FDLQNKEVPVPHKDTTYWCQIFRFPEMKKKHHVIRIEPLIQKGHENLVHHILLYQCDSNLNKSEVNRGHECYHPNMPDSFLTCETVLFAWAIGGEGFTYPPHVGMSIGTSIDPVYVQLEIHFDNPSLQGGIVDSSGLRLYYSPSLRRYDAGVIETGVWVSLYHMLPPGMTDYITEGHCTQECLQESLDSEMPSGVHVFAVLLHAHLAGRAITARHFRQQLELQPLASDDQFDFNFQEFQPLSQERLILPGDSLITECRYNTKGRMNMTWGGLSTREEMCLSFLLYYPRVNLAKCESLPEIAGQLKFIGVTEIQEPVTTWPFVIKSPKKYSNLSFTEAMDKYKWTMKKGKSFNDIVRKLPMNVRCSKTGQDEW 560          
BLAST of tyramine beta-hydroxilase vs. Ensembl Zebrafish
Match: moxd1 (monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:570584])

HSP 1 Score: 261.922 bits (668), Expect = 4.962e-79
Identity = 154/498 (30.92%), Postives = 248/498 (49.80%), Query Frame = 3
Query:  243 GIGFSDHGKLENSDLF---VVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS------------------SVSDVVFENLPEKEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSF 1667
            G G S  G + +SD+    V+N   +L  D  T+   ++ +D  Q+Y L     N         R + TCD ND +I  G+T  +I++   +    + L    +N     L+LL      S  + +    ++    + +P   TTYWC++ + P + KKHH+I+ E +I    + +VHH+ L+ C  +           C   + P     C  V+ AWA+G   FTYP  VG  IG      Y  LEIHF+N   + GI+D+SGLRL+Y+  LR+YDAG+IE G+  +  + +PP    +   G+C+++C  Q +P+ G++VF   LH HL G  +  RHFR+  EL+PL  D  +  ++QE + L +   +LPGD L+T C Y T  R  +T+GG+   +EMCL+++ YYP++ L  C+S                   V+   F     K++ N  F E  ++  W+ K  K       + P++  C+ +  D +
Sbjct:   63 GFGLSPTGAMSSSDIVIGGVLNGSPYL-LDYFTDSNRKVHRDPLQNYELLYGRENDTHTVLAFSRNLQTCDDND-KIITGSTVRVIWAFHAEDVGESGLVYHGMNRGRKSLRLLNPGTGPSIPAGTAF-FDLQNKEVPVPHKDTTYWCQIFRFPEMKKKHHVIRIEPLIQKGHENLVHHILLYQCDSNLNKSEVNRGHECYHPNMPDSFLTCETVLFAWAIGGEGFTYPPHVGMSIGTSIDPVYVQLEIHFDNPSLQGGIVDSSGLRLYYSPSLRRYDAGVIETGVWVSLYHMLPPGMTDYITEGHCTQEC-LQEMPS-GVHVFAVLLHAHLAGRAITARHFRQQLELQPLASDDQFDFNFQEFQPLSQERLILPGDSLITECRYNTKGRMNMTWGGLSTREEMCLSFLLYYPRVNLAKCESLPEIAGQLKFIGVTEIQEPVTTWPFVIKSPKKYSNLSFTEAMDKYKWTMKKGKSFNDIVRKLPMNVRCSKTGQDEW 555          
BLAST of tyramine beta-hydroxilase vs. Ensembl Xenopus
Match: enc1.2 (ectodermal-neural cortex (with BTB-like domain), gene 2 [Source:Xenbase;Acc:XB-GENE-5914613])

HSP 1 Score: 397.512 bits (1020), Expect = 6.700e-131
Identity = 219/574 (38.15%), Postives = 327/574 (56.97%), Query Frame = 3
Query:   18 NLIVYRTEIMRLILLHVFIILKIVISYTKPYQYHATYS-----RTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV--NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFL-NYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFE------------NLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDW 1679
            NL +     +   +L VF+IL +        Q  +++        +G   +YW+V  + + +  ++   L K   F +    G SD G  E++D+ V+  N L     D  +++ G++  D +QDY L +   + E      +R   TCD  DY I+ GT ++I   L+   +  + + V  + N  +  +QLL+  +PI  +     +ME+    + IPA +TTYWC + +LP    KHHI+ YE VI+   + IVHH+E+F C  S    + R++GPC+S+ KP  L  CR V+AAWAMGA AF YPE+ G   GG + S Y  LE+H++N  E KG+ D+SG+RL+YT  LR+YDAGI+E+GL Y+    IPP QK F L+GYC++KC+ +ALP+NGI +F SQLHTHL G  V     R+ +E + +N D HY PH+QEIR+L K V+VLPGD++VT+C Y T +R  +T GG  ITDEMC+NY+ YYP+ +LELCKS V     +            ++         + F  V W+  ++ +L+  Y  AP+   CN S +  F G+W
Sbjct:   11 NLRIREVVPVYFTMLAVFMILLVASLQGPSRQQKSSFPYQVPLDPQGSLQLYWNVSYSEKVVYFRI---LIKDLKFGLI--FGMSDRGDFEDADMAVLWTNELGSFFGDAWSDQKGQLHMDSQQDYELLNAQQSQEGLYLLFRRPFATCDPKDYLIEDGTVHLIYALLEKPFSTLSSIDVSAIKNRGLQRVQLLKPDLPIPRLPADVLNMEVRAPQVLIPAKETTYWCHITELPKDFTKHHIVMYEPVITKGHEAIVHHIEVFQCA-SNYYTIPRYDGPCDSKMKPQSLNSCRHVLAAWAMGAKAFYYPEESGLAFGGPDSSRYLRLEVHYHNPLELKGLRDSSGIRLYYTSTLRRYDAGIMEVGLVYSPVMAIPPGQKDFLLTGYCTDKCTDRALPSNGIKIFASQLHTHLGGRGVPPILVREGKEAEVVNADGHYSPHFQEIRMLKKAVHVLPGDVMVTSCSYNTEDRKNITVGGFSITDEMCVNYVHYYPRTDLELCKSMVDPGYLQKYFHMVNRFNSDDVSTSPNTTVTKQFQEVPWNSFSAGVLKSLYSFAPISMHCNRSSAVRFPGEW 578          
BLAST of tyramine beta-hydroxilase vs. Ensembl Xenopus
Match: enc1.2 (ectodermal-neural cortex (with BTB-like domain), gene 2 [Source:Xenbase;Acc:XB-GENE-5914613])

HSP 1 Score: 369.777 bits (948), Expect = 2.102e-120
Identity = 213/581 (36.66%), Postives = 319/581 (54.91%), Query Frame = 3
Query:   18 NLIVYRTEIMRLILLHVFIILKIVISYTKPYQYHATYS-----RTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV--NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFL-NYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFE------------NLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPI 1700
            NL +     +   +L VF+IL +        Q  +++        +G   +YW+V  + + +  ++   L K   F +    G SD G  E++D+ V+  N L     D  +++ G++  D +QDY L +   + E      +R   TCD  DY I+ GT ++I   L+   +  + + V  + N  +  +QLL+  +PI  +     +ME+    + IPA +TTYWC + +LP    KHHI+ YE VI+   + IVHH+E+F C  S    + R++GPC+S+ KP  L  CR V+AAWAMGA AF YPE+ G   GG + S Y  LE+H++N  E KG+ D+SG+RL+YT  LR+YDAGI+E+GL Y+    IPP QK F L+GYC++KC+ +ALP+NGI +F SQLHTHL G  V     R+ +E + +N D HY PH+Q        V+V  GD++VT+C Y T +R  +T GG  ITDEMC+NY+ YYP+ +LELCKS V     +            ++         + F  V W+  ++ +L+  Y  AP+   CN S +  F    N    PI
Sbjct:   11 NLRIREVVPVYFTMLAVFMILLVASLQGPSRQQKSSFPYQVPLDPQGSLQLYWNVSYSEKVVYFRI---LIKDLKFGLI--FGMSDRGDFEDADMAVLWTNELGSFFGDAWSDQKGQLHMDSQQDYELLNAQQSQEGLYLLFRRPFATCDPKDYLIEDGTVHLIYALLEKPFSTLSSIDVSAIKNRGLQRVQLLKPDLPIPRLPADVLNMEVRAPQVLIPAKETTYWCHITELPKDFTKHHIVMYEPVITKGHEAIVHHIEVFQCA-SNYYTIPRYDGPCDSKMKPQSLNSCRHVLAAWAMGAKAFYYPEESGLAFGGPDSSRYLRLEVHYHNPLELKGLRDSSGIRLYYTSTLRRYDAGIMEVGLVYSPVMAIPPGQKDFLLTGYCTDKCTDRALPSNGIKIFASQLHTHLGGRGVPPILVREGKEAEVVNADGHYSPHFQ--------VSVYGGDVMVTSCSYNTEDRKNITVGGFSITDEMCVNYVHYYPRTDLELCKSMVDPGYLQKYFHMVNRFNSDDVSTSPNTTVTKQFQEVPWNSFSAGVLKSLYSFAPISMHCNRSSAVRFPVSINTGEPPI 577          
BLAST of tyramine beta-hydroxilase vs. Ensembl Xenopus
Match: kank1 (KN motif and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-876859])

HSP 1 Score: 281.182 bits (718), Expect = 4.014e-86
Identity = 168/531 (31.64%), Postives = 267/531 (50.28%), Query Frame = 3
Query:  243 GIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS------------------SVSDVVFENLPEKEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRRS 1760
            G GFS +G + +SD+ +  V   K    D +++    + +D  Q+YLL+  + N         R ++TCD ND  I   T  +I ++  N    +       LN     L+LL       +   +      T   + IP   TTYWC++ ++P L+KKHH++K E +I + ++ +VHH+ L+ C R+  + V  +   C   + P     C  V+ AWA+G   FT+P   G  +G      Y ++EIH++N  +++G+ DNSG+RL+YT  +R+YDAG++E G+  +  + IPP+   F   G+C+ +C  +AL A    GI+VF   LH+HL G  +  RH+RK  E KPL  D  Y  ++QE + L +   +LPGD +VT C Y T  RT +T+GG+   DEMCL+++ YYPKI L  C+S                   V+   F     K++ N  F E  N   WS K      +   + P++  C+  +S+ +      I++P      Y  + + F CL   S
Sbjct:   58 GFGFSPNGDMASSDIVIGGVEEGKPYLQDFYSDGNRILHRDPHQNYLLEYAMENSTHTILKFSRDLHTCDPNDKTITESTIRVI-WAYHNDDIGHVGPTYHGLNRGRKSLRLLNPEKTYIKSVDTPS-FNFTNKNVPIPYKDTTYWCQMFKMPALNKKHHVVKIEPLIQSGNENLVHHILLYECDRNVNDSVLDYGHECYHPNMPDVFHTCETVVFAWAIGGEGFTFPSHAGLSLGMPTDPKYVLMEIHYDNPSQQEGLTDNSGIRLYYTHHVRKYDAGVLETGIWVSLYHMIPPRMAQFISEGHCTMECLEEALSAENPEGIHVFAVLLHSHLAGKAIWARHYRKGEEQKPLAYDTEYDFNFQEFKYLEEERTILPGDNIVTQCQYNTKGRTTMTWGGLSTRDEMCLSFLLYYPKINLARCESIPEIKQQLEFIGVKEIYRPVTSWPFIIKSPKKYNNLSFTEAMNAYQWSKKKGNSFNQQALQIPINVRCSKHESNEWMVQ-GMIVSPPQVKEIY--QSEEFVCLSLSS 583          
BLAST of tyramine beta-hydroxilase vs. Ensembl Xenopus
Match: kank1 (KN motif and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-876859])

HSP 1 Score: 280.796 bits (717), Expect = 5.892e-86
Identity = 169/531 (31.83%), Postives = 267/531 (50.28%), Query Frame = 3
Query:  243 GIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS------------------SVSDVVFENLPEKEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRRS 1760
            G GFS +G + +SD+ +  V   K    D +++    + +D  Q+YLL+  + N         R ++TCD ND  I   T  +I ++  N    +       LN     L+LL       +   +      T   + IP   TTYWC++ ++P L+KKHH++K E +I + ++ +VHH+ L+ C R+  + V  +   C   + P     C  V+ AWA+G   FT+P   G  +G      Y ++EIH++N  +++G+ DNSG+RL+YT  +R+YDAG++E G+  +  + IPP+   F   G+C+ +C  +AL A    GI+VF   LH+HL G  +  RH+RK  E KPL  D  Y  ++QE + L +   +LPGD +VT C Y T  RT +T+GG+   DEMCL+++ YYPKI L  C+S                   V+   F     K++ N  F E  N   WS K      +   + P++  C+  +S+ +      I++P      Y  E+  F CL   S
Sbjct:   63 GFGFSPNGDMASSDIVIGGVEEGKPYLQDFYSDGNRILHRDPHQNYLLEYAMENSTHTILKFSRDLHTCDPNDKTITESTIRVI-WAYHNDDIGHVGPTYHGLNRGRKSLRLLNPEKTYIKSVDTPS-FNFTNKNVPIPYKDTTYWCQMFKMPALNKKHHVVKIEPLIQSGNENLVHHILLYECDRNVNDSVLDYGHECYHPNMPDVFHTCETVVFAWAIGGEGFTFPSHAGLSLGMPTDPKYVLMEIHYDNPSQQEGLTDNSGIRLYYTHHVRKYDAGVLETGIWVSLYHMIPPRMAQFISEGHCTMECLEEALSAENPEGIHVFAVLLHSHLAGKAIWARHYRKGEEQKPLAYDTEYDFNFQEFKYLEEERTILPGDNIVTQCQYNTKGRTTMTWGGLSTRDEMCLSFLLYYPKINLARCESIPEIKQQLEFIGVKEIYRPVTSWPFIIKSPKKYNNLSFTEAMNAYQWSKKKGNSFNQQALQIPINVRCSKHESNEWMVQ-GMIVSPPQVKEIYQSEE--FVCLSLSS 588          
BLAST of tyramine beta-hydroxilase vs. Ensembl Xenopus
Match: lamb3 (laminin subunit beta 3 [Source:Xenbase;Acc:XB-GENE-983491])

HSP 1 Score: 207.994 bits (528), Expect = 4.907e-59
Identity = 157/536 (29.29%), Postives = 232/536 (43.28%), Query Frame = 3
Query:   57 LLHVFIILKIVISYTKPYQYHATYSRTEGVYD------IYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV----NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIE---IPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS-----SVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLER 1610
            +  + ++L   IS    +  H  +SR   V        + W V+ + E+I L++      Q     W  +  +    L  SD+ +     +   F   D H +     ++D  QDY L +   N       + RK  TCD  DY  + GT N+   +              F  Y ++LL                    I + +I    IP   TTY C  I LP +  KHHI+KYE  I   S GIVHH+ ++ C      ++    G C      +  + C  V+  WA+G   F YPE  G  IG +    Y  LEIH++N D   GI DNSG+R+FYT +LRQ DAGI+  G+      FIPP  ++F   G C        +P  G   +G+      T     TR    H  +  L  DK Y   +Q+IR  PK +++  GD +V  C   T +R  VT+GG    +EMCL ++FYYP I +  C S      V+D +    PE+   +   + + V+W D+     +R
Sbjct:    7 MWRLGLLLFGSISMGGCWGVHLQFSRVMKVRGRKDSALLRWGVDRHREQIALEV------QVPRASWVALALNLERNLTGSDVVIGGWNGDTEIFYVSDAHIDSQWPPVRDNSQDYELLELRRNETHSTLRVWRKWFTCDPQDYDFEVGTKNLFALT--------------FSIYLIILLNCFGY---------------IILCFIRQFLIPEEDTTYACSFIPLPQVATKHHIVKYEVNIDPQSDGIVHHILIYAC--DANAEIVPEVGDCYGSD--IRYSQCLNVMFGWAVGGEDFFYPEIAGVSIGTKYDPQYVRLEIHYSNFDGISGIRDNSGIRVFYTPELRQLDAGILMAGVLTFPIQFIPPGAEAFRSYGLCDTG----MIPQVGTRGWGATRGLGATRGLGSTRGNGTH--IGSLGEDKSYDFGFQQIRYFPKPIDIKMGDQIVVECTGSTMDRDSVTYGGPSSLNEMCLGFLFYYPNIPIATCWSFYDLNHVTDALGLE-PEESVMDAIFSMDTVDWDDETRAKAQR 496          
BLAST of tyramine beta-hydroxilase vs. Ensembl Mouse
Match: Dbh (dopamine beta hydroxylase [Source:MGI Symbol;Acc:MGI:94864])

HSP 1 Score: 405.216 bits (1040), Expect = 6.993e-134
Identity = 225/589 (38.20%), Postives = 338/589 (57.39%), Query Frame = 3
Query:   66 VFIILKIVISYTK-------PYQYHATYSRTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV----NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVF------------ENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRRS 1760
            V I L I+++  +       P+ YH      EG+ ++ W+V    E I  +L  Q L     F      G SD G++EN+DL ++    +R  F   D  +++ G+I  D +QDY L       +      +R   TCD  DY I+  T +++   L+        ++   L+  +  +QLL+S +P   +    ++M+I    I IP ++TTYWC + +LP    +HHII YEA+++  ++ +VHHME+F C  +   D  +FNGPC+S+ KP  L  CR V+AAWA+GA AF YP++ G P GG   S +  LE+H++N  + +G  D+SG+RL YT  LR+YDAGI+ELGL YT    IPP++ +F L+GYC++KC++ AL  +GI++F SQLHTHLTG +V T   R  +E K +NRD HY PH+QEIR+L K+V V PGD+L+T+C Y T N+T  T GG  I +EMC+NY+ YYP+ ELELCKS+V D               E +      +  + F+ V W+  N  +L+  YD AP+   CN + +  F G+WN    P + +    LE+ +  C +R++
Sbjct:   30 VAIFLVILVAALRGSEPPESPFPYHIPLD-PEGILELSWNVSYVQEIIHFQLQVQGLRAGVLF------GMSDRGEMENADLIMLWTDGDRAYFA--DAWSDRKGQIHLDSQQDYQLLQAQRTRDGLSLLFKRPFVTCDPKDYVIEDDTVHLVYGILEEPFQSLEAINTSGLHTGLQRVQLLKSEVPTPSMPEDVQTMDIRAPDILIPDNETTYWCYITELPPRFPRHHIIMYEAIVTEGNEALVHHMEVFQCA-AESEDFPQFNGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPKEAGVPFGGPGSSPFLRLEVHYHNPRKIQGRQDSSGIRLHYTATLRRYDAGIMELGLVYTPLMAIPPQETAFVLTGYCTDKCTQMALQDSGIHIFASQLHTHLTGRKVVTVLARDGQERKVVNRDNHYSPHFQEIRMLKKVVTVYPGDVLITSCTYNTENKTLATVGGFGILEEMCVNYVHYYPQTELELCKSAVDDGFLQKYFHMVNRFSSEEVCTCPQASVPQQFSSVPWNSFNRDMLKALYDYAPISMHCNKTSAVRFPGEWNLQPLPKITS---TLEEPTPRCPIRQT 605          
BLAST of tyramine beta-hydroxilase vs. Ensembl Mouse
Match: Moxd1 (monooxygenase, DBH-like 1 [Source:MGI Symbol;Acc:MGI:1921582])

HSP 1 Score: 280.796 bits (717), Expect = 4.775e-86
Identity = 181/584 (30.99%), Postives = 285/584 (48.80%), Query Frame = 3
Query:   57 LLHVFIILKIVISYTKPYQY-HATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVV----FENLPE---------------KEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLE 1727
            LL ++ +L    + +    Y H      EG Y ++W  +   E++  +L  + N       + G GFS  G +  +D+ V  V   +    D  TN    + KD +QDY L   + N         R+++TCD ND  +   T  +I     +    +   + D LN     L+LL         +       +  N + IP   TTYWC++ ++P   +KHH+IK E +I    + +VHH+ ++ C  +  + V  F   C   + P     C  VI AW +G   FTYP  VG  +G      Y +LE+H++N   +KG+ID+SGLR+F+T  +R+YDAG+IE GL  +  + IPP    F   G+C+ +C  +AL A   +GI+VF   LH HL G  +  RHFRK  E+K L  D  Y  ++QE + L +   +LPGD L+T C Y T +R  +T+GG+   +EMCL+Y+ YYP++ L  C SS+ D++    F  + E               K++RN  F +  N+  W+ K      +     PV+  C+ +D+  +       I P ++ R Y+ E
Sbjct:    6 LLVLWALLPATAAGSPGRSYPHRVVLDPEGKYWLHWGRQG--ERLAFRLEVRTNG------YVGFGFSPTGSMAAADIVVGGVAHGRPYLQDYFTNADRELEKDAQQDYHLDYAMENSTHTVIEFSRELHTCDVNDKSLTDSTVRVIWAYHHDDPGESGPKYHD-LNRGTRSLRLLNPEKANVVSTVLPYFDLVNQN-VPIPNKGTTYWCQMFKIPTFQEKHHVIKVEPIIERGHENLVHHILVYQCSSNFNDSVLDFGHECYHPNMPDAFLTCETVILAWGIGGEGFTYPPHVGLSLGMPLDPRYVLLEVHYDNPARRKGLIDSSGLRVFHTTDIRRYDAGVIEAGLWVSLFHTIPPGMPEFHSEGHCTLECLEEALGAEKPSGIHVFAVLLHAHLAGKGIRLRHFRKGEEMKLLAYDDDYDFNFQEFQYLREEQTILPGDNLITECRYNTKDRAVMTWGGLSTRNEMCLSYLLYYPRVNLTRC-SSIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYRNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTAIPPDIK-RPYEAE 577          
BLAST of tyramine beta-hydroxilase vs. Ensembl Mouse
Match: Moxd2 (monooxygenase, DBH-like 2 [Source:MGI Symbol;Acc:MGI:2388042])

HSP 1 Score: 219.935 bits (559), Expect = 3.552e-63
Identity = 158/524 (30.15%), Postives = 243/524 (46.37%), Query Frame = 3
Query:   99 TKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGF---DLHTNKYGRIIKDERQDY----LLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIII-FSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQ--ALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS-----SVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEA 1625
            T P +Y      +  V+ + W  +   E I  +L      Q     W G+G +D      SDL V   L        D H      + +D  QD     L +D +    +F     R   TCD +D  I   T  ++  +   +   M+ E H    + F  LLQ+L+     +        ++I+ N+I IP   TTY C  + LP + KKHHI K+E ++   ++ +VHH+ ++ C    GN      G           ++C  VIA WA+G  ++ +P+ VG  IG      +  LEIH++N     GI D SG+RLFYT  LR+YD G+++LG+     +FIPP  ++F   G C      +    P + IY+    LHTHL G  ++   +R   +L+ + +D  Y  + QE R LP  V + PGD L+  C Y+T +R  +TFGG    +EMCL + FYYP+I +  C        V++ + E   E    N     + V W+ +N K  E+   E+
Sbjct:   27 TSPLRYSRFLDPSRAVF-LRWDFDYEAEIITFEL------QVQTTGWVGLGITDRYTFVGSDLVVGGVLPNGNVYFSDQHLLDEDTLEQDGSQDAELLRLTEDAVSTTMRF----SRPFRTCDPHDRDITSDTMRVLAAYGPDDIPKMSRE-HTFVKSIF--LLQMLQYDDQDAPEDTIIHDLKIS-NFI-IPEDDTTYACTFLPLPIVSKKHHIYKFEPILVERNETMVHHVLVYAC----GNSSVLPTGIGECYGSDPAFSLCSHVIAGWAVGGLSYQFPDDVGISIGTPFDPQWIRLEIHYSNFQNLPGIRDTSGMRLFYTSHLRKYDMGVLQLGISVFPIHFIPPGAEAFLSYGLCKTDKFEELNGAPVSDIYISACLLHTHLAGRSLQALQYRNGTQLQVVCKDFSYDFNLQESRDLPHPVVIKPGDELLIECHYQTLDRDFMTFGGASTINEMCLIFFFYYPRINISSCMGYPDIIYVTNELGEEASENPMENLM-VLDNVEWTPENIKKAEKACKES 529          
BLAST of tyramine beta-hydroxilase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 93.9745 bits (232), Expect = 1.465e-19
Identity = 86/306 (28.10%), Postives = 132/306 (43.14%), Query Frame = 3
Query:  651 PASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRF--NGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNN----QDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPK----IELELCKSSVSDVVFENLPEK 1538
            P    TY+C  ++LP +D++  +I ++      S   VHHM LF C          F   G C  ++          ++ AWA  AP    P+ VG  +GGE  S Y +L++H+ +    +D  K   D SG+ L  T   +   AG+    L  +    IPP +K           C  +  P   ++VF  ++HTH  G  V     R + +   + R     P  Q    +   V+V  GDIL   C++    RTE T  G   +DEMC  YI YY +    +    C  +V+  +F  +PE+
Sbjct:   72 PKESDTYFCMSMRLP-VDEEAFVIDFKP---RASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKAN---------ILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHK---DCSGVSLHLTRVPQPLIAGMY---LMMSVNTVIPPGEKVVN----SDISCHYKMYP---MHVFAYRVHTHHLGKVVSGYRVR-NGQWTLIGRQSPQLP--QAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPEE 348          
BLAST of tyramine beta-hydroxilase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 93.9745 bits (232), Expect = 2.014e-19
Identity = 86/306 (28.10%), Postives = 132/306 (43.14%), Query Frame = 3
Query:  651 PASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRF--NGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNN----QDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPK----IELELCKSSVSDVVFENLPEK 1538
            P    TY+C  ++LP +D++  +I ++      S   VHHM LF C          F   G C  ++          ++ AWA  AP    P+ VG  +GGE  S Y +L++H+ +    +D  K   D SG+ L  T   +   AG+    L  +    IPP +K           C  +  P   ++VF  ++HTH  G  V     R + +   + R     P  Q    +   V+V  GDIL   C++    RTE T  G   +DEMC  YI YY +    +    C  +V+  +F  +PE+
Sbjct:   72 PKESDTYFCMSMRLP-VDEEAFVIDFKP---RASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKAN---------ILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHK---DCSGVSLHLTRVPQPLIAGMY---LMMSVNTVIPPGEKVVN----SDISCHYKMYP---MHVFAYRVHTHHLGKVVSGYRVR-NGQWTLIGRQSPQLP--QAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPEE 348          
BLAST of tyramine beta-hydroxilase vs. UniProt/SwissProt
Match: sp|Q64237|DOPO_MOUSE (Dopamine beta-hydroxylase OS=Mus musculus OX=10090 GN=Dbh PE=1 SV=2)

HSP 1 Score: 405.216 bits (1040), Expect = 4.892e-133
Identity = 225/589 (38.20%), Postives = 338/589 (57.39%), Query Frame = 3
Query:   66 VFIILKIVISYTK-------PYQYHATYSRTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV----NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVF------------ENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRRS 1760
            V I L I+++  +       P+ YH      EG+ ++ W+V    E I  +L  Q L     F      G SD G++EN+DL ++    +R  F   D  +++ G+I  D +QDY L       +      +R   TCD  DY I+  T +++   L+        ++   L+  +  +QLL+S +P   +    ++M+I    I IP ++TTYWC + +LP    +HHII YEA+++  ++ +VHHME+F C  +   D  +FNGPC+S+ KP  L  CR V+AAWA+GA AF YP++ G P GG   S +  LE+H++N  + +G  D+SG+RL YT  LR+YDAGI+ELGL YT    IPP++ +F L+GYC++KC++ AL  +GI++F SQLHTHLTG +V T   R  +E K +NRD HY PH+QEIR+L K+V V PGD+L+T+C Y T N+T  T GG  I +EMC+NY+ YYP+ ELELCKS+V D               E +      +  + F+ V W+  N  +L+  YD AP+   CN + +  F G+WN    P + +    LE+ +  C +R++
Sbjct:   30 VAIFLVILVAALRGSEPPESPFPYHIPLD-PEGILELSWNVSYVQEIIHFQLQVQGLRAGVLF------GMSDRGEMENADLIMLWTDGDRAYFA--DAWSDRKGQIHLDSQQDYQLLQAQRTRDGLSLLFKRPFVTCDPKDYVIEDDTVHLVYGILEEPFQSLEAINTSGLHTGLQRVQLLKSEVPTPSMPEDVQTMDIRAPDILIPDNETTYWCYITELPPRFPRHHIIMYEAIVTEGNEALVHHMEVFQCA-AESEDFPQFNGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPKEAGVPFGGPGSSPFLRLEVHYHNPRKIQGRQDSSGIRLHYTATLRRYDAGIMELGLVYTPLMAIPPQETAFVLTGYCTDKCTQMALQDSGIHIFASQLHTHLTGRKVVTVLARDGQERKVVNRDNHYSPHFQEIRMLKKVVTVYPGDVLITSCTYNTENKTLATVGGFGILEEMCVNYVHYYPQTELELCKSAVDDGFLQKYFHMVNRFSSEEVCTCPQASVPQQFSSVPWNSFNRDMLKALYDYAPISMHCNKTSAVRFPGEWNLQPLPKITS---TLEEPTPRCPIRQT 605          
BLAST of tyramine beta-hydroxilase vs. UniProt/SwissProt
Match: sp|P15101|DOPO_BOVIN (Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN=DBH PE=1 SV=2)

HSP 1 Score: 401.749 bits (1031), Expect = 7.948e-132
Identity = 226/592 (38.18%), Postives = 336/592 (56.76%), Query Frame = 3
Query:   27 VYRTEIMRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV--NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFR----------------NFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFEC 1745
            +Y T +   +++ V   L+       P+ +H      EG  ++ W++    E I  +L  ++L     F      G SD G+LEN+DL V+  +R      D  +++ G++  D +QDY L       E      +R   TCD NDY I+ GT +++   L+        ++   L+  +  +QLL+ +IP   +   TR+MEI    + IP  QTTYWC V +LP    +HHI+ YE +++  ++ +VHHME+F C  +    +  F+GPC+S+ KP  L  CR V+AAWA+GA AF YPE+ G   GG   S +  LE+H++N     G  D+SG+RL+YT  LR++DAGI+ELGL YT    IPP++ +F L+GYC++KC++ ALPA+GI++F SQLHTHLTG +V T   R  RE + +NRD HY PH+QEIR+L K+V+V PGD+L+T+C Y T +R   T GG  I +EMC+NY+ YYP+ +LELCKS+V          K FR                +  E F  V W+  N ++L+  Y  AP+   CN S +  F+G+WN    P + +R   LE+ +  C
Sbjct:   14 MYGTAVAVFLVILV-AALQGSAPAESPFPFHIPLD-PEGTLELSWNISYAQETIYFQLLVRELKAGVLF------GMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDSQQDYQLLRAQRTPEGLYLLFKRPFGTCDPNDYLIEDGTVHLVYGFLEEPLRSLESINTSGLHTGLQRVQLLKPSIPKPALPADTRTMEIRAPDVLIPGQQTTYWCYVTELPDGFPRHHIVMYEPIVTEGNEALVHHMEVFQCA-AEFETIPHFSGPCDSKMKPQRLNFCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVITGRRDSSGIRLYYTAALRRFDAGIMELGLAYTPVMAIPPQETAFVLTGYCTDKCTQLALPASGIHIFASQLHTHLTGRKVVTVLARDGRETEIVNRDNHYSPHFQEIRMLKKVVSVQPGDVLITSCTYNTEDRRLATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDPGFL----HKYFRLVNRFNSEEVCTCPQASVPEQFASVPWNSFNREVLKALYGFAPISMHCNRSSAVRFQGEWNRQPLPEIVSR---LEEPTPHC 589          
BLAST of tyramine beta-hydroxilase vs. UniProt/SwissProt
Match: sp|P09172|DOPO_HUMAN (Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 GN=DBH PE=1 SV=3)

HSP 1 Score: 395.971 bits (1016), Expect = 1.477e-129
Identity = 222/569 (39.02%), Postives = 328/569 (57.64%), Query Frame = 3
Query:   27 VYRTEIMRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGF--DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGND-VKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVF-------------ENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWN 1682
            +Y T +  + L+ +   L+       P  YH      EG  ++ W+V    E I  +L  ++L     F      G SD G+LEN+DL V+       +  D  +++ G+I  D +QDY L       E      +R   TCD  DY I+ GT +++   L+        ++   L   +  +QLL+  IP  E+     +ME+    I+IP+ +TTYWC + +LP    +HHIIKYE +++  ++ +VHHME+F C  +P  D V  F+GPC+S+ KP  L  CR V+AAWA+GA AF YPE+ G   GG   S Y  LE+H++N    +G  D+SG+RL+YT KLR+++AGI+ELGL YT    IPP++ +F L+GYC++KC++ ALP +GI++F SQLHTHLTG +V T   R  RE + +N+D HY PH+QEIR+L K+V+V PGD+L+T+C Y T +R   T GG  I +EMC+NY+ YYP+ +LELCKS+V D  F             E++      +  + F  V W+  N  +L+  Y  AP+   CN S +  F+G+WN
Sbjct:   21 MYSTAVA-IFLVILVAALQGSAPRESPLPYHIPLD-PEGSLELSWNVSYTQEAIHFQLLVRRLKAGVLF------GMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQC--APEMDSVPHFSGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYPQTQLELCKSAV-DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWN 578          
BLAST of tyramine beta-hydroxilase vs. UniProt/SwissProt
Match: sp|Q9XTA0|DOPO_HORSE (Dopamine beta-hydroxylase OS=Equus caballus OX=9796 GN=DBH PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 1.413e-128
Identity = 217/583 (37.22%), Postives = 327/583 (56.09%), Query Frame = 3
Query:   69 FIILKIVISYTKPYQYHATYS---RTEGVYDIYWSVEPNLEKIQLKL-CQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVF------------ENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRRS 1760
             +IL   +  ++P +    Y      EG  ++ W+V    E I  +L  ++L     F      G SD G+LEN+DL V+       + G D  +++ G I  D +QDY L       E      +R   TCD  DY I+ GT +++   L+        ++   L+  +  +QLL+  + +  +    R+ME+    + +P  +TTYWC + +LP    +HHI+ YE +++  ++ +VHHME+F C  +      +FNGPC+S+ KP  L  CR V+AAWA+GA AF YPE+ G   GG   S +  LE+H++N  + +G  D+SG+RL+YT  LR++DAGI+ELGL YT    IPP++ +F L+GYC++KC++ ALP +GI++F SQLHTHLTG +V T   R  RE + +NRD HY PH+QEIR+L K+V+V PGD+L+T+C Y T +R   T GG  I +EMC+NY+ YYP+ +LELCKS+V                 E +      +  E F  V W+  N ++L   Y  AP+   CN S +  F+GDWN    P + ++   LE+ +  C   R 
Sbjct:   23 LVILVAALQGSEPPESPFPYRIPLDPEGTLELSWNVSYVQETIHFQLLVRELKAGVLF------GMSDRGELENADLVVLWTDGDSAYFG-DAWSDQKGWIHLDAQQDYQLLRAQRTPEGLSLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFWSLEAINTSALHTGLQRVQLLKPNVSVPALPADMRTMEVRAPDVLVPGQETTYWCYITELPDGFPRHHIVMYEPIVTEGNEALVHHMEVFQCA-AEFESFPQFNGPCDSKMKPSRLNYCRNVLAAWALGAKAFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLKIEGRRDSSGIRLYYTATLRRFDAGIMELGLVYTPVMAIPPQETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLARDGREREVVNRDDHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRKLATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDPGFLQKYFHFVNRFNGEEVCTCPQASVPEQFATVPWNSFNRQVLSALYGFAPISMHCNRSSAVRFQGDWNLQPLPEIISK---LEEPTPRCPASRG 594          
BLAST of tyramine beta-hydroxilase vs. UniProt/SwissProt
Match: sp|Q05754|DOPO_RAT (Dopamine beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Dbh PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 4.246e-123
Identity = 211/571 (36.95%), Postives = 318/571 (55.69%), Query Frame = 3
Query:  102 KPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGI--GFSDHGKLENSDLFVV----NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVF------------ENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRRS 1760
             P+ YH      EG  ++ W+V  + E I  +L      Q   P  +G+  G SD G++EN+DL ++    +R  F   D  +++ G+I  D  QDY L              +R   TCD  DY I+  T +++   L+        ++   L+  +  +QLL+  +    +    ++M+I    + IP+++TTYWC + +LP    +HHII YEA+++  ++ +VHHME+F C          FNGPC+S+ KP  L  CR V+AAWA+GA AF YPE+ G P+G    S +  LE+H++N    +G  D+SG+RL YT  LR  +AGI+ELGL YT    IPP++ +F L+GYC+++C++ ALP +GI +F SQLHTHLTG +V T   R  ++ + +NRD HY PH+QEIR+L   V V  GD+L+T+C Y T NRT  T GG  I +EMC+NY+ YYPK ELELCKS+V D               E +      +  + F  V W+  N  +L+  Y+ AP+   CN + +  F G+WN    P + +    +E+    C +R++
Sbjct:   48 SPFPYHIPLD-PEGTLELSWNVSYDQEIIHFQL------QVQGP-RAGVLFGMSDRGEMENADLVMLWTDGDRTYFA--DAWSDQKGQIHLDTHQDYQLLQAQRVSNSLSLLFKRPFVTCDPKDYVIEDDTVHLVYGILEEPFQSLEAINTSGLHTGLQQVQLLKPEVSTPAMPADVQTMDIRAPDVLIPSTETTYWCYITELPLHFPRHHIIMYEAIVTEGNEALVHHMEVFQCTNE-SEAFPMFNGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGVPLGSSGSSRFLRLEVHYHNPRNIQGRRDSSGIRLHYTASLRPNEAGIMELGLVYTPLMAIPPQETTFVLTGYCTDRCTQMALPKSGIRIFASQLHTHLTGRKVITVLARDGQQREVVNRDNHYSPHFQEIRMLKNAVTVHQGDVLITSCTYNTENRTMATVGGFGILEEMCVNYVHYYPKTELELCKSAVDDGFLQKYFHIVNRFGNEEVCTCPQASVPQQFASVPWNSFNRDMLKALYNYAPISVHCNKTSAVRFPGNWNLQPLPNITSA---VEEPDPRCPIRQT 604          
BLAST of tyramine beta-hydroxilase vs. TrEMBL
Match: H9N4S9 (Tyramine beta-hydroxilase (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 405/409 (99.02%), Postives = 406/409 (99.27%), Query Frame = 3
Query:  195 KLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFG 1421
            KLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCI SPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQK FALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQE+RLLPKIVNVLPGD LVTTCIYKTTNRTEVTFG
Sbjct:    1 KLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCISSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKGFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEVRLLPKIVNVLPGDTLVTTCIYKTTNRTEVTFG 409          
BLAST of tyramine beta-hydroxilase vs. TrEMBL
Match: B6ZH61 (Tyramine beta-hydroxylase OS=Dugesia japonica OX=6161 GN=DjTBH PE=2 SV=1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 361/547 (66.00%), Postives = 432/547 (78.98%), Query Frame = 3
Query:   45 MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKF-LGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKE-FRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDW 1679
            MRLIL + FI + I+ISY   +QYH TYS  E +Y I WS++ + E IQL++C+K      FP W GIGFS+ GK+EN+DLF VN +KF  GFDLHTN YG II+D   +Y LKD   +H+  CF   RK+NTCDK DYQIDRGTTNIII S K  +N+N+   ++ LNYFV+ LQL+RS IPIS IS ST+ M+I VN I+IP S+TTYWCK+I+LP L++KHHIIKYEA++   S+G+VHHMELFHC   P + +K +N PCN+ESKPMGLTMCRK           FTYPE+VGNPIGGE FS YAILEIH+NN +EK+GIIDNSGLRL+YTD+LRQYDAGIIELGLEYTEKN IPPKQ SF LSGYC ++C++QALP NGI+VFGSQLHTHLTG+QVETRHFR  +EL+PLN D HYQPHYQEIRLLPKIVN+LPGD+L+TTC Y T NR+E+TFGGIEIT+EMCLNYIFYYP+I+LELCKSSV+D + E   EK+   N K  FN + WS  NSKLLERFY+ AP+HQSCNMSDS SFEG W
Sbjct:    1 MRLILFNNFISINILISYCYNFQYHTTYSENENIYHIDWSIDTHFENIQLQICEKFKNSIDFPNWLGIGFSNRGKIENADLFAVN-IKFEKGFDLHTNSYGEIIEDNENNYHLKDIFTSHKNVCFIFDRKLNTCDKFDYQIDRGTTNIIILSSK-FENINH-FGLELLNYFVIQLQLIRSRIPISPISSSTQFMDIQVNNIKIPDSKTTYWCKLIKLPRLEQKHHIIKYEAILK--SRGLVHHMELFHCEVPPDDSMKYYNAPCNAESKPMGLTMCRK----------PFTYPEEVGNPIGGEKFSNYAILEIHYNNPEEKRGIIDNSGLRLYYTDELRQYDAGIIELGLEYTEKNSIPPKQTSFILSGYCLDECTKQALPTNGIFVFGSQLHTHLTGVQVETRHFRNDKELEPLNIDTHYQPHYQEIRLLPKIVNILPGDMLITTCTYNTLNRSEMTFGGIEITNEMCLNYIFYYPRIKLELCKSSVNDFILEQFFEKKPTENLKNIFNNIKWSKNNSKLLERFYELAPIHQSCNMSDSKSFEGHW 532          
BLAST of tyramine beta-hydroxilase vs. TrEMBL
Match: A0A3S5HJL8 (Tyramine beta-hydroxylase OS=Lymnaea stagnalis OX=6523 GN=TBH PE=2 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 3.360e-148
Identity = 234/557 (42.01%), Postives = 319/557 (57.27%), Query Frame = 3
Query:   66 VFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSV-SDVV---------FENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITP 1697
            V++++       + YQY  T    +  Y   WSV+     I ++L  K+  +     W   GFSD+G + ++DL +       K   FD HT   G  + D +QDY L     +         R  NTCD  DY +D GTT+++       +       V  L + V  LQLL+  I        T S E+    + +PA +TTYW     LP +   HHII+YE +++  S  +VHHME+FHC    G+ V  +NGP  +E KP GL +CRKVI AWAMGA A  YPE+ G P+GG+ FS +A+LE+H+NN  +K G +D+SG+R   T +LR+YDAGI+ELGLEY  K  +PP Q+ F LSGYC  KC++ +LP  GI+VF SQLHTHLTG +V T+H R   EL  +NRD HY PH+QEIR LP+  +VLPGD+L+TTC Y TT R++ T GG  ITDEMCLNY+ YYP+ +LE+CKSSV +D +         FEN         +  +  + WS  N +LLE  Y  +P+   CN SD   F G+W  +  P
Sbjct:   12 VWLVVLSADHSVQAYQYQVTLD-PDSRYLFQWSVDYKESLINVQLTCKVTPE----SWLAFGFSDYGDVTSADLILFWTDGDGKHHFFDGHTTPDGIFLPDRQQDYHLTSVADDRGSVVLDFYRHFNTCDPEDYALDNGTTHLVYVESAQPEGPPLARDVTRLRHGVQRLQLLKPEISAPVFPEDTWSFEVRAPEVLVPAEETTYWWHTTILPDMPSPHHIIQYEGIVAEGSGDLVHHMEVFHCQVQKGHGVPYYNGPGIAEGKPEGLEVCRKVIGAWAMGAEAMIYPEEAGVPVGGQGFSRFALLEVHYNNPQKKSGRMDSSGIRFHVTSQLRKYDAGIMELGLEYVNKMAVPPGQRDFKLSGYCVHKCTQMSLPPAGIHVFASQLHTHLTGRRVYTKHARDGAELPEVNRDNHYSPHFQEIRRLPQPHHVLPGDVLITTCEYDTTKRSKATVGGFSITDEMCLNYVHYYPRSDLEVCKSSVRTDSLHTFFFLLNRFENSKVSPEAGDRANYESIEWSPLNVRLLEDLYSTSPLSMQCNRSDGTRFPGEWEHVRVP 563          
BLAST of tyramine beta-hydroxilase vs. TrEMBL
Match: I7HHD7 (Tyramine beta hydroxylase OS=Lymnaea stagnalis OX=6523 GN=tbh PE=2 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 3.470e-148
Identity = 234/557 (42.01%), Postives = 319/557 (57.27%), Query Frame = 3
Query:   66 VFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSV-SDVV---------FENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITP 1697
            V++++       + YQY  T    +  Y   WSV+     I ++L  K+  +     W   GFSD+G + ++DL +       K   FD HT   G  + D +QDY L     +         R  NTCD  DY +D GTT+++       +       V  L + V  LQLL+  I        T S E+    + +PA +TTYW     LP +   HHII+YE +++  S  +VHHME+FHC    G+ V  +NGP  +E KP GL +CRKVI AWAMGA A  YPE+ G P+GG+ FS +A+LE+H+NN  +K G +D+SG+R   T +LR+YDAGI+ELGLEY  K  +PP Q+ F LSGYC  KC++ +LP  GI+VF SQLHTHLTG +V T+H R   EL  +NRD HY PH+QEIR LP+  +VLPGD+L+TTC Y TT R++ T GG  ITDEMCLNY+ YYP+ +LE+CKSSV +D +         FEN         +  +  + WS  N +LLE  Y  +P+   CN SD   F G+W  +  P
Sbjct:   12 VWLVVLSADHSVQAYQYQVTLD-PDSRYLFQWSVDYKESLINVQLTCKVTPE----SWLAFGFSDYGDVTSADLILFWTDGDGKHHFFDGHTTPDGIFLPDRQQDYHLTSVADDRGSVVLDFYRHFNTCDPEDYALDNGTTHLVYVESAQPEGPPLARDVTRLRHGVQRLQLLKPEISAPVFPEDTWSFEVRAPEVLVPAEETTYWWHTTILPDMPSPHHIIQYEGIVAEGSGDLVHHMEVFHCQVQKGHGVPYYNGPGIAEGKPEGLEVCRKVIGAWAMGAEAMIYPEEAGVPVGGQGFSRFALLEVHYNNPQKKSGRMDSSGIRFHVTSQLRKYDAGIMELGLEYVNKMAVPPGQRDFKLSGYCVHKCTQMSLPPAGIHVFASQLHTHLTGRRVYTKHARDGAELPEVNRDNHYSPHFQEIRRLPQPHHVLPGDVLITTCEYDTTKRSKATVGGFSITDEMCLNYVHYYPRSDLEVCKSSVRTDSLHTFFFLLNRFENSKVSPEAGDRANYESIEWSPLNVRLLEDLYSTSPLSMQCNRSDGTRFPGEWEHVRVP 563          
BLAST of tyramine beta-hydroxilase vs. TrEMBL
Match: A0A2C9LHW4 (DOMON domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106066921 PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 3.939e-146
Identity = 237/573 (41.36%), Postives = 333/573 (58.12%), Query Frame = 3
Query:   57 LLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENL--------PEKEFRNFKETFNRV--NWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDW-----NAIITPILETRDYD 1721
            ++   +I K+V  +   +QY   +  + G Y   WSV+     + +++  K+ +     IW  +GFSD+G + ++DL V            D +TN +G I+ D++QDY L     +H        R+ NTCD+ DY +D GTT++I F       +     V  L + V  +QLL+  +P+  +   T + E+    I IP+ +TTYW     LP +   HHI+KY  VIS  ++ +VHHME+FHC    G  +  ++GP  +E  P GL  CR+VIAAWAMGA    YPE+ G  IGG++ S +A+LE+H+NN + K G +DNSG+R + T +LR+ +AGI+ELGLEY  K  IPP QK F LSGYC + C+R  LP  GIYVF SQLHTHLTG ++ T+H R+  EL  LNRD H+ PH+QEIR LP+  NVLPGD LVTTC Y T +R + T GG  ITDEMC+NYI YYP+ ELE+CKSS+     +            K + +  +  N V  NW+  N++LL+  Y  +P+   CN SD   F GDW     + I  P++  RD D
Sbjct:   11 IIGCLLIFKMV-KWASAFQY-KLHLDSNGRYLFEWSVDYQKNNVNVQITAKVTQD----IWFAVGFSDYGSVTSADLVVFWTDGHGNHHFVDGYTNDHGIILPDDQQDYFLTSVAADHGAVVLDFYRRFNTCDEQDYTLDNGTTHVIFFESVYANELPFGHVVSSLGHAVKRVQLLKPELPMPVLPNDTWTFEVRAPEILIPSVETTYWWHTTILPRIPTNHHIVKYSGVISEGNEDLVHHMEVFHCQVPKGQKIPYYSGPAENEDTPKGLEPCRRVIAAWAMGAQDMVYPEEAGVSIGGQDTSRFALLEVHYNNPERKSGRMDNSGIRFYVTSQLRKNEAGIMELGLEYINKMAIPPGQKKFKLSGYCVQDCTRVGLPPGGIYVFASQLHTHLTGRRLYTKHVRQGLELPELNRDNHFSPHFQEIRRLPQPHNVLPGDELVTTCEYDTRSRDKATIGGFSITDEMCVNYIHYYPRTELEVCKSSIQTNALQTFFFLLNRLEDAKVYPDAGDRANYVNINWTPVNAQLLDELYATSPLSMQCNRSDGVRFPGDWEHQKVSEIAQPLV-ARDMD 576          
BLAST of tyramine beta-hydroxilase vs. Ensembl Cavefish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 341.273 bits (874), Expect = 1.010e-109
Identity = 197/522 (37.74%), Postives = 287/522 (54.98%), Query Frame = 3
Query:  246 IGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVS-DVV--FENLPEKEF----------RNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITP-ILETRDYDLEKQSFECLMRRS 1760
            IG SD G+  N+DL ++       + G D  ++  GR++ D +QDY L +       F    +R  +TCD +DY I+ GT ++I   L        +L+V  L+  V  + LLR   P   +    +S+E+    I IP+ +TTYWC + QLP    K+HI+ YE+V+++ ++ I                   ++G C+S+ KP  L  CR V+AAWA+GA  F YP   G PIGGE  S +  LE+H++N     G  D+SG+RL+YT  LR++DAGI+ELGL YT    IPP+Q SF LSGYC   C+R ALP  GI++F SQLHTHL G  V T   R  +E++ +  DKHY  HYQ          VL GD LVT C + T +R + T GG  I +EMC+NY+ YYP+ +LELCKS V  D +  + +L    F          R+ +E F+ V+W   + ++L   Y  +P+   CN S ++ F G+W     P +LE    +L+++ + C + RS
Sbjct:   85 IGLSDRGQPTNADLVLLWSDGHKSYFG-DAWSDAEGRVMLDSQQDYQLLEAQNTPTGFTVLFRRPFSTCDPHDYVIEEGTVHVIYALLDQPIRSLQQLNVSRLHTGVQRILLLRPDTPAPSLPADVQSIEVLAPGITIPSQETTYWCHIYQLPANMPKNHIVMYESVVTSGNEAI-------------------YSGSCDSKMKPANLNYCRHVLAAWALGAEPFYYPMDAGLPIGGEGSSRFLRLEVHYHNPLIISGRQDSSGIRLWYTRSLRRFDAGIMELGLVYTPVMAIPPRQSSFPLSGYCIPACTRTALPQGGIHIFASQLHTHLAGRTVRTVLVRGGKEVEVVQEDKHYSTHYQ----------VLHGDALVTKCTFNTEDRNKPTVGGFGIMEEMCVNYVHYYPRTQLELCKSHVDLDYLKKYFSLINSRFHGGEGCSCSQRSVEEEFSSVSWDQFSEEVLNSLYTTSPISMHCNQSTAELFPGNWEKQKIPEVLE----ELQREPYPCELGRS 572          
BLAST of tyramine beta-hydroxilase vs. Ensembl Cavefish
Match: moxd1 (monooxygenase DBH like 1 [Source:NCBI gene;Acc:103035147])

HSP 1 Score: 278.87 bits (712), Expect = 3.948e-85
Identity = 162/536 (30.22%), Postives = 265/536 (49.44%), Query Frame = 3
Query:  117 HATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLF---VVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELC------------------KSSVSDVVFENLPEKEFRN--FKETFNRVNWSDKNSKLLERFYDEAPVHQSCN 1646
            H+      G Y + WS +      +++   +         + G+GFS +G + ++DL    V N + +L  D + +    + KD  Q+Y L     NH        R + TCD ND  I  G+T  +I++L ++    +      +N     L+ L      +  +     M++  N + +P   TTYWC++ ++P + +KHHII+ E +I    + +VHH+ L+ C  S           C   + P   T C  VI AWA+G   FTYP  VG  IG +    Y ++E+HF+N   +  ++D+SGLRLFYT KLR YDAG+IE G+  +  + +PP  + F   G+C+++C +++L +   +G+ VF + LH HL G  + TRHFR+  EL P+  D  +  ++QE + L     +LPGD L+T C+Y T  R  +T+GG+   +EMCL+Y+ YYP++ L  C                  +S ++   F     K + N  F E  ++  W+ K  K         P++  C+
Sbjct:   56 HSAALDAGGRYALKWSFDETSITFEVEAATR--------GYMGLGFSPNGAMASADLVIGGVANGIPYL-HDYYADSSRVVHKDPVQNYRLLYGRENHTHTVLGFSRDLETCDPNDRAIT-GSTMRVIWALHSEDVGPSGPVYHGINRGRKSLRFLNPGTNRNVPAGIAT-MDLRNNNVPVPDKDTTYWCQMYKMPDVQQKHHIIRIEPLIQKGHENLVHHILLYQCDSSLNESELDLGHNCFHPNMPDSFTTCETVIFAWAIGGEGFTYPPHVGMSIGTDIDPVYVLMEMHFDNPALQTDVVDSSGLRLFYTPKLRTYDAGVIETGVWVSLYHMLPPGMEDFITEGHCTQECLQESLESEMPSGVSVFAALLHAHLAGRAIRTRHFRQQVELPPMALDDQFDFNFQEFQPLSPERQILPGDSLITECVYNTKGRNNMTWGGLSTRNEMCLSYLLYYPRVNLARCESLPEIRGQLKFIGVKQIQSPLTTWPFMIKSPKRYSNLSFTEAMDKFRWTKKRGKAFNEVVLNLPMNVRCS 580          
BLAST of tyramine beta-hydroxilase vs. Ensembl Cavefish
Match: moxd1l (DBH-like monooxygenase protein 2 homolog [Source:NCBI gene;Acc:103025507])

HSP 1 Score: 235.728 bits (600), Expect = 1.579e-69
Identity = 142/432 (32.87%), Postives = 210/432 (48.61%), Query Frame = 3
Query:  237 WSGIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMN------NELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPC-NSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQAL--PANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS 1499
            W G GFS +G +E +D+ +  V        D H       + DE+QDY L        Q     +R +  CDK+DY I      +I ++     N+           V+ L +                + P +   ++T+  + IP   T Y CKV+++P LD+K+H+ + E +I   +  +VHH+ L+ C   P          C   E++    T C + +AAW +G  AF  PE  G P+GG++  T   LE+H+NNQD   G +DNSGLR +YT +LRQYDA ++  GL       IPP   +F   G C      Q +  P   ++VF   LHTHL G ++   HFR   ++  L  D+HY   +Q+   L K   +  GD L+  C Y T NRT +T GG+  T+EMCL ++FYYP + L  C S
Sbjct:   62 WVGFGFSPNGGMEGADIVIGGVGPDGIYFTDRHAVGKFMPLLDEQQDYRLLSLTEADGQTVMKFERLIRACDKDDYPITEVPVKLI-YAYGKTDNITYHRTSRGTKEVNLLKFM------------PKAMLPDSNYFDLTMTNLTIPTENTYYHCKVMKIPLLDQKYHVYRIEPLIE--NMDLVHHLLLYRC---PPTVTTPTEEACYTGETQ----TQCFQTVAAWGVGGGAFELPEVAGIPVGGDDGKTLYRLEVHYNNQDNIAGRVDNSGLRFYYTSQLRQYDAAVLMTGLAVVPGYVIPPNTTNFHSYGVCDTSQVSQVISDPKADLHVFSVILHTHLAGRKIRVGHFRNGEQIDLLAMDEHYNFEFQQAVNLGKTKTIKLGDQLLVECTYNTENRTGLTLGGLATTNEMCLAFLFYYPAMSLSSCVS 471          
BLAST of tyramine beta-hydroxilase vs. Ensembl Cavefish
Match: moxd1l (DBH-like monooxygenase protein 2 homolog [Source:NCBI gene;Acc:103025507])

HSP 1 Score: 231.491 bits (589), Expect = 2.588e-68
Identity = 141/430 (32.79%), Postives = 210/430 (48.84%), Query Frame = 3
Query:  237 WSGIGFSDHGKLENSDLFV--VNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMN------NELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPC-NSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS 1499
            W G GFS +G +E +D+ +  V        D H       + DE+QDY L        Q     +R +  CDK+DY I      +I ++     N+           V+ L +                + P +   ++T+  + IP   T Y CKV+++P LD+K+H+ + E +I   +  +VHH+ L+ C   P          C   E++    T C + +AAW +G  AF  PE  G P+GG++  T   LE+H+NNQD   G +DNSGLR +YT +LRQYDA ++  GL       IPP   +F   G C +     + P   ++VF   LHTHL G ++   HFR   ++  L  D+HY   +Q+   L K   +  GD L+  C Y T NRT +T GG+  T+EMCL ++FYYP + L  C S
Sbjct:   68 WVGFGFSPNGGMEGADIVIGGVGPDGIYFTDRHAVGKFMPLLDEQQDYRLLSLTEADGQTVMKFERLIRACDKDDYPITVMPVKLI-YAYGKTDNITYHRTSRGTKEVNLLKFM------------PKAMLPDSNYFDLTMTNLTIPTENTYYHCKVMKIPLLDQKYHVYRIEPLIE--NMDLVHHLLLYRC---PPTVTTPTEEACYTGETQ----TQCFQTVAAWGVGGGAFELPEVAGIPVGGDDGKTLYRLEVHYNNQDNIAGRVDNSGLRFYYTSQLRQYDAAVLMTGLAVVPGYVIPPNTTNFHSYGVC-DTSQVISDPKADLHVFSVILHTHLAGRKIRVGHFRNGEQIDLLAMDEHYNFEFQQAVNLGKTKTIKLGDQLLVECTYNTENRTGLTLGGLATTNEMCLAFLFYYPAMSLSSCVS 474          
BLAST of tyramine beta-hydroxilase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 85.1149 bits (209), Expect = 7.524e-17
Identity = 83/308 (26.95%), Postives = 129/308 (41.88%), Query Frame = 3
Query:  648 IPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGN-----DVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHF----NNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYP----KIELELCKSSVSDVVFENLP 1532
            +P++  +Y+C  + +P    + +I+ +   +   S    HHM L+ C R+P +     D  R  G C  E+K         ++ AWA  AP    P+ VG  +GG+   TY +L+IH+    N +D  K   D SGL L  T K + + AG+    L  +    IPP +            C+  + P   +Y F  + HTH  G  V     R + +   + R     P  Q    +   + V  GD L   C++    R+  T  G    DEMC  Y+ YY      I    C    S  +F ++P
Sbjct:   68 VPSASDSYYCVAVPVP-TSWEAYIVDF---VPHASMDTAHHMLLYGC-RNPTSTKGYWDCGREQGTCEDEAK---------IMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFRDHHK---DCSGLTLRMTSKPQPFIAGMY---LMMSVDTVIPPGKTVTN----ADIACTYLSYP---MYPFAFRTHTHRLGKVVSGYRIR-NGQWTLIGRQSPQLP--QAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNKHSIPYMDCMDHGSSSLFRSIP 345          
BLAST of tyramine beta-hydroxilase vs. Ensembl Sea Lamprey
Match: moxd1l (monooxygenase, DBH-like 1, like [Source:NCBI gene;Acc:553484])

HSP 1 Score: 233.802 bits (595), Expect = 1.440e-70
Identity = 143/439 (32.57%), Postives = 229/439 (52.16%), Query Frame = 3
Query:  237 WSGIGFSDHGKLENSDLFV--VNRLKFLGF-DLHTNKYGRIIKDERQDY---LLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNII-IFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNY--IEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMC-RKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCS------RQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTF--GGIEITDEMCLNYIFYYPKIELELCKS 1499
            W  +GFS  G +  SD+ +  V+      F D H      +++D  QDY    L++N  +       +QR + TCD +D +++  T  ++  +  K+  +  +  +        + +QLL    P  +  PS  +    VNY   EIPA  T Y C++  +P LD+KHH+IK    + A ++  VHH+ L+ C  S        +  CN  + P   T C   ++A WA+G   F YP + G  +G +    + +LE H++N  +  G+ D+SGLR + T +LR YD+G++E+G+     +FIPP   SF  S Y  E+ S       QA  +  I VF + LH HL G  ++ RHFR+ +++  L RD  Y  +YQE R L ++  VLPGD L+T C Y++T+R+  T    G+   DEMC+ +++YYP++ +  C S
Sbjct:   21 WVAVGFSPTGSMAGSDVALGWVDGTGAAHFMDGHVIDR-EVLRDGSQDYSAVWLRENGTHTH---MRLQRPLRTCDSHDMELNEDTIRVVWAYGAKDPASEADIPYHGPTTRGSMSVQLLGHGPPSEQPLPSNHA-HFDVNYDKFEIPAQSTFYQCEIFPVPKLDRKHHLIKVVPRLQANNEAFVHHILLYTCSASVNASHVGASHECNHPNMPDSFTHCFGGIMAGWAVGGGTFDYPPEAGFSLGAQGDPQFVMLETHYDNPAQLAGVADSSGLRFYITPELRAYDSGMLEVGVNPQPTHFIPPMTPSFMRSIYGHERVSLCPCGHTQARQSGEIQVFATILHAHLLGAAMQVRHFRQGKQIGHLGRDMGYDFNYQEARYLKELTAVLPGDELITECTYRSTSRSHTTTFKVGLSTQDEMCIAFLYYYPRVNVSRCLS 454          
BLAST of tyramine beta-hydroxilase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010103.1 (pep scaffold:Pmarinus_7.0:GL481541:935:16119:1 gene:ENSPMAG00000009144.1 transcript:ENSPMAT00000010103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.861 bits (564), Expect = 3.876e-68
Identity = 109/285 (38.25%), Postives = 160/285 (56.14%), Query Frame = 3
Query:  648 IPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQ-LHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS 1499
            IP   T Y CK+ QLP LDKKHH+IK + VI A ++  VHH+ ++ C+ +           C   S       C+ V+AAWA+G   F YP   G  +G +    + +L++H++N        D+SG R +YT +LR Y+AG++E G+    ++FIPP    F   G C+ K    +   + + V   + LHTHL GI V+ RHFR   ++  L RD  Y   +QE R L K+ +VLPGD ++T CIY T  R   T GG+   DEMCL++ +YYPK+ + +C+S
Sbjct:   10 IPTVATYYSCKLFQLPKLDKKHHLIKVKPVIQAGNERYVHHLLVYVCLNTLNVSYVGSQAECYKYSSTHPFATCKTVMAAWAVGGETFDYPANAGFSLGLDEDPQFLLLQMHYDNAGLVSRANDSSGFRFYYTPELRTYEAGLLETGIFAYSQHFIPPNTARFTSYGICNTKTFYTSNANSTLQVLAVRFLHTHLAGISVQARHFRNGTQIGNLGRDMGYDFDFQETRYLNKLTSVLPGDQIITECIYNTAGRNTTTAGGLGTMDEMCLSFFYYYPKVNVGICRS 294          
BLAST of tyramine beta-hydroxilase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000578.1 (pep scaffold:Pmarinus_7.0:GL478884:14758:39469:-1 gene:ENSPMAG00000000517.1 transcript:ENSPMAT00000000578.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.216 bits (513), Expect = 3.849e-60
Identity = 127/345 (36.81%), Postives = 182/345 (52.75%), Query Frame = 3
Query:  648 IPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLT-----MCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKG----IIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKC--------SRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS-----SVSDVVFENL----------PEKEFRNFK-ETFNRVNWS 1583
            IP  +T Y C V+QLP L KKHH+IK + ++ A +   VHHM ++ C  +           C S    MG T      C  V+AAWA+G   F YP   G  +G +      +LE+H+NN     G    + D+SGLRL+YT  LR+YD GI+E G+     +FIPPK  SF   G C+ +         + Q   +  + VF + LH+HL GI ++ RHFR   ++  L RD  Y    QE R L  +  VLPGD +VT C Y+TT RT  T GG+   +EMCL++++YYPK+ + LC+S     +V+ V+   L          P+  FR F  E ++ + W+
Sbjct:    1 IPPVETNYVCNVMQLPNLTKKHHLIKVQPLVQAGNTRFVHHMIVYACETNVNMSYINTTFQCYSS---MGATNHPSARCLSVLAAWAVGGETFDYPADAGYSLGMDADPKVVMLEMHYNNPQAASGTHTGVSDSSGLRLYYTPNLRKYDTGILETGILPNIYHFIPPKTTSFTSYGICNTRSFVTANSNDTLQGQVSGTMNVFATMLHSHLAGIAIQVRHFRNGNQIGNLGRDMGYDFGLQETRYLNNLTAVLPGDQVVTECTYRTTTRTVTTTGGLSTMNEMCLSFLYYYPKVNIGLCRSMYDITTVAPVMGFTLNSQWPYYITSPQAFFRYFLFEIYDVIPWT 342          
BLAST of tyramine beta-hydroxilase vs. Ensembl Sea Lamprey
Match: moxd1 (monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:570584])

HSP 1 Score: 196.438 bits (498), Expect = 8.151e-58
Identity = 96/263 (36.50%), Postives = 145/263 (55.13%), Query Frame = 3
Query:  723 KYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPA---NGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVT-FGGIEITDEMCLNYIFYYPKIELELCKS 1499
            + E ++    +G+VHH+ L+ C       + +    C   + P     C  ++ AWA+G  AF YP  VG  +G      + ++E H++N  +  GI DNSGLRL YT +LR YDAG++E G+  +  + +PP    +   G+C+ +C  +AL      G+ VF   LH HL G ++  RH+R  REL  L RD  Y  ++QE+ +LP    +LPGD L T C+Y T  R  +T +GG    +EMCL Y+ YYP++ L  C+S
Sbjct:    1 QVEPLVKPGHEGMVHHILLYQCALGLHEAILQSGHRCYQANMPEEFRSCESILFAWAIGGGAFLYPPHVGLSLGEPGDPVFVLMETHYDNPLQLSGIRDNSGLRLHYTAQLRAYDAGVMETGVWVSLYHMVPPHAPHWVSQGHCTRECLNEALGTERPQGVSVFAVLLHAHLAGRELLVRHWRGDRELPLLARDSEYDFNFQELHMLPSERLLLPGDHLTTECVYNTEGRVNMTWWGGQSTHNEMCLAYVLYYPRVNLSRCQS 263          
BLAST of tyramine beta-hydroxilase vs. Ensembl Sea Lamprey
Match: moxd1l (monooxygenase, DBH-like 1, like [Source:NCBI gene;Acc:553484])

HSP 1 Score: 192.586 bits (488), Expect = 1.734e-55
Identity = 124/401 (30.92%), Postives = 184/401 (45.89%), Query Frame = 3
Query:  237 WSGIGFSDHGKLENSDLFV--VNRLKFLGF-DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDF---LNYFVVLLQLLXXXXXXXXXX-XXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFN--NQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQ---ALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNR 1403
            W G+G S  G +  SD+ V  V+        D H      +++D  QDY L     N       + R + TCD ND  I   T  +I  S  N  +  +E  + +   ++     LQLL S             + +I  +   IP   T Y CK+  LP L KKHH+++ E +I   S+ +VHHM ++ C  +           C     P   + C  V+AAWA+G   F YP   G  +G      + +LEIH+N  N+    GI D+SGLR  YT +LR++DAG +  G+  +  +FIPP   SF    +C   C            +  F S + +H  G  +    F    ++  + R++ Y   +QE R L K+V VLPGD +V  C+Y+TTNR
Sbjct:   38 WVGLGLSSTGTMAGSDVVVGWVDSAAATHLVDAHIEGERSLVRDTSQDYKLVRLSENGTHTVMRVVRALRTCDANDRDITENTMRLIWASEDN--DPKSEAQITYHGPMDRGTKSLQLLSSRPRSQPELPQDRSTFDIVQDKCAIPPDSTFYACKIFSLPNLSKKHHLVEVEPIIDPGSEALVHHMVVYMCPDTVNASHVGVTHQCYLAQLPDSFSTCTSVLAAWAIGGGTFEYPPAAGYSLGVPGDPRFVLLEIHYNNPNRSTAAGIEDSSGLRFHYTAQLRRFDAGHLMAGIIVSPFHFIPPNTDSFLNLYHCPSACGNNRWGCYTGQRVRFFSSFVLSHFIGGAIFFTPFENGTQIGDVGREQDYDFKFQETRHLKKLVTVLPGDKIVVECVYRTTNR 436          
BLAST of tyramine beta-hydroxilase vs. Ensembl Nematostella
Match: EDO49634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFN8])

HSP 1 Score: 268.085 bits (684), Expect = 6.715e-83
Identity = 158/453 (34.88%), Postives = 237/453 (52.32%), Query Frame = 3
Query:  153 IYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDL---FVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNII-IFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESK-PMGLTMCRK---VIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQ---ALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKI 1478
            +YWS+  N + I   L  +      F I SG G      ++ +D+   +V +   FL       +Y   I D+  DY L      + +      RK++TCD  D +I  GTT +I     ++ Q+ N+     F     VL+  L S    +   P+    +I +N   +PA  TTY C V  +P   KKHHI++++ V+ + + GIVHH  +  C +     +      C  E+  P  +  CR    ++ AW +G   F YP+ VG+P+G +    Y ++E+H+NN D+  G IDNSG+R FYTD LR+YDAG++ +G   T    IPPKQK +  + YC+++C+        +  I  F + LHTHL G    T+H R   EL  + RD +Y  ++Q+I+ L K V+ LPGD L+  C+Y T +RT VTFGG    DEMCLN++FYYP I
Sbjct:   39 LYWSINHNAKTISFALEAETTGWVGFGISSGSGM-----MKGADIVIGWVKDGKAFLTDRYADGEYMPKI-DDHNDYKLISGTEENGKTILKFSRKIDTCDPRDRKIKIGTTKVIWALDYEDPQSENDMRKHRFRGSRSVLM--LNSQGNSNPPDPAWSHFDILMNNYTVPARHTTYSCHVFTIPKFTKKHHIVRFDPVVQSENAGIVHHFIVMACDKDFPEHLSNDTSECTDEANMPAEVLKCRGRGVLVGAWGVGGGPFVYPDHVGSPLGLDFQGRYFVMEVHYNNPDKLAGKIDNSGVRFFYTDSLRKYDAGVLNVGASVTPWMLIPPKQKEWTTTTYCNKRCNENVSVTQKSRRIKFFSAFLHTHLAGRATWTKHVRNGVELPEIARDDNYDFNFQDIQFLNKEVHFLPGDELIHECVYNTMDRTGVTFGGEATNDEMCLNFMFYYPFI 483          
BLAST of tyramine beta-hydroxilase vs. Ensembl Nematostella
Match: EDO44959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU62])

HSP 1 Score: 244.202 bits (622), Expect = 2.349e-74
Identity = 145/456 (31.80%), Postives = 235/456 (51.54%), Query Frame = 3
Query:  153 IYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGF--DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVV---LLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRS-PGNDVKRFNGPCNSESKPMGLTMCRKV--IAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSR-QALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELC 1493
            +YW+V  +   ++  L  +      F I +G G      +  SD+ +       G+  D + +       D  QD+ L ++   +     +  RK  TCD  D +I+ G+  ++ +S  + ++ +      FL +       L LL       ++       ++  N + IP+  T+Y CK  + P    KHHI+KY  +I++ + G VHHM ++ C  S P +++    G C  ++ P  +  C     IAAWA+G   F YPE VG   G  +   Y +LEIH++N     G+ D+SG+R F+T+K RQ+DAGI+  G        IPP+Q+ +   GYC   C+R  +LP  GI +F    HTHL GI+V TRH R  +EL  + R++HY  +YQE ++L   V+V PGD ++  C Y+T N+     GG+  T+EMC++++ YYP+++L  C
Sbjct:    9 LYWNVNHDESSVKFALRVQATGWVGFGISAGTG-----NMVGSDVVMGWVKDGKGYLQDRYADSKSLPSLDSSQDWHLLESSEENGFTTLSFHRKFYTCDTKDNKIEDGSVRVV-YSYHDTKDPDISDDSTFLYHSARGSRTLILLNVHKKKPQLPAQLSHFDLRHN-LTIPSRLTSYMCKPFEFPQPASKHHIVKYMPLINSKNLGRVHHMLVYGCHSSFPRSNLSHV-GECTDKNMPPAIQRCSGAAPIAAWAIGGEDFYYPEHVGLAFGDGHGPRYVVLEIHYDNPQNDLGVYDDSGIRFFFTNKTRQFDAGILWAGWAPISAMVIPPRQEEWTSIGYCPSNCTRLSSLPDKGINIFAGMEHTHLQGIKVWTRHVRDGKELPEIIREEHYDFNYQEFQVLRNEVHVKPGDDIIQMCKYQTKNKNYPVVGGLGTTEEMCMSFLLYYPQVDLAKC 456          
BLAST of tyramine beta-hydroxilase vs. Ensembl Nematostella
Match: EDO46568 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU2])

HSP 1 Score: 202.601 bits (514), Expect = 7.981e-61
Identity = 104/273 (38.10%), Postives = 161/273 (58.97%), Query Frame = 3
Query:  720 IKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPC-NSESKPMGLTMC--RKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKC-----SRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDV 1514
            ++ E +++  ++G VHH  ++ C  +   ++    GPC +  + P  +T C  +  + AWA+GA  F YP+ VG  IG  +   Y ++E+H++N    +G+ D SGLR  +T + R YDAG+I  G    +   IPP+QK +   GYCS +C     ++  LP  GI +    LHTHL G+++ TRH R   EL  + RD +Y  ++QE ++LP+ V+V PGD LV  C Y+T ++TE   GG+   +EMC+ +I YYPK+EL  C  SV+DV
Sbjct:    5 LQVEPIVTPGNEGYVHHTVVYGCKSTFNPNLTTVTGPCYDRINMPPDITSCAGQSSLWAWAVGAGPFFYPKHVGFAIGAGHGPRYVVMEVHYDNPSNTEGVADYSGLRFHHTAQTRMYDAGMIWAGWAPFDAMIIPPQQKEWISVGYCSGECTEAGFAQSTLPDKGINIIAILLHTHLQGVKIWTRHIRDGVELLEVARDDNYDFNFQEFQVLPEEVHVKPGDDLVQVCHYQTMDKTEPVVGGLGTPEEMCMAFIVYYPKVELTKCW-SVNDV 276          
BLAST of tyramine beta-hydroxilase vs. Ensembl Nematostella
Match: EDO42991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR2])

HSP 1 Score: 166.777 bits (421), Expect = 9.799e-48
Identity = 91/264 (34.47%), Postives = 139/264 (52.65%), Query Frame = 3
Query:  726 YEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNS---ESKPMGLTMCR---KVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQ-----ALPANGIYVFGSQLHTHLTG---IQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPK 1475
            +E  +   ++G VHH  +F C   P  +V   N   +       P  +  C+   ++ AAW +G  AF YP+ VG PIG ++  +  ++E+H++N ++  G  D+SG+R +YTDKLR YD+G   +G        +PPKQ+ +   G+C  +C++Q      LP  GI VF S LHTHL G   + +   H R    L P           QEI+ LP   ++ PGD ++  C Y T +R +  FGG    DEMC+N++ YYP+
Sbjct:    1 FEPAVVPGNEGFVHHFVVFEC--HPRFNVSHLNYTMDCLDFVKMPQEIQTCKTLGEITAAWGVGGGAFVYPDHVGYPIGMQDSGSILVMEVHYDNPEKLTGRFDSSGVRFYYTDKLRLYDSGTWSVGDSVNTWMMVPPKQEEWISEGHCPHQCTKQLLENTTLPEKGINVFASFLHTHLAGKATVMLCVFHVRFLPTLLP-----------QEIQALPLERHIRPGDDVIHYCKYNTMDRQKTVFGGFGTKDEMCINFMLYYPR 251          
BLAST of tyramine beta-hydroxilase vs. Ensembl Nematostella
Match: EDO29630 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T334])

HSP 1 Score: 166.392 bits (420), Expect = 1.078e-47
Identity = 84/236 (35.59%), Postives = 135/236 (57.20%), Query Frame = 3
Query:  720 IKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSE-SKPMGLTMC--RKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKC-----SRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNR 1403
            ++ E +++  ++G VHH  ++ C  +   ++    GPC    + P  +T C  +  + AWA+GA  F YP+ VG  IG  +   Y ++E+H++N    +G+ D SGLR  +T + R YDAG+I  G    +   IPP+QK +   GYCS +C     ++  LP  GI +    LHTHL G+++ TRH R   EL  + RD +Y  ++QE ++LP+ V++ PGD LV  C Y+T ++
Sbjct:    5 LQVEPIVTPGNEGYVHHTVVYGCKSTFNPNLTTVTGPCYDRINMPPDITSCAGQSSLWAWAVGAGPFFYPKHVGFAIGAGHGPRYVVMEVHYDNPSNTEGVADYSGLRFHHTAQTRMYDAGMIWAGWAPFDAMIIPPQQKEWISVGYCSGECTEAGFAQSTLPDKGINIIAILLHTHLQGVKIWTRHIRDGVELPEVARDDNYDFNFQEFQVLPEEVHIKPGDDLVQMCHYQTMDK 240          
BLAST of tyramine beta-hydroxilase vs. Ensembl Medaka
Match: dbh (dopamine beta-hydroxylase [Source:NCBI gene;Acc:101157870])

HSP 1 Score: 377.481 bits (968), Expect = 1.202e-123
Identity = 207/520 (39.81%), Postives = 303/520 (58.27%), Query Frame = 3
Query:  246 IGFSDHGKLENSDLFVV--NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGN-DVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNF-----------------KETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFEC 1745
            +G SD G+L N+DL V+  +  K    D  ++  G +  D +QDY L +     + F    +R  +TCD  DY I+ GT +II   L        EL++  ++  V  + +LR   P   + P  +++++    + IP+ +TTYWC + +LP    K+HII YE+VI+  ++ IVHH+E+F C  SP   DV +++G C+   KP  L  CR V+AAWAMGA AF YP   G  IGG   S +  LE+H++N     G  D+SG+RL YT +LR+YDAGI+ELGL YT    IPPKQ +F L+GYC+ KC++ ALP  GIYVF SQLHTHL G  V T   R  +E++ +  D+H+  HYQ IR+L K+VN+LPGD+L+T C Y T +R++ T GG  I +EMC+NYI YYP+I+LELCKS +     +     ++ NF                  + F++++W D   ++L+  Y+ AP+   CN S +  F G+W     P++ +    LEK  + C
Sbjct:   73 LGMSDRGELTNADLVVLWDSGTKSYFGDAWSDSEGHVSLDSQQDYELIEAKEKPDGFYLLFKRPFSTCDPKDYLIEEGTVHIIYGLLDQPLASLEELNLSRIHTGVQRVLMLRPDDPSPTLGPDLQTIDVVAPDVIIPSQETTYWCFIQKLPENMPKNHIIMYESVITPGNEAIVHHIEVFEC--SPDMMDVPQYSGSCDDNMKPRKLNYCRHVLAAWAMGAEAFYYPPDAGLAIGGPGSSRFLRLEVHYHNPLLIAGRRDSSGIRLHYTPRLRRYDAGIMELGLVYTPVMAIPPKQHTFYLTGYCTSKCTQTALPPGGIYVFASQLHTHLAGRGVRTVLVRGGKEVEIVQEDQHFSTHYQTIRVLRKMVNILPGDVLLTKCTYNTEDRSKPTVGGFGIMEEMCVNYIHYYPRIQLELCKSHIDMGYLQ-----KYFNFINRFHGNEQCVCGEVDVTQQFSQLDWDDFTGEVLDSLYNTAPIFMHCNQSTARLFPGEWEKQPIPVVTST---LEKHRYPC 582          
BLAST of tyramine beta-hydroxilase vs. Ensembl Medaka
Match: dbh (dopamine beta-hydroxylase [Source:NCBI gene;Acc:101157870])

HSP 1 Score: 377.481 bits (968), Expect = 1.296e-123
Identity = 207/516 (40.12%), Postives = 302/516 (58.53%), Query Frame = 3
Query:  246 IGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGN-DVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFE---NLPEKEFRN---------FKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFEC 1745
            +G SD G+L N+DL V+       + G D  ++  G +  D +QDY L +     + F    +R  +TCD  DY I+ GT +II   L        EL++  ++  V  + +LR   P   + P  +++++    + IP+ +TTYWC + +LP    K+HII YE+VI+  ++ IVHH+E+F C  SP   DV +++G C+   KP  L  CR V+AAWAMGA AF YP   G  IGG   S +  LE+H++N     G  D+SG+RL YT +LR+YDAGI+ELGL YT    IPPKQ +F L+GYC+ KC++ ALP  GIYVF SQLHTHL G  V T   R  +E++ +  D+H+  HYQ IR+L K+VN+LPGD+L+T C Y T +R++ T GG  I +EMC+NYI YYP+I+LELCKS +     +   N   +   N           + F++++W D   ++L+  Y+ AP+   CN S +  F G+W     P++ +    LEK  + C
Sbjct:   73 LGMSDRGELTNADLVVLWDSGTKSYFG-DAWSDSEGHVSLDSQQDYELIEAKEKPDGFYLLFKRPFSTCDPKDYLIEEGTVHIIYGLLDQPLASLEELNLSRIHTGVQRVLMLRPDDPSPTLGPDLQTIDVVAPDVIIPSQETTYWCFIQKLPENMPKNHIIMYESVITPGNEAIVHHIEVFEC--SPDMMDVPQYSGSCDDNMKPRKLNYCRHVLAAWAMGAEAFYYPPDAGLAIGGPGSSRFLRLEVHYHNPLLIAGRRDSSGIRLHYTPRLRRYDAGIMELGLVYTPVMAIPPKQHTFYLTGYCTSKCTQTALPPGGIYVFASQLHTHLAGRGVRTVLVRGGKEVEIVQEDQHFSTHYQTIRVLRKMVNILPGDVLLTKCTYNTEDRSKPTVGGFGIMEEMCVNYIHYYPRIQLELCKSHIDMGYLQKYFNFINRFHGNEQCVCGEVDVTQQFSQLDWDDFTGEVLDSLYNTAPIFMHCNQSTARLFPGEWEKQPIPVVTST---LEKHRYPC 582          
BLAST of tyramine beta-hydroxilase vs. Ensembl Medaka
Match: dbh (dopamine beta-hydroxylase [Source:NCBI gene;Acc:101157870])

HSP 1 Score: 377.867 bits (969), Expect = 1.811e-123
Identity = 207/521 (39.73%), Postives = 303/521 (58.16%), Query Frame = 3
Query:  246 IGFSDHGKLENSDLFVV---NRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGN-DVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNF-----------------KETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFEC 1745
            +G SD G+L N+DL V+       + G D  ++  G +  D +QDY L +     + F    +R  +TCD  DY I+ GT +II   L        EL++  ++  V  + +LR   P   + P  +++++    + IP+ +TTYWC + +LP    K+HII YE+VI+  ++ IVHH+E+F C  SP   DV +++G C+   KP  L  CR V+AAWAMGA AF YP   G  IGG   S +  LE+H++N     G  D+SG+RL YT +LR+YDAGI+ELGL YT    IPPKQ +F L+GYC+ KC++ ALP  GIYVF SQLHTHL G  V T   R  +E++ +  D+H+  HYQ IR+L K+VN+LPGD+L+T C Y T +R++ T GG  I +EMC+NYI YYP+I+LELCKS +     +     ++ NF                  + F++++W D   ++L+  Y+ AP+   CN S +  F G+W     P++ +    LEK  + C
Sbjct:   97 LGMSDRGELTNADLVVLWDSGTKSYFG-DAWSDSEGHVSLDSQQDYELIEAKEKPDGFYLLFKRPFSTCDPKDYLIEEGTVHIIYGLLDQPLASLEELNLSRIHTGVQRVLMLRPDDPSPTLGPDLQTIDVVAPDVIIPSQETTYWCFIQKLPENMPKNHIIMYESVITPGNEAIVHHIEVFEC--SPDMMDVPQYSGSCDDNMKPRKLNYCRHVLAAWAMGAEAFYYPPDAGLAIGGPGSSRFLRLEVHYHNPLLIAGRRDSSGIRLHYTPRLRRYDAGIMELGLVYTPVMAIPPKQHTFYLTGYCTSKCTQTALPPGGIYVFASQLHTHLAGRGVRTVLVRGGKEVEIVQEDQHFSTHYQTIRVLRKMVNILPGDVLLTKCTYNTEDRSKPTVGGFGIMEEMCVNYIHYYPRIQLELCKSHIDMGYLQ-----KYFNFINRFHGNEQCVCGEVDVTQQFSQLDWDDFTGEVLDSLYNTAPIFMHCNQSTARLFPGEWEKQPIPVVTST---LEKHRYPC 606          
BLAST of tyramine beta-hydroxilase vs. Ensembl Medaka
Match: moxd1l (DBH-like monooxygenase protein 2 homolog [Source:NCBI gene;Acc:101169083])

HSP 1 Score: 219.55 bits (558), Expect = 2.044e-64
Identity = 145/436 (33.26%), Postives = 211/436 (48.39%), Query Frame = 3
Query:  237 WSGIGFSDHGKLENSDLFVVNRLKFLGF--DLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIF-----SLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKG-IIDNSGLRLFYTDKLRQYDAGIIELGLE--YTEKNFIPPKQKSFALSGYC-----SEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKS 1499
            W  +GFS  G++  +D+ +        +  D H  +    + D+ Q Y L   + N  Q   T QR + +CD+ D+ I      +I        +K          V+ LNY                 + +   + + V  + +P+++T Y CKV++L  L  KHHI + E  I   +  IVHHM L+HC   P      +  PC      +G  +C  V+AAW  G   +  PE  G PIGGEN +    LEIH+NN  +K G +IDNSGLRL+YTD+LRQ+D GI+  G+      K  IPPK   F   G C     S+ C    +P   + VF   LHTHL G +V   HFRK +++  L  +++Y    Q+   L  I  V+ GD ++  C Y T +RT  T  G+   DEMCL +++YYP I +  C S
Sbjct:   60 WISLGFSPSGEMYGADIVIGGVGPNGNYFNDYHAKEEVMPLLDKEQSYTLLSMMENDGQTIMTFQRAIQSCDEEDFHITAQPIKLIYAYGTSDEIKYHGPRRGTKEVNLLNYV------------PRTSNANATYLSVKVTNVPVPSNKTYYHCKVMKLSDLSTKHHIYQIEPEIE--NPDIVHHMLLYHC---PPTVTTPYENPCYRGD--LG-DVCFGVVAAWGTGGGVYELPENAGIPIGGENKNILYRLEIHYNNPQQKAGSVIDNSGLRLYYTDQLRQHDVGILNTGVLPILPVKYNIPPKAAEFHTYGLCNTSYFSQVCLVSPMPD--LQVFAVLLHTHLAGRKVRVGHFRKGKQIDFLGLNENYNFEMQQTVNLGSIKTVMEGDEIIVECTYNTEDRTGPTKIGLSTFDEMCLAFLYYYPAISVTSCLS 473          
BLAST of tyramine beta-hydroxilase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 73.1738 bits (178), Expect = 5.129e-13
Identity = 79/308 (25.65%), Postives = 120/308 (38.96%), Query Frame = 3
Query:  651 PASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGN----DVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNN----QDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYP----KIELELCKSSVSDVVFENLPEK 1538
            P++  TY C    +P  ++  +I+ +   I   S   VHHM LF C          D     G C  +           ++ AWA  AP    P+ VG  +G  +  +Y +L++H+ +    +D  +   D SGL L  T K + + AGI    L  +    IPP +            C   + P   IY F  + HTH  G  V     R  +    + R     P  Q    +   ++V  GD +   C++    RT  T  G    DEMC  Y+ YY      +    C  S S   F ++P +
Sbjct:   60 PSNSDTYLCMAFPVP-TNQDSYIVDF---IPHASMNTVHHMILFGCQSPSSASSSWDCGGALGTCKDDPS---------IMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFRDHHR---DCSGLTLRMTSKPQPFVAGIY---LLMSVDTVIPPGKTVTNA----DVACDYASYP---IYPFAFRTHTHRLGKVVSGYRIRNGK-WTLIGRQSPQLP--QAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFYMMYYMDRRHAVPFMSCMESGSREQFRHIPAE 338          
BLAST of tyramine beta-hydroxilase vs. Planmine SMEST
Match: SMESG000005292.1 (SMESG000005292.1)

HSP 1 Score: 1105.89 bits (2859), Expect = 0.000e+0
Identity = 551/571 (96.50%), Postives = 553/571 (96.85%), Query Frame = 3
Query:   45 MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRR 1757
            MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPA TYPEQ                 IHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDL+KQSFECLMR+
Sbjct:    1 MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPALTYPEQ-----------------IHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLKKQSFECLMRK 554          
BLAST of tyramine beta-hydroxilase vs. Planmine SMEST
Match: SMESG000005292.1 (SMESG000005292.1)

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 546/571 (95.62%), Postives = 548/571 (95.97%), Query Frame = 3
Query:   45 MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLXXXXXXXXXXXXXXXMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLEKQSFECLMRR 1757
            MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPA TYPEQV                      DEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDL+KQSFECLMR+
Sbjct:    1 MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQLKLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYGRIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIFSLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYIEIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPALTYPEQV----------------------DEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEFRNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIITPILETRDYDLKKQSFECLMRK 549          
BLAST of tyramine beta-hydroxilase vs. Planmine SMEST
Match: SMESG000057300.1 (SMESG000057300.1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.093e-17
Identity = 74/273 (27.11%), Postives = 115/273 (42.12%), Query Frame = 3
Query:  669 YWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCR----KVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYYPK 1475
            Y C    +P  ++  +I+ YE + +++   I HHM LF C  SP +    F  PC S        +C     K++  WA  A +F YP   G  +GG++   Y +L++H+    +   I D SGL L  + K   Y  GI  L   Y +   I P+ +   L   C  K + +A      Y    + H H  G  +    ++       +       P + +       V + PGDIL+  C++ +T +  VT  G    DEMC  YI    K
Sbjct:   37 YICSSFPVPNHNENSYIVSYEPLANSS---IAHHMLLFGC-SSPFSTEPSF--PCRS--------ICENSREKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYL---KPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGK---IQPQTRKVNLDVSCRYKGNSEA------YTLAFRTHAHALGRSISG--YKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGYTHMDEMCNFYIMMVTK 281          
BLAST of tyramine beta-hydroxilase vs. Planmine SMEST
Match: SMESG000073851.1 (SMESG000073851.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.505e-9
Identity = 66/279 (23.66%), Postives = 102/279 (36.56%), Query Frame = 3
Query:  651 PASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCR---KVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQD---EKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYY 1469
            P  +  Y C       LD K+  +         S    HH+ L H    PG+    +N  C   +      +C+   K++ +WAM A  F  P+ V   IG      Y +++ H+ N D   +     D SG+ +    K     AGI  L  + +    IP     F +   CS        P      F  ++HTH  G  V      +    +   +    +  +  ++     V + PGD L   CI +      V  G     DEMC  YI+Y+
Sbjct:   27 PTKEDQYICHA-----LDLKNDTLFITGFNPKASASHAHHI-LIHSCTEPGSVKPYWN--CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGS----IPGHSTVF-MEAACSYTGKTVLHP------FAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVK---GTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 282          
BLAST of tyramine beta-hydroxilase vs. Planmine SMEST
Match: SMESG000073851.1 (SMESG000073851.1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.453e-9
Identity = 66/279 (23.66%), Postives = 102/279 (36.56%), Query Frame = 3
Query:  651 PASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIRSPGNDVKRFNGPCNSESKPMGLTMCR---KVIAAWAMGAPAFTYPEQVGNPIGGENFSTYAILEIHFNNQD---EKKGIIDNSGLRLFYTDKLRQYDAGIIELGLEYTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQVETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKTTNRTEVTFGGIEITDEMCLNYIFYY 1469
            P  +  Y C       LD K+  +         S    HH+ L H    PG+    +N  C   +      +C+   K++ +WAM A  F  P+ V   IG      Y +++ H+ N D   +     D SG+ +    K     AGI  L  + +    IP     F +   CS        P      F  ++HTH  G  V      +    +   +    +  +  ++     V + PGD L   CI +      V  G     DEMC  YI+Y+
Sbjct:    6 PTKEDQYICHA-----LDLKNDTLFITGFNPKASASHAHHI-LIHSCTEPGSVKPYWN--CEEMNAKDSKPICKSGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLLATDGS----IPGHSTVF-MEAACSYTGKTVLHP------FAYRVHTHSLGKLVSGYVIHRKNWTEIGKKSPQVEQMFYPVK---GTVKIYPGDTLAARCIMENKGDKLVKIGNTR-KDEMCNFYIYYW 261          
The following BLAST results are available for this feature:
BLAST of tyramine beta-hydroxilase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DBH3.076e-13039.02dopamine beta-hydroxylase [Source:HGNC Symbol;Acc:... [more]
MOXD11.030e-8131.38monooxygenase DBH like 1 [Source:HGNC Symbol;Acc:H... [more]
MOXD11.969e-7832.19monooxygenase DBH like 1 [Source:HGNC Symbol;Acc:H... [more]
DBH5.928e-2528.23dopamine beta-hydroxylase [Source:HGNC Symbol;Acc:... [more]
PAM5.650e-1726.64peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tbh-11.146e-10334.62Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
tbh-11.294e-10334.62Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
tbh-15.361e-10334.62Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
pghm-16.629e-1423.32Probable peptidylglycine alpha-hydroxylating monoo... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbh5.042e-12138.97gene:FBgn0010329 transcript:FBtr0089999[more]
Tbh5.042e-12138.97gene:FBgn0010329 transcript:FBtr0340409[more]
CG52354.088e-7332.44gene:FBgn0036565 transcript:FBtr0333599[more]
CG52354.088e-7332.44gene:FBgn0036565 transcript:FBtr0075497[more]
olf4134.449e-6030.04gene:FBgn0037153 transcript:FBtr0333219[more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbh1.555e-12639.77dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
dbh1.694e-12639.77dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
moxd14.998e-8030.74monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:57... [more]
moxd12.616e-7930.54monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:57... [more]
moxd14.962e-7930.92monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:57... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enc1.26.700e-13138.15ectodermal-neural cortex (with BTB-like domain), g... [more]
enc1.22.102e-12036.66ectodermal-neural cortex (with BTB-like domain), g... [more]
kank14.014e-8631.64KN motif and ankyrin repeat domains 1 [Source:Xenb... [more]
kank15.892e-8631.83KN motif and ankyrin repeat domains 1 [Source:Xenb... [more]
lamb34.907e-5929.29laminin subunit beta 3 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dbh6.993e-13438.20dopamine beta hydroxylase [Source:MGI Symbol;Acc:M... [more]
Moxd14.775e-8630.99monooxygenase, DBH-like 1 [Source:MGI Symbol;Acc:M... [more]
Moxd23.552e-6330.15monooxygenase, DBH-like 2 [Source:MGI Symbol;Acc:M... [more]
Pam1.465e-1928.10peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Pam2.014e-1928.10peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64237|DOPO_MOUSE4.892e-13338.20Dopamine beta-hydroxylase OS=Mus musculus OX=10090... [more]
sp|P15101|DOPO_BOVIN7.948e-13238.18Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN... [more]
sp|P09172|DOPO_HUMAN1.477e-12939.02Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 ... [more]
sp|Q9XTA0|DOPO_HORSE1.413e-12837.22Dopamine beta-hydroxylase OS=Equus caballus OX=979... [more]
sp|Q05754|DOPO_RAT4.246e-12336.95Dopamine beta-hydroxylase OS=Rattus norvegicus OX=... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9N4S90.000e+099.02Tyramine beta-hydroxilase (Fragment) OS=Schmidtea ... [more]
B6ZH610.000e+066.00Tyramine beta-hydroxylase OS=Dugesia japonica OX=6... [more]
A0A3S5HJL83.360e-14842.01Tyramine beta-hydroxylase OS=Lymnaea stagnalis OX=... [more]
I7HHD73.470e-14842.01Tyramine beta hydroxylase OS=Lymnaea stagnalis OX=... [more]
A0A2C9LHW43.939e-14641.36DOMON domain-containing protein OS=Biomphalaria gl... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbh1.010e-10937.74dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
moxd13.948e-8530.22monooxygenase DBH like 1 [Source:NCBI gene;Acc:103... [more]
moxd1l1.579e-6932.87DBH-like monooxygenase protein 2 homolog [Source:N... [more]
moxd1l2.588e-6832.79DBH-like monooxygenase protein 2 homolog [Source:N... [more]
pam7.524e-1726.95peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
moxd1l1.440e-7032.57monooxygenase, DBH-like 1, like [Source:NCBI gene;... [more]
ENSPMAT00000010103.13.876e-6838.25pep scaffold:Pmarinus_7.0:GL481541:935:16119:1 gen... [more]
ENSPMAT00000000578.13.849e-6036.81pep scaffold:Pmarinus_7.0:GL478884:14758:39469:-1 ... [more]
moxd18.151e-5836.50monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:57... [more]
moxd1l1.734e-5530.92monooxygenase, DBH-like 1, like [Source:NCBI gene;... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496346.715e-8334.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449592.349e-7431.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465687.981e-6138.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429919.799e-4834.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296301.078e-4735.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbh1.202e-12339.81dopamine beta-hydroxylase [Source:NCBI gene;Acc:10... [more]
dbh1.296e-12340.12dopamine beta-hydroxylase [Source:NCBI gene;Acc:10... [more]
dbh1.811e-12339.73dopamine beta-hydroxylase [Source:NCBI gene;Acc:10... [more]
moxd1l2.044e-6433.26DBH-like monooxygenase protein 2 homolog [Source:N... [more]
pam5.129e-1325.65peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of tyramine beta-hydroxilase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005292.10.000e+096.50SMESG000005292.1[more]
SMESG000005292.10.000e+095.62SMESG000005292.1[more]
SMESG000057300.13.093e-1727.11SMESG000057300.1[more]
SMESG000073851.11.505e-923.66SMESG000073851.1[more]
SMESG000073851.12.453e-923.66SMESG000073851.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30017498
GenBankAFD34360.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017498 ID=SMED30017498|Name=tyramine beta-hydroxilase|organism=Schmidtea mediterranea sexual|type=transcript|length=1760bp
CGAAAAAATAAATTGTGAATTTAATCGTTTATCGAACAGAAATTATGCGT
TTAATTTTACTCCACGTTTTCATTATCTTAAAAATTGTGATATCTTATAC
AAAACCGTATCAATATCATGCAACGTATTCGCGGACCGAAGGCGTTTATG
ACATTTATTGGTCTGTTGAACCGAATCTCGAAAAAATTCAACTGAAATTA
TGTCAAAAACTAAACAAGCAATTCAGCTTTCCGATTTGGTCTGGAATAGG
ATTTTCCGATCACGGAAAATTGGAAAATTCTGATCTGTTTGTGGTGAATC
GGTTAAAATTTCTTGGATTTGATTTACACACAAATAAATATGGTAGAATT
ATTAAAGATGAAAGACAGGATTATTTATTAAAAGATAATATTATAAATCA
TGAACAGTTTTGTTTTACGATTCAAAGAAAGGTAAACACCTGTGACAAAA
ATGATTATCAAATTGATAGAGGTACAACAAATATAATTATATTTTCACTG
AAAAATAAACAAAATATGAATAATGAGCTTCACGTTGATTTTCTCAATTA
TTTTGTTGTTCTTTTACAATTACTTAGAAGCACAATTCCTATTTCTGAAA
TCTCCCCGTCAACCCGGTCTATGGAAATTACAGTCAATTATATAGAAATA
CCGGCTTCGCAGACCACTTACTGGTGTAAAGTAATTCAATTACCATATTT
GGATAAAAAACATCATATAATAAAATATGAAGCAGTTATCAGTGCAACAA
GTCAAGGTATTGTGCACCATATGGAATTATTTCACTGTATCCGTTCACCG
GGAAATGATGTGAAACGATTTAATGGTCCCTGTAATTCAGAAAGTAAGCC
CATGGGTTTGACAATGTGCAGAAAGGTTATTGCAGCTTGGGCTATGGGTG
CACCGGCATTTACCTATCCTGAACAAGTGGGTAATCCAATTGGCGGAGAA
AACTTTTCAACTTATGCTATTTTGGAGATTCATTTTAATAATCAAGATGA
AAAAAAAGGTATTATAGACAACAGTGGATTGAGACTCTTCTATACTGATA
AACTAAGGCAATACGACGCAGGAATTATTGAATTGGGTTTAGAATATACA
GAAAAAAACTTCATTCCTCCGAAACAAAAAAGTTTTGCCTTATCTGGTTA
TTGTTCAGAAAAATGTTCCAGACAAGCACTGCCAGCAAATGGAATTTATG
TTTTCGGATCTCAACTGCATACCCATCTAACAGGAATTCAAGTTGAAACG
AGGCATTTTAGAAAGCATAGAGAATTGAAACCATTAAATAGAGATAAGCA
TTATCAACCACATTATCAGGAAATTAGATTACTACCAAAAATTGTCAATG
TACTTCCGGGAGACATTCTTGTTACGACTTGTATTTATAAGACCACTAAT
CGGACTGAAGTAACATTCGGAGGAATTGAGATAACCGATGAAATGTGCTT
AAATTACATTTTTTACTATCCGAAAATAGAGTTGGAATTATGTAAGTCTA
GTGTTAGTGATGTTGTTTTTGAAAATTTACCCGAAAAAGAATTTCGAAAT
TTTAAAGAGACATTCAATCGAGTAAATTGGTCTGACAAAAATTCAAAACT
GCTAGAAAGGTTTTACGATGAAGCTCCGGTACACCAGTCTTGTAACATGT
CTGACAGCGACTCTTTTGAGGGAGATTGGAATGCTATTATCACTCCGATA
CTGGAAACCAGAGATTATGATTTGGAAAAACAGAGTTTTGAGTGTCTAAT
GAGGAGATCG
back to top

protein sequence of SMED30017498-orf-1

>SMED30017498-orf-1 ID=SMED30017498-orf-1|Name=SMED30017498-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=572bp
MRLILLHVFIILKIVISYTKPYQYHATYSRTEGVYDIYWSVEPNLEKIQL
KLCQKLNKQFSFPIWSGIGFSDHGKLENSDLFVVNRLKFLGFDLHTNKYG
RIIKDERQDYLLKDNIINHEQFCFTIQRKVNTCDKNDYQIDRGTTNIIIF
SLKNKQNMNNELHVDFLNYFVVLLQLLRSTIPISEISPSTRSMEITVNYI
EIPASQTTYWCKVIQLPYLDKKHHIIKYEAVISATSQGIVHHMELFHCIR
SPGNDVKRFNGPCNSESKPMGLTMCRKVIAAWAMGAPAFTYPEQVGNPIG
GENFSTYAILEIHFNNQDEKKGIIDNSGLRLFYTDKLRQYDAGIIELGLE
YTEKNFIPPKQKSFALSGYCSEKCSRQALPANGIYVFGSQLHTHLTGIQV
ETRHFRKHRELKPLNRDKHYQPHYQEIRLLPKIVNVLPGDILVTTCIYKT
TNRTEVTFGGIEITDEMCLNYIFYYPKIELELCKSSVSDVVFENLPEKEF
RNFKETFNRVNWSDKNSKLLERFYDEAPVHQSCNMSDSDSFEGDWNAIIT
PILETRDYDLEKQSFECLMRRS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004500dopamine beta-monooxygenase activity
GO:0016715oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
GO:0005507copper ion binding
GO:0004497monooxygenase activity
GO:0003824catalytic activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000198RhoGAP_dom
IPR000945DBH-rel
IPR024548Cu2_monoox_C
IPR014784Cu2_ascorb_mOase-like_C
IPR000323Cu2_ascorb_mOase_N
IPR005018DOMON_domain
IPR020611Cu2_ascorb_mOase_CS-1
IPR008977PHM/PNGase_F_dom_sf
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0055114oxidation-reduction process