Intraflagellar transport protein 57

Overview
NameIntraflagellar transport protein 57
Smed IDSMED30017476
Length (bp)1326
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intraflagellar transport protein 57 (SMED30017476) t-SNE clustered cells

Violin plots show distribution of expression levels for Intraflagellar transport protein 57 (SMED30017476) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intraflagellar transport protein 57 (SMED30017476) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intraflagellar transport protein 57 (SMED30017476) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017476

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017476SMESG000013668.1 SmedASXL_001548SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017476SMESG000013668.1 Contig20925uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017476SMESG000013668.1 Contig20925newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017476SMESG000013668.1 Contig53039uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017476SMESG000013668.1 Contig53039newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30017476SMESG000013668.1 dd_Smed_v6_7099_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017476SMESG000013668.1 dd_Smed_v4_7099_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intraflagellar transport protein 57 vs. Ensembl Human
Match: IFT57 (intraflagellar transport 57 [Source:HGNC Symbol;Acc:HGNC:17367])

HSP 1 Score: 287.73 bits (735), Expect = 1.513e-92
Identity = 164/395 (41.52%), Postives = 252/395 (63.80%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            E GPG A+ +F  ME ++E LK++ YE  + +   +K  SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE++  VL   ++ ALK  GF W  P +  E   E     D+     +       + +F  ++ D++E    L++      +   +  A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LD+L +E+ +++EKI++REKY+NNQ+E+ + +YR AQ  L   +E+ ++ +GG+ +R ++L+E+ EEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  +M IR G++EH LLQ  LK KS+
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNK-----VDEEFVEEETDNEENFIDLNVLKAQTYHLDMNETAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALKETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVMEELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSN 411          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Human
Match: IFT57 (intraflagellar transport 57 [Source:HGNC Symbol;Acc:HGNC:17367])

HSP 1 Score: 93.9745 bits (232), Expect = 3.602e-22
Identity = 49/124 (39.52%), Postives = 66/124 (53.23%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISR-------------------------------HYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVR 385
            E GPG A+ +F  ME ++E LK++ YE  + +   +K  SR                               HYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRWVPASPSARVPASPQGDALLGPAGNQFRESGHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELR 154          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Celegans
Match: che-13 (Intraflagellar transport protein che-13 [Source:UniProtKB/Swiss-Prot;Acc:Q93833])

HSP 1 Score: 125.946 bits (315), Expect = 1.594e-32
Identity = 59/159 (37.11%), Postives = 106/159 (66.67%), Query Frame = 2
Query:  722 ESVKP-DGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQA 1195
            ES  P   +++S  ++  W  EVERV PQLK+T++ +++DWR H +QM+    ++++      P+LD +  ++ K++E+IA+REK LN+Q+   +S +R A D    +REK K AS G++ R + L  ++++++++KQQ+EE+G   SDG P+ +++QA
Sbjct:  126 ESKNPLQSVLQSNTDAITWKQEVERVAPQLKITLKQDAKDWRLHLEQMNSMHKNVEQKVGNVGPYLDNMSKDIAKALERIASREKSLNSQLASMMSKFRRATDTRAELREKYKAASVGVSSRTETLDRISDDIEQLKQQIEEQGAKSSDGAPLVKIKQA 284          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Celegans
Match: che-13 (Intraflagellar transport protein che-13 [Source:UniProtKB/Swiss-Prot;Acc:Q93833])

HSP 1 Score: 126.331 bits (316), Expect = 5.177e-32
Identity = 59/161 (36.65%), Postives = 106/161 (65.84%), Query Frame = 2
Query:  716 TAESVKP-DGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQA 1195
              ES  P   +++S  ++  W  EVERV PQLK+T++ +++DWR H +QM+    ++++      P+LD +  ++ K++E+IA+REK LN+Q+   +S +R A D    +REK K AS G++ R + L  ++++++++KQQ+EE+G   SDG P+ +++QA
Sbjct:  211 ATESKNPLQSVLQSNTDAITWKQEVERVAPQLKITLKQDAKDWRLHLEQMNSMHKNVEQKVGNVGPYLDNMSKDIAKALERIASREKSLNSQLASMMSKFRRATDTRAELREKYKAASVGVSSRTETLDRISDDIEQLKQQIEEQGAKSSDGAPLVKIKQA 371          

HSP 2 Score: 112.849 bits (281), Expect = 3.763e-27
Identity = 51/135 (37.78%), Postives = 84/135 (62.22%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCK-PFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLE-MDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIW 505
            E+GPG  ++++   E +++ LK+++YE  + K   + KPI +HYF    N GEQF  F SL+AWL+++ G E  + PQ++DDPN++++ I+ A +        +  KLKSG GE ++ +L  L+D +L   GF W
Sbjct:   23 EDGPGKEYEIYIKNEELVDKLKLLNYEDGFLKLGVVYKPILKHYFVKSKNVGEQFFLFTSLAAWLIKKSGDESYNMPQEFDDPNSTLANIMAAAKNKGIATDFTAAKLKSGAGENVIFILNSLADASLVHVGFQW 157          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Fly
Match: IFT57 (gene:FBgn0031550 transcript:FBtr0077529)

HSP 1 Score: 92.8189 bits (229), Expect = 2.719e-20
Identity = 51/142 (35.92%), Postives = 84/142 (59.15%), Query Frame = 2
Query:  770 EWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQA 1195
            EW LE+ERVLPQLKV ++ ++RDWRTH  QM   +T++ +  D     L +L  E    +EKI +REK+LNN+++  +  ++     L  ++  + +    + ++   L E+  E +  K++ME RG  MSDG  V ++R+A
Sbjct:  221 EWHLELERVLPQLKVFVKADARDWRTHISQMETLKTNILENSDTAEAQLKKLHSEFTFDLEKIESREKHLNNELKPLIQQFKELSIELSTIQYAQNQLQEDMEKQTAELNEVMMEQELKKEEMERRGQAMSDGSSVQQIRKA 362          

HSP 2 Score: 92.8189 bits (229), Expect = 2.931e-20
Identity = 42/103 (40.78%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  179 DYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALK 487
            +YE++  K F +KP+SR YF   TNPGEQF  F  +  WL ++ G +M++PQ+YDDPN   + I++ + +I   +   P KL  G G   + VL++LS  A K
Sbjct:   29 NYEKHLLKEFKLKPLSRFYFVKATNPGEQFYMFTLICWWLCKKLGKDMERPQEYDDPNTVAANIIKLLGEIDVPVDFQPNKLIRGAGPICLSVLEVLSTQACK 131          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Zebrafish
Match: ift57 (intraflagellar transport 57 homolog (Chlamydomonas) [Source:NCBI gene;Acc:414929])

HSP 1 Score: 178.333 bits (451), Expect = 5.083e-51
Identity = 88/171 (51.46%), Postives = 135/171 (78.95%), Query Frame = 2
Query:  731 KPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            +P  ++ES +++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+Q  +     + +  L +L ++++K++EK+++REKYLN Q+EH +S+YR AQ  L  V+E  ++ASGG+ +R +ILAE++EELD++KQ+MEE+G++MSDG PV ++RQ++ KLK E++QM +R G
Sbjct:  203 RPAVVLESDVDAAEWNLEVERVLPQLKVTIRTDNKDWRIHLDQMHQHQDGINTSLQDAKGCLFKLREDISKTLEKVSSREKYLNTQLEHLISEYRQAQSQLNKVKELYQQASGGVTERTRILAEISEELDKVKQEMEEKGSSMSDGAPVVKIRQSLTKLKQEIEQMDVRMG 373          

HSP 2 Score: 142.895 bits (359), Expect = 7.663e-38
Identity = 63/142 (44.37%), Postives = 92/142 (64.79%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFA----LPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRF 520
            E GPG  +++F  ME +L+ LKV+DYE++      +KP+SRHYF     + +NPGEQF  F  ++AWL+  CG   D PQ+YDDPNA++S IL  +R +   +   P+KLK+G GE++  VL  L + ALK +GF W+ P +
Sbjct:    6 ERGPGSVYQMFVLMEDLLDKLKVLDYEQHVLDKHNIKPLSRHYFVSSPHVLSNPGEQFYMFSVIAAWLITLCGRPFDTPQEYDDPNATVSNILSELRTLGGQVDFPPSKLKTGSGEHVCYVLDQLVEKALKSKGFAWNRPLY 147          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Xenopus
Match: ift57 (intraflagellar transport 57 [Source:NCBI gene;Acc:549315])

HSP 1 Score: 189.889 bits (481), Expect = 2.341e-55
Identity = 101/192 (52.60%), Postives = 152/192 (79.17%), Query Frame = 2
Query:  716 TAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            T ES KP+ I+ES  ++AEW+LEVERVLPQLKVTIR +++DWR H DQMHQ++  +     ET+ +LD+L +E+ K++EK+++REKY+NNQ+E  + +YR  Q  L   +E+ ++ASGG+ +R +ILAE+TEEL+++KQ+MEE+G++M+DG P+ +++QA+ KLK E+ QM IR+G++EH LLQ TLK KS+
Sbjct:  178 TKESSKPEEILESNTDAAEWILEVERVLPQLKVTIRTDNKDWRVHVDQMHQHRDGIDTSLKETKGYLDKLHNEVAKALEKVSSREKYINNQLEQLVQEYRSVQAQLSEAKERYQQASGGVTERTRILAEITEELEKVKQEMEEKGSSMTDGAPLVKIKQALTKLKHEIVQMDIRTGVVEHTLLQSTLKEKSN 369          

HSP 2 Score: 139.428 bits (350), Expect = 1.724e-36
Identity = 65/143 (45.45%), Postives = 91/143 (63.64%), Query Frame = 2
Query:   92 VDGTNEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRF 520
             D  ++ GPG A++ F  ME +L+ LK++ YE    +   MKP+SRHYFALPTNPGEQF  F +L+AWL+ + G   DQPQ+YDDPNA+IS IL  +R    ++   P++LK+G GE +  VL   ++  LK   F W  P +
Sbjct:    2 ADSDDDRGPGAAYQAFLMMEDLLDKLKLLSYEDEVLRKQNMKPLSRHYFALPTNPGEQFYMFCTLAAWLISKAGHHFDQPQEYDDPNATISNILSELRSFGYSVDFPPSRLKAGYGEQVCYVLDCFAEEVLKHIHFSWKRPTY 144          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Xenopus
Match: ift57 (intraflagellar transport 57 [Source:NCBI gene;Acc:549315])

HSP 1 Score: 189.504 bits (480), Expect = 5.287e-55
Identity = 101/192 (52.60%), Postives = 152/192 (79.17%), Query Frame = 2
Query:  716 TAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            T ES KP+ I+ES  ++AEW+LEVERVLPQLKVTIR +++DWR H DQMHQ++  +     ET+ +LD+L +E+ K++EK+++REKY+NNQ+E  + +YR  Q  L   +E+ ++ASGG+ +R +ILAE+TEEL+++KQ+MEE+G++M+DG P+ +++QA+ KLK E+ QM IR+G++EH LLQ TLK KS+
Sbjct:  202 TKESSKPEEILESNTDAAEWILEVERVLPQLKVTIRTDNKDWRVHVDQMHQHRDGIDTSLKETKGYLDKLHNEVAKALEKVSSREKYINNQLEQLVQEYRSVQAQLSEAKERYQQASGGVTERTRILAEITEELEKVKQEMEEKGSSMTDGAPLVKIKQALTKLKHEIVQMDIRTGVVEHTLLQSTLKEKSN 393          

HSP 2 Score: 138.272 bits (347), Expect = 6.939e-36
Identity = 64/139 (46.04%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  104 NEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRF 520
            ++ GPG A++ F  ME +L+ LK++ YE    +   MKP+SRHYFALPTNPGEQF  F +L+AWL+ + G   DQPQ+YDDPNA+IS IL  +R    ++   P++LK+G GE +  VL   ++  LK   F W  P +
Sbjct:   11 DDRGPGAAYQAFLMMEDLLDKLKLLSYEDEVLRKQNMKPLSRHYFALPTNPGEQFYMFCTLAAWLISKAGHHFDQPQEYDDPNATISNILSELRSFGYSVDFPPSRLKAGYGEQVCYVLDCFAEEVLKHIHFSWKRPTY 149          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Mouse
Match: Ift57 (intraflagellar transport 57 [Source:MGI Symbol;Acc:MGI:1921166])

HSP 1 Score: 296.59 bits (758), Expect = 3.847e-96
Identity = 162/379 (42.74%), Postives = 241/379 (63.59%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            E GPG A+ +F  ME ++E LK++ YE    +   +KP SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE +  VL  L++ ALK  GF W  P +  E   E     D+     S       + +F  ++ D++E    L++          + +A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LD+L +E+++++EKI +REKY+NNQ+EH + +YR AQ  L   RE+ ++ +GG+ +R ++L+E+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  QM IR G
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEEELLRKSNLKPPSRHYFALPTNPGEQFYMFCTLAAWLINKTGRAFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEQVCYVLDCLAEEALKYIGFTWKRPSYPVEELEEETVPEDDAELTLSK-----VDEEFVEEETDNEENFIDLNVLKAQTYRLDTNESAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDKLHNEISRTLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERTRLLSEVTEELEKVKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIG 395          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Mouse
Match: Ift57 (intraflagellar transport 57 [Source:MGI Symbol;Acc:MGI:1921166])

HSP 1 Score: 231.876 bits (590), Expect = 3.970e-72
Identity = 132/323 (40.87%), Postives = 203/323 (62.85%), Query Frame = 2
Query:  275 FISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE +  VL  L++ ALK  GF W  P +  E   E     D+     S       + +F  ++ D++E    L++          + +A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LD+L +E+++++EKI +REKY+NNQ+EH + +YR AQ  L   RE+ ++ +GG+ +R ++L+E+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  QM IR G
Sbjct:    2 FCTLAAWLINKTGRAFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEQVCYVLDCLAEEALKYIGFTWKRPSYPVEELEEETVPEDDAELTLSK-----VDEEFVEEETDNEENFIDLNVLKAQTYRLDTNESAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDKLHNEISRTLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERTRLLSEVTEELEKVKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIG 310          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Mouse
Match: Ift57 (intraflagellar transport 57 [Source:MGI Symbol;Acc:MGI:1921166])

HSP 1 Score: 187.193 bits (474), Expect = 1.970e-55
Identity = 89/176 (50.57%), Postives = 138/176 (78.41%), Query Frame = 2
Query:  716 TAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            T ES K + I+EST ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LD+L +E+++++EKI +REKY+NNQ+EH + +YR AQ  L   RE+ ++ +GG+ +R ++L+E+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  QM IR G
Sbjct:   92 TNESAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDKLHNEISRTLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERTRLLSEVTEELEKVKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIG 267          
BLAST of Intraflagellar transport protein 57 vs. UniProt/SwissProt
Match: sp|Q5EA95|IFT57_BOVIN (Intraflagellar transport protein 57 homolog OS=Bos taurus OX=9913 GN=IFT57 PE=1 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.802e-97
Identity = 173/395 (43.80%), Postives = 254/395 (64.30%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            E GPG A+ +F  ME ++E LK++ YE N  +   +KP SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA IS IL  +R         P+KLKSG GE++  VL  L++ ALK  GF W  P +  E   E     D+     +       + +F  ++ D++E    L++          + +A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LDRL +E+++++EKI +REKY+NNQ+EH + +YR AQ  L   RE+ ++ +GG+ +R +IL+E+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  QM IR G++EH LLQ  LK KS+
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEENLLRKNNLKPPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNAIISNILSELRSFGRTADFPPSKLKSGYGEHVCYVLDCLAEEALKYIGFTWKRPAYPVEELEEETVAEDDAELTLNK-----VDEEFVEEETDNEENFIDLNVLKAQTYRLDMNESAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDRLHNEISRTLEKIGSREKYINNQLEHLVQEYRAAQAQLSEARERYQQGNGGVTERTRILSEVTEELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVQMDIRIGVVEHTLLQSKLKEKSN 411          
BLAST of Intraflagellar transport protein 57 vs. UniProt/SwissProt
Match: sp|Q8BXG3|IFT57_MOUSE (Intraflagellar transport protein 57 homolog OS=Mus musculus OX=10090 GN=Ift57 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 2.691e-95
Identity = 162/379 (42.74%), Postives = 241/379 (63.59%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            E GPG A+ +F  ME ++E LK++ YE    +   +KP SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE +  VL  L++ ALK  GF W  P +  E   E     D+     S       + +F  ++ D++E    L++          + +A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LD+L +E+++++EKI +REKY+NNQ+EH + +YR AQ  L   RE+ ++ +GG+ +R ++L+E+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  QM IR G
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEEELLRKSNLKPPSRHYFALPTNPGEQFYMFCTLAAWLINKTGRAFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEQVCYVLDCLAEEALKYIGFTWKRPSYPVEELEEETVPEDDAELTLSK-----VDEEFVEEETDNEENFIDLNVLKAQTYRLDTNESAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDKLHNEISRTLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERTRLLSEVTEELEKVKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIG 395          
BLAST of Intraflagellar transport protein 57 vs. UniProt/SwissProt
Match: sp|Q9NWB7|IFT57_HUMAN (Intraflagellar transport protein 57 homolog OS=Homo sapiens OX=9606 GN=IFT57 PE=1 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 7.268e-92
Identity = 164/395 (41.52%), Postives = 252/395 (63.80%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            E GPG A+ +F  ME ++E LK++ YE  + +   +K  SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE++  VL   ++ ALK  GF W  P +  E   E     D+     +       + +F  ++ D++E    L++      +   +  A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+  LD+L +E+ +++EKI++REKY+NNQ+E+ + +YR AQ  L   +E+ ++ +GG+ +R ++L+E+ EEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  +M IR G++EH LLQ  LK KS+
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNK-----VDEEFVEEETDNEENFIDLNVLKAQTYHLDMNETAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALKETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVMEELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSN 411          
BLAST of Intraflagellar transport protein 57 vs. UniProt/SwissProt
Match: sp|A9ULY7|IFT57_XENLA (Intraflagellar transport protein 57 homolog OS=Xenopus laevis OX=8355 GN=ift57 PE=2 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 2.109e-54
Identity = 101/190 (53.16%), Postives = 152/190 (80.00%), Query Frame = 2
Query:  722 ESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            ES KP+ I+ES  ++AEW+LEVERVLPQLKVTIR +++DWR H DQMHQ++  +     ET+ +LD+L +E+ K++EK+++REKY+NNQ+E  + +YR AQ  L   +E+ ++ASGG+ +R +ILAE+TEEL+++KQ+MEE+G++M+DG P+ +++QA+ KLK E+ QM IR+G++EH LLQ TLK KS+
Sbjct:  204 ESSKPEEILESNTDAAEWILEVERVLPQLKVTIRTDNKDWRVHVDQMHQHRDGIDTSLKETKGYLDKLHNEIAKALEKVSSREKYINNQLEQLVQEYRSAQAQLSEAKERYQQASGGVTERTRILAEITEELEKVKQEMEEKGSSMTDGAPLVKIKQALTKLKHEIVQMDIRTGVVEHTLLQSTLKEKSN 393          

HSP 2 Score: 138.272 bits (347), Expect = 3.713e-35
Identity = 65/139 (46.76%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  104 NEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRF 520
            ++ GPG A++ F  ME +L+ LK++ YE    +   MKP+SRHYFALPTNPGEQF  F +LSAWL+ + G   DQPQ+YDDPNA+IS IL  +R    ++   P++LK+G GE +  VL   ++  LK   F W  P +
Sbjct:   11 DDRGPGAAYQAFLMMEDLLDKLKLLSYEDEVLRKQNMKPLSRHYFALPTNPGEQFYMFCTLSAWLINKAGNNFDQPQEYDDPNATISNILSQLRSFGYSVDFPPSRLKAGYGEQVCYVLDCFAEEVLKHIRFSWKRPTY 149          
BLAST of Intraflagellar transport protein 57 vs. UniProt/SwissProt
Match: sp|Q28HX4|IFT57_XENTR (Intraflagellar transport protein 57 homolog OS=Xenopus tropicalis OX=8364 GN=ift57 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 2.801e-54
Identity = 101/192 (52.60%), Postives = 152/192 (79.17%), Query Frame = 2
Query:  716 TAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            T ES KP+ I+ES  ++AEW+LEVERVLPQLKVTIR +++DWR H DQMHQ++  +     ET+ +LD+L +E+ K++EK+++REKY+NNQ+E  + +YR  Q  L   +E+ ++ASGG+ +R +ILAE+TEEL+++KQ+MEE+G++M+DG P+ +++QA+ KLK E+ QM IR+G++EH LLQ TLK KS+
Sbjct:  202 TKESSKPEEILESNTDAAEWILEVERVLPQLKVTIRTDNKDWRVHVDQMHQHRDGIDTSLKETKGYLDKLHNEVAKALEKVSSREKYINNQLEQLVQEYRSVQAQLSEAKERYQQASGGVTERTRILAEITEELEKVKQEMEEKGSSMTDGAPLVKIKQALTKLKHEIVQMDIRTGVVEHTLLQSTLKEKSN 393          

HSP 2 Score: 138.272 bits (347), Expect = 3.676e-35
Identity = 64/139 (46.04%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  104 NEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRF 520
            ++ GPG A++ F  ME +L+ LK++ YE    +   MKP+SRHYFALPTNPGEQF  F +L+AWL+ + G   DQPQ+YDDPNA+IS IL  +R    ++   P++LK+G GE +  VL   ++  LK   F W  P +
Sbjct:   11 DDRGPGAAYQAFLMMEDLLDKLKLLSYEDEVLRKQNMKPLSRHYFALPTNPGEQFYMFCTLAAWLISKAGHHFDQPQEYDDPNATISNILSELRSFGYSVDFPPSRLKAGYGEQVCYVLDCFAEEVLKHIHFSWKRPTY 149          
BLAST of Intraflagellar transport protein 57 vs. TrEMBL
Match: K1Q768 (Intraflagellar transport protein 57-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10004849 PE=4 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 3.501e-101
Identity = 167/366 (45.63%), Postives = 251/366 (68.58%), Query Frame = 2
Query:  146 MEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            ME +L+ L+++DYER +     MKPISRHYFA+PTNPGEQF  F S+ AWL+++ G   +QPQ+YDDPNA+IS+IL+ +R    ++   P+KLK GCGE+ + VL  L+D ALK  GF W  P +  E   E   + D+     ++ E    +S F N+  +++ E+    L+       S  N     +  E  KP+ I+EST ++A W LEVERVLPQLKVTIR +++DWR H +QMHQ++  ++    ET+ +LD+L DE+++++EKI +REKY+NNQ+EH LS+YR AQD L   +E+ ++ASGG+ +R+++LA++TEEL+R+K +ME+RG++M+DG P+ +++QA+Q L+ E  QM IR G
Sbjct:    1 MEEILDKLRLLDYERQFQMKMKMKPISRHYFAIPTNPGEQFFMFTSICAWLLQKAGRSFEQPQEYDDPNATISSILEELRHFGHSVDFPPSKLKQGCGEHCIYVLDKLADEALKSSGFHWDKPDYPQEELEEENVVEDDAELTLNEVE----KSIFQNEMEEEEFEKEEQILDLEGLKRLSQKN-----QQVEHSKPEEIMESTTDAAAWKLEVERVLPQLKVTIRKDNKDWRDHVEQMHQHKDGIESSLTETKSYLDKLHDEISRTLEKIGSREKYINNQLEHLLSEYRAAQDQLSETKERYRQASGGVTERSRMLADVTEELERVKMEMEDRGSSMTDGAPLVKIKQAIQNLRKENVQMEIRIG 357          
BLAST of Intraflagellar transport protein 57 vs. TrEMBL
Match: A0A0B7A0J5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF90786 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 4.893e-99
Identity = 168/382 (43.98%), Postives = 258/382 (67.54%), Query Frame = 2
Query:   98 GTNEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            G  ++GPG  F  F  ME +L+ L+++DY++++ +   +KPI+RHYFA+ TNPGEQF  F SL+AWL+R+ G   +QPQ+YDDPNA+IS+IL  VR+    I   P+KLK G GE+ + VL  L+D ALK   F W  P++  E   E   + D+     ++ E    +S        +D +E+   L+      F+ +   D+ K  E      I+EST ++A+W LEVERV+PQLKVTIR +++DWR H +QMHQ+   ++   +E++ HLD+L DE++ ++EKI++REKY+N+Q+EH L  +R AQD L   +EK ++ASGG+ QR+++LAE+TEEL+++KQ+M+ERG++M+DG P+ R++Q++Q+LK E  QM IR+G
Sbjct:   11 GGGDDGPGLIFMPFVIMEELLDKLRLLDYDKDFARKMNLKPINRHYFAIQTNPGEQFYMFTSLAAWLLRKAGRNFEQPQEYDDPNATISSILDEVRKYGHQIDFPPSKLKQGWGEHCIYVLDRLADEALKCTSFTWRRPQYPEEEMEEENIVEDDSELMLNEIE----KSMAIGTSDIEDADEDEPILDLEGIQKFNQNKAFDSHKPEE------ILESTTDAADWKLEVERVMPQLKVTIRTDNKDWRVHLEQMHQHNEGIETSLNESKVHLDKLQDEISHTLEKISSREKYINSQLEHLLISFRQAQDALAETKEKYRQASGGVTQRSRMLAEITEELEKVKQEMDERGSSMTDGAPLVRIKQSIQQLKKESTQMDIRAG 382          
BLAST of Intraflagellar transport protein 57 vs. TrEMBL
Match: V4CDF6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_113043 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.335e-97
Identity = 161/377 (42.71%), Postives = 244/377 (64.72%), Query Frame = 2
Query:  113 GPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            GPG  ++ F   E +++ L ++D  + + +   +KPISRHYFA+ TNPGEQF  F S++AWL+R+ G   +QPQ+YDDPNA+IS+IL  VR+ +  I   P+KLK GCGE+ + VL+ L+D A+K   F W  P +  E                        E++  +   DD E       +     + S+   +  +   ES KP+ I++ST ++A+W LEVERV+PQLKVTIR +++DWR H DQMHQ++  ++    ET+ +LD+L DE+++++EKI +REKYLNNQ+EH L D+R  Q+ L   +EK ++ASGG+ +R++ILAE+TEEL++IK +ME+RG++M+DG P+ +++QA+  LK E  QM IR G
Sbjct:   16 GPGQFYEPFVQNEELMDKLNLLDCGKEFIRKNNLKPISRHYFAIATNPGEQFYYFTSIAAWLLRKSGKSFEQPQEYDDPNATISSILDEVRKYNYTIDFPPSKLKQGCGEHCLYVLQRLADEAIKYSNFKWRKPVYPEE------------------------EAEEQHVIEDDTELTLNRVDDTPGVSSISDIKPSSGQLQMESSKPEEILQSTTDAADWKLEVERVMPQLKVTIRTDNKDWRVHLDQMHQHKDGIETSLTETKSYLDKLHDEISRTLEKIGSREKYLNNQLEHLLHDFRNVQEQLSESKEKYRQASGGVTERSRILAEVTEELEKIKSEMEDRGSSMTDGAPLVKIKQAISSLKKESTQMDIRIG 368          
BLAST of Intraflagellar transport protein 57 vs. TrEMBL
Match: H0VBK3 (Intraflagellar transport 57 OS=Cavia porcellus OX=10141 GN=IFT57 PE=4 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 5.300e-96
Identity = 172/395 (43.54%), Postives = 261/395 (66.08%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            E GPG A+ +F  ME ++E LK++ YE    +   +KP SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE++  VL  L++ ALK  GF W  P +  E   E     D+     +       + +F  ++ D++E    L++      +   +N+A         K + I+EST ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+ +LD+L +E+++++EKI +REKY+NNQ+EH + ++R AQ  L   RE+ ++ +GG+ +R ++LAE+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E+ QM IR G++EH LLQ  LK KS+
Sbjct:   31 ERGPGAAYHMFVVMEDLVEKLKLLRYEEGLLRKNNLKPPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEHVCYVLDCLAEEALKYIGFTWKRPSYPVEEVEEETVPEDDAELTLNK-----LDEEFVEEETDNEENFIDLNILKAQTYHLDMNNSA---------KQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGYLDKLQNEISRTLEKIGSREKYINNQLEHLIQEHRAAQAQLSEARERYQQGNGGVTERTRLLAEVTEELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQEIIQMDIRIGVVEHTLLQSKLKEKSN 411          
BLAST of Intraflagellar transport protein 57 vs. TrEMBL
Match: A0A091DF79 (Intraflagellar transport protein 57 like protein OS=Fukomys damarensis OX=885580 GN=H920_07892 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.431e-95
Identity = 171/395 (43.29%), Postives = 256/395 (64.81%), Query Frame = 2
Query:  107 EEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            E GPG A+ +F  ME+++E LK++ YE    +   +KP SRHYFALPTNPGEQF  F +L+AWL+ + G   +QPQ+YDDPNA+IS IL  +R         P+KLKSG GE++  +L  L++ ALK  GF W  P +  E   E     D+     +       + +F  ++ D++E    L++      +   S +A  E   ES         T ++AEW LEVERVLPQLKVTIR +++DWR H DQMHQ+++ ++    ET+ +LD+L  E+++++EKI +REKY+NNQ+EH + ++R AQ  L   RE+ ++ SGG+ +R ++LAE+TEEL+++KQ+MEE+G++M+DG P+ +++Q++ KLK E  QM IR G++EH LLQ  LK KS+
Sbjct:   31 ERGPGAAYHMFVVMEYLVEKLKLLHYEEGLLRKSNLKPPSRHYFALPTNPGEQFYMFCTLAAWLINKAGHPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEHVCYILDCLAEEALKYIGFTWKRPSYPVEEVEEEAVPEDDAELTLNK-----VDEEFVEEETDNEENFIDLNILKAQTYHLDMSESAKQEDILES---------TTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALTETKGYLDKLHSEISRTLEKIGSREKYINNQLEHLVQEHRAAQAQLSEARERYQQGSGGVTERTRLLAEVTEELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETIQMDIRIGVVEHTLLQSKLKEKSN 411          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Cavefish
Match: ift57 (intraflagellar transport 57 homolog (Chlamydomonas) [Source:NCBI gene;Acc:414929])

HSP 1 Score: 185.267 bits (469), Expect = 8.139e-54
Identity = 89/175 (50.86%), Postives = 135/175 (77.14%), Query Frame = 2
Query:  719 AESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            A   +P+ I+ES  +SAEW LEVERVLPQLKVTIR++ +DWR H +QMHQ+Q  +K    + + +LD+L +E+ K+ EK+ +REKY+N+Q+EH ++DYR AQ  L   RE+ ++ SGG+ +R + LAE++EEL+++KQ+MEE+G++MSDG PV ++RQ++ KLK E++QM +R G
Sbjct:  180 AGGARPEMILESVTDSAEWNLEVERVLPQLKVTIRSDVKDWRIHVNQMHQHQDGIKTSLKDAKGYLDKLLEEIGKTQEKVGSREKYINSQLEHLITDYRNAQSKLSEARERYQQGSGGVTERTRTLAEISEELEKVKQEMEEKGSSMSDGAPVVKIRQSLTKLKQEIQQMDVRMG 354          

HSP 2 Score: 116.316 bits (290), Expect = 2.396e-28
Identity = 60/139 (43.17%), Postives = 87/139 (62.59%), Query Frame = 2
Query:  104 NEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRF 520
            +E GPG  F++F  ME +L+ LK++DYE +      MK +S  Y A  +N GEQF  F  ++AWL+  CG   + PQ++DDPNA++S IL  +R +   +   P+KLKSG GE++  VL  L++ ALK R FIW  P +
Sbjct:   11 DERGPGAQFQMFVVMEDLLDKLKLLDYEEHVLVKHNMKTLSSPYTA--SNTGEQFYMFSVIAAWLITLCGRPFETPQEHDDPNATVSNILSQLRALGGVVDFPPSKLKSGSGEHVCYVLDRLAEEALKSRNFIWKKPVY 147          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Nematostella
Match: EDO43467 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYI7])

HSP 1 Score: 182.57 bits (462), Expect = 2.613e-53
Identity = 89/176 (50.57%), Postives = 136/176 (77.27%), Query Frame = 2
Query:  716 TAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSG 1243
            ++ES KPD ++ES +++AEW LEVERVLP LKV IR +++DWRTH +QM Q+   +K   +ETR HLD+L  E+++++EKIA+REKY+NNQ+EH L +YR  QD+   ++E+ K+ SGG+ +  + LA++TEEL+ +K QM+ERGTNM+D  P+ R++Q++ +LK E++QM +R G
Sbjct:  180 SSESHKPDSVMESNVDAAEWKLEVERVLPLLKVHIRTDNKDWRTHYEQMQQHSEGIKSSLNETRGHLDKLHQEISRTLEKIASREKYVNNQLEHLLLEYRGLQDSAAEIKERYKQGSGGVTELTRSLAQITEELESVKAQMDERGTNMTDAGPLVRIKQSLTRLKQEVQQMEVRIG 355          

HSP 2 Score: 124.405 bits (311), Expect = 9.757e-32
Identity = 53/111 (47.75%), Postives = 72/111 (64.86%), Query Frame = 2
Query:  182 YERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVP 514
            Y+  +CKP   +P++RHYFAL TNPGEQF  F SL+AWL+ + G   +QPQ+YDDPNA+IS IL  ++++       P KLK+G GE +   +  L D ALK + F W  P
Sbjct:   13 YDAEFCKPLGFRPLTRHYFALSTNPGEQFFTFTSLAAWLLNQRGKNFEQPQEYDDPNATISNILDELKKMGIQTDFPPAKLKTGSGEQVCYCIDKLCDEALKAKRFGWKRP 123          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Nematostella
Match: EDO25889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDF6])

HSP 1 Score: 127.487 bits (319), Expect = 1.225e-35
Identity = 59/110 (53.64%), Postives = 85/110 (77.27%), Query Frame = 2
Query:  716 TAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVR 1045
            ++ES KPD ++ES +++AEW LEVERVLP LKV IR +++DWRTH +QM Q+   +K   +ETR HLD+L  E+++++EKIA+REKY+NNQ+EH L +YR  QD+   V+
Sbjct:    2 SSESHKPDSVMESNVDAAEWKLEVERVLPLLKVHIRTDNKDWRTHYEQMQQHSEGIKSSLNETRGHLDKLHQEISRTLEKIASREKYVNNQLEHLLLEYRGLQDSAAEVK 111          
BLAST of Intraflagellar transport protein 57 vs. Ensembl Medaka
Match: ift57 (intraflagellar transport 57 [Source:NCBI gene;Acc:101168320])

HSP 1 Score: 269.626 bits (688), Expect = 3.088e-86
Identity = 154/400 (38.50%), Postives = 249/400 (62.25%), Query Frame = 2
Query:  104 NEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFA----LPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSD 1291
            +E GPG A ++ + ME +LE L  ++YE    K   MK + RHYF     L +NPGEQF  F  ++AWL+   G    +P+++D+PNA++S IL  +R     +   P+KLK+G GE++ +VL  L+D ALK+R F +  P                            + S+   ++   +++  +    A   +  S S      +   S KP+ I+E+T+++AEW LEVERV+P LKVTIRN+++DWR H +QMHQYQ  +   + E++ ++D+L +++ K+ EK+++REKY+NNQ+E  + +YR AQ  L   +E+ ++ASGG+ +R+++LAE++EELD++KQ+MEE+G++MSD  PV ++ Q++ KLK E+ Q+ +R G++EH LLQ  LK KS+
Sbjct:    5 DERGPGAAHRMVSVMEGLLEKLDALNYEELLDK-HNMKKVCRHYFVSNSHLSSNPGEQFYMFTIIAAWLINVAGRPFTEPREHDEPNATVSNILAELRAFGVKVDFPPSKLKTGSGEHVCLVLDRLADEALKRRNFSFKRP---------------------------DYPSETPEEESMLEDDAEVTLSTAEEEILVSTSQRKMLTEPELSSKPEEILEATVDAAEWNLEVERVIPHLKVTIRNDNKDWRVHLEQMHQYQDKIDSLFKESKSYMDKLQEDIGKTQEKVSSREKYINNQLELPVQEYRSAQAKLSEAKERYQQASGGVTERSRVLAEISEELDKVKQEMEEKGSSMSDAAPVVKINQSLTKLKQEIVQIDLRIGVVEHTLLQAKLKEKSN 376          
BLAST of Intraflagellar transport protein 57 vs. Planmine SMEST
Match: SMESG000013668.1 (SMESG000013668.1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 410/411 (99.76%), Postives = 410/411 (99.76%), Query Frame = 2
Query:   80 MAENVDGTNEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFXXXXXXXXXXXXXXXXXXXXXXXXFGFESKFXXXXXXXXXXXXXXXXXXXXXXXFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAXXXXXXXXXXXXIRSGXXXXXXXXXXXKAKSDTRPTEYS 1312
            MAENVDGTNEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECG EMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFDNESEIENENIIDEDVNENSDNEEFGFESKFNNDDIDDDEEENLLDLEALNRLNFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAMQKLKMEMKQMLIRSGLLEHLLLQETLKAKSDTRPTEYS
Sbjct:    1 MAENVDGTNEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISRHYFALPTNPGEQFNAFISLSAWLVRECGYEMDQPQDYDDPNASISTILQAVRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFDNESEIENENIIDEDVNENSDNEEFGFESKFNNDDIDDDEEENLLDLEALNRLNFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNESRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYLNNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIKQQMEERGTNMSDGWPVARLRQAMQKLKMEMKQMLIRSGLLEHLLLQETLKAKSDTRPTEYS 411          
The following BLAST results are available for this feature:
BLAST of Intraflagellar transport protein 57 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IFT571.513e-9241.52intraflagellar transport 57 [Source:HGNC Symbol;Ac... [more]
IFT573.602e-2239.52intraflagellar transport 57 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
che-131.594e-3237.11Intraflagellar transport protein che-13 [Source:U... [more]
che-135.177e-3236.65Intraflagellar transport protein che-13 [Source:U... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IFT572.719e-2035.92gene:FBgn0031550 transcript:FBtr0077529[more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift575.083e-5151.46intraflagellar transport 57 homolog (Chlamydomonas... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ift572.341e-5552.60intraflagellar transport 57 [Source:NCBI gene;Acc:... [more]
ift575.287e-5552.60intraflagellar transport 57 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ift573.847e-9642.74intraflagellar transport 57 [Source:MGI Symbol;Acc... [more]
Ift573.970e-7240.87intraflagellar transport 57 [Source:MGI Symbol;Acc... [more]
Ift571.970e-5550.57intraflagellar transport 57 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5EA95|IFT57_BOVIN1.802e-9743.80Intraflagellar transport protein 57 homolog OS=Bos... [more]
sp|Q8BXG3|IFT57_MOUSE2.691e-9542.74Intraflagellar transport protein 57 homolog OS=Mus... [more]
sp|Q9NWB7|IFT57_HUMAN7.268e-9241.52Intraflagellar transport protein 57 homolog OS=Hom... [more]
sp|A9ULY7|IFT57_XENLA2.109e-5453.16Intraflagellar transport protein 57 homolog OS=Xen... [more]
sp|Q28HX4|IFT57_XENTR2.801e-5452.60Intraflagellar transport protein 57 homolog OS=Xen... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q7683.501e-10145.63Intraflagellar transport protein 57-like protein O... [more]
A0A0B7A0J54.893e-9943.98Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
V4CDF61.335e-9742.71Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
H0VBK35.300e-9643.54Intraflagellar transport 57 OS=Cavia porcellus OX=... [more]
A0A091DF791.431e-9543.29Intraflagellar transport protein 57 like protein O... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift578.139e-5450.86intraflagellar transport 57 homolog (Chlamydomonas... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434672.613e-5350.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258891.225e-3553.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift573.088e-8638.50intraflagellar transport 57 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Intraflagellar transport protein 57 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013668.10.000e+099.76SMESG000013668.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017476 ID=SMED30017476|Name=Intraflagellar transport protein 57|organism=Schmidtea mediterranea sexual|type=transcript|length=1326bp
TGACATAGTGACAAGATAAACATTTAAAATATTTATAATTTATTAAATTT
ATTTTGCATTGCGTTTACATTTATTTTAGATGGCAGAAAATGTAGATGGT
ACTAATGAGGAAGGACCAGGAGGAGCCTTTAAAGTTTTTACTAATATGGA
ACATGTCTTGGAAAATTTAAAAGTCATGGATTACGAAAGAAATTATTGCA
AACCATTTCTTATGAAACCGATTTCTCGGCATTATTTCGCATTACCTACA
AATCCTGGAGAACAATTTAACGCATTTATCAGTTTGAGTGCATGGTTAGT
TCGCGAATGTGGTTTGGAAATGGATCAGCCACAAGATTATGATGATCCAA
ATGCCAGTATATCAACCATTTTGCAGGCTGTCAGACAAATTAGTGATAAC
ATATCTATTTCTCCAACTAAATTGAAGTCAGGATGTGGAGAATATATTGT
CATGGTTTTAAAAATACTTTCCGATTTTGCTCTTAAAAAACGAGGATTTA
TATGGTCGGTTCCAAGATTTGATAATGAATCCGAAATCGAAAATGAGAAT
ATAATAGATGAAGATGTGAATGAAAACAGTGACAATGAAGAATTTGGATT
TGAAAGTAAATTTAATAACGACGATATTGACGATGACGAAGAAGAAAATC
TGCTAGATTTAGAAGCATTAAACCGGCTGAATTTCTCCAACTCCAACAAT
GCCGATGCCGAAAAGACAGCAGAATCCGTCAAGCCCGATGGAATTATCGA
GTCCACTCTCAATTCTGCAGAATGGTTGCTTGAGGTTGAGAGAGTTTTAC
CACAACTTAAAGTGACAATTAGAAATGAAAGTCGCGACTGGAGAACTCAC
CAGGATCAAATGCACCAATATCAAACCGACTTGAAAAAGTGCTACGATGA
GACTCGTCCTCATTTGGACAGGCTATTCGATGAGCTGAATAAATCAGTGG
AAAAAATAGCTACAAGAGAAAAATATCTGAATAATCAAGTTGAGCATAGG
TTGTCGGATTACAGATTGGCACAAGACAACCTTGTTTTGGTTAGAGAGAA
ACGGAAAGAAGCCAGTGGTGGAATCAATCAACGGGCTAAAATTCTTGCTG
AACTCACCGAAGAACTCGATCGTATTAAACAACAAATGGAAGAACGCGGT
ACTAATATGTCTGACGGTTGGCCTGTCGCCCGGCTTCGTCAAGCAATGCA
GAAGTTGAAGATGGAAATGAAGCAAATGCTAATTAGATCGGGATTATTGG
AACATTTACTTTTACAAGAAACTCTCAAAGCCAAAAGTGATACCAGACCA
ACTGAATATTCCTAATTACTTGTTTT
back to top

protein sequence of SMED30017476-orf-1

>SMED30017476-orf-1 ID=SMED30017476-orf-1|Name=SMED30017476-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MAENVDGTNEEGPGGAFKVFTNMEHVLENLKVMDYERNYCKPFLMKPISR
HYFALPTNPGEQFNAFISLSAWLVRECGLEMDQPQDYDDPNASISTILQA
VRQISDNISISPTKLKSGCGEYIVMVLKILSDFALKKRGFIWSVPRFDNE
SEIENENIIDEDVNENSDNEEFGFESKFNNDDIDDDEEENLLDLEALNRL
NFSNSNNADAEKTAESVKPDGIIESTLNSAEWLLEVERVLPQLKVTIRNE
SRDWRTHQDQMHQYQTDLKKCYDETRPHLDRLFDELNKSVEKIATREKYL
NNQVEHRLSDYRLAQDNLVLVREKRKEASGGINQRAKILAELTEELDRIK
QQMEERGTNMSDGWPVARLRQAMQKLKMEMKQMLIRSGLLEHLLLQETLK
AKSDTRPTEYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0005929cilium
GO:0030992intraciliary transport particle B
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019530Intra-flagellar_transport_57
Vocabulary: biological process
TermDefinition
GO:0003351epithelial cilium movement
GO:0006915apoptotic process
GO:0006919activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007368determination of left/right symmetry
GO:0032006regulation of TOR signaling
GO:0042073intraciliary transport
GO:0042462eye photoreceptor cell development
GO:0042981regulation of apoptotic process
GO:0045494photoreceptor cell maintenance
GO:0060271cilium morphogenesis
GO:1905515non-motile cilium assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 332..359
NoneNo IPR availableCOILSCoilCoilcoord: 366..386
IPR019530Intra-flagellar transport protein 57PFAMPF10498IFT57coord: 23..394
e-value: 1.7E-117
score: 392.5
IPR019530Intra-flagellar transport protein 57PANTHERPTHR16011IFT57/HIPPIcoord: 8..409