WD repeat-containing protein on Y chromosome

Overview
NameWD repeat-containing protein on Y chromosome
Smed IDSMED30017474
Length (bp)3527
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein on Y chromosome (SMED30017474) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein on Y chromosome (SMED30017474) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein on Y chromosome (SMED30017474) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein on Y chromosome (SMED30017474) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017474

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017474h1SMcG0012900 SmedASXL_009240SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30017474h1SMcG0012900 Contig48740newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017474h1SMcG0012900 Contig48740uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017474h1SMcG0012900 dd_Smed_v6_5437_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017474h1SMcG0012900 dd_Smed_v4_5437_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 253.447 bits (646), Expect = 6.568e-69
Identity = 236/929 (25.40%), Postives = 411/929 (44.24%), Query Frame = 2
Query:  419 IEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPA--RIENTP--HRENVIRITSTSDGS-FIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYC---RIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRS-----EGIAGIGMENVLS--NPSIKFYRWKVH-NDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEI-SRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLM---SGHVFF----------------KLIS--------PVAXXXXXXXX-----XXXXXSINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY----ANNKVETDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTN 3034
            +E ++ +    +++ AFE+ +  +   +   +F   + E +   T E+     LF K+D A  G INWD+  +++ LE  E++E     R  A  +P    +E  P  H++ + ++    + S ++  S +G+L+ W   L+L++   + +   + ++K  W+   + +   NKI VA   +E+ F++L S E +    ++  L+  P+C+DY+ D  + ++ ++ +GD  G V  +   A    L +  ++P S     E    I    +LS  +        K+H  DWV ++ Y  SL  IIS +     ++V+   E S                            K+R+  + T FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+             H++     +C +                   K   F      DE H      G  +    +Q  +L  K     +    +H+  VTC  YN    QV++   GSTV  W + TG+K+ +F   H ++ ++ +  D+   RLLTG  DG V++W+F NG+C          L   +  AV+  +I    K I+  GW+RAI V+  Q     ++ +     W   +   H +DIL  A L    L T  Y G I++WN     + HV                  KL+S        P+AD             +   ++ +L FL++R        A+LV+ G  G V FW++ +  +L   F   +  G  + +       D  ++ L  GD  G++ +W+IE Y    + NK+ T  P L+R ++ H   I+SL++       ++I+SS DC++ V       V  FGQ + W + N
Sbjct:   38 LENQLSVGDFVKIQKAFESPQPRKIICMSREDFTQKMTEIVGWGTKEEYGE--LFDKVDVAQDGFINWDKLTSFILLELYEQDE-----RAKATVVPQWKDLEFLPVKHKDTIQKVIFLKNSSHYLTISKEGLLAIWGEHLKLQETFPITS--DATKLKHLWVTSLVSLENVNKIAVAFTSKEVCFYDLLSKEEFACQYKLQGLKGTPICMDYWYDPLDANESILSFGDITGKVQAIAFTAA---LISLFERPASACEDGEATMTINWAELLSGCHKCCHILEHKLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREKS----------------------------KKRL--NMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQ------------HQLSIQRIACSFP------------------KSQDFRCLFHFDEAH------GRLFISFNNQLALLAMKSEA--SKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTGSTDGTVKIWDF-NGYC-------HHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQ---NFNQFFIQPEEWKGGIQ--HHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLL-AEFLAHSGVGSIIMST------DKMNRYLTTGDLDGWLKIWNIEEYCLNSSKNKI-TKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIEN 865          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Human
Match: EFCAB8 (EF-hand calcium binding domain 8 [Source:HGNC Symbol;Acc:HGNC:34532])

HSP 1 Score: 215.312 bits (547), Expect = 3.996e-56
Identity = 182/701 (25.96%), Postives = 310/701 (44.22%), Query Frame = 2
Query:  446 LEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRIT-----STSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSK--WIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYC----RIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRS---EGIAGIGMENVLSNPSI--KFYRWK-VHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIF-SICADKCVKVWDLHDHNCLLTVRPKGHRIRG-DMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFN-EAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWN 2488
            L +++  FE  + + +G L +  F   +K+ L   +  D   + LF K+D    G + W ++  YM  E+  KE+       + F LP  +    H   V+++          G F+  + DGIL FWS +  L    S   + Q+Q++ ++  W+ID + ++  N + VA+  ++I+FF++S  +  C        L++  L +DY+ D      C   +GD KG V +         L   +  PR+   +    + ++ +L+  S   + YR K +H +W  ++K+   +  ++SCS  E ++LV+  +                               K R+S    V  + KGI  FD+   +N LVTGG D  IRLWNP+V+ +P  +++GH   + ++ +  + N I  S+  DK ++VWD+ D+ CL +   K   +    + S ++ +   +L+ +T  + +L                          Y E  +Q  +   K          TH  P+    Y++ F QVV+ C   TV +W + TG K  EF     +   +T +  D + R LLTG RDG ++MWN+N G CL      E      EIS +    I  NK     GW + I  ++      +   Y+ Q+         H EDIL++A  +   L T+ Y G I+ WN
Sbjct:   54 LAKIEKMFEE-DINSTGALGMDAFIKAMKKVLS--SVSDEMLKELFLKVDSDCEGFVTWQKYVDYMMREFQGKEDMRKSQYRLHFYLPMTVVPLNHGCEVVKVVFLIHRFKKIGCFLTVTKDGILQFWSESFSL---MSSFRLNQTQQLYNQPMWVIDMVCLHNMNLVAVASTRQKIDFFDISDHK--CVRAFTFVDLDSCALVMDYWSDYHRGVFC---YGDAKGNVIVFTSENMTSGLFNPRILPRASKWDHWIKVSLQKLLNEKSALHRSYRLKALHPNWCEQVKFIPQMNVVVSCSAIEKSSLVLTILPAKA-------------------------SKKPRLS----VLRLRKGILCFDYCPDRNFLVTGGYDAFIRLWNPFVSKRPVWLMKGHQTSVTHILVDSRNNSILISVSKDKNIRVWDMLDYICLQSFCGKFFALGNCPITSAYFFEKDNTLICSTYSIGILK------------------------GYLE--AQGLIKARK--------RTTHCSPLCAVLYSKIFKQVVSGCLRGTVSVWEVVTGRKTMEFAVSGGQHVEMTAMALDESERCLLTGLRDGTMKMWNYNIGKCLLTFPSPEQ----LEISGI----IHMNKVFYVTGWSKRITHFLFHKTKPVLLCYHWQTY--------HTEDILSMAKYRNQFLGTSSYSGDILFWN 664          

HSP 2 Score: 76.6406 bits (187), Expect = 2.822e-13
Identity = 49/193 (25.39%), Postives = 87/193 (45.08%), Query Frame = 2
Query: 2573 SINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY-------------------ANNKVETDCPE-----------------------------LLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFG 3007
            S+ K++FLQ+R +   +A+L++S   G ++ W++ E G L G+F    ++G  +   +A    D +D +L  GD  G+I +WDI++Y                   A+NK     P+                             LL  W+ H++S+  +  V   Q++I++  D  V+ W   G+ +GTFG
Sbjct:  801 SVEKIIFLQTRPRLPHTAALLSSCMDGYIYAWSLHENGGLLGKFPVDLDNGDVVVGAMAT---DKNDWILITGDCKGYIKIWDIKDYCALIDKQPFQSSGAKVVSEAHNKFRLLIPQQLGTNFPHYIPLEDKEVVAGHTISLVPPTLLMTWKGHLNSVADILYVDNFQLVISAGQDRDVKAWKLSGDAIGTFG 990          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 180.259 bits (456), Expect = 2.616e-46
Identity = 157/580 (27.07%), Postives = 257/580 (44.31%), Query Frame = 2
Query: 1418 QPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEI-SRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLM---SGHVFF----------------KLIS--------PVAXXXXXXXX-----XXXXXSINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY----ANNKVETDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTN 3034
            + K+R+  + T FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+             H++     +C +                   K   F      DE H      G  +    +Q  +L  K     +    +H+  VTC  YN    QV++   GSTV  W + TG+K+ +F   H ++ ++ +  D+   RLLTG  DG V++W+F NG+C          L   +  AV+  +I    K I+  GW+RAI V+  Q     ++ +     W   +   H +DIL  A L    L T  Y G I++WN     + HV                  KL+S        P+AD             +   ++ +L FL++R        A+LV+ G  G V FW++ +  +L   F   +  G  + +       D  ++ L  GD  G++ +W+IE Y    + NK+ T  P L+R ++ H   I+SL++       ++I+SS DC++ V       V  FGQ + W + N
Sbjct:    6 KSKKRL--NMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQ------------HQLSIQRIACSFP------------------KSQDFRCLFHFDEAH------GRLFISFNNQLALLAMKSEA--SKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTGSTDGTVKIWDF-NGYC-------HHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQ---NFNQFFIQPEEWKGGIQ--HHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLL-AEFLAHSGVGSIIMST------DKMNRYLTTGDLDGWLKIWNIEEYCLNSSKNKI-TKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIEN 524          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 169.859 bits (429), Expect = 9.914e-43
Identity = 174/691 (25.18%), Postives = 288/691 (41.68%), Query Frame = 2
Query:  926 IIVATGDREIEFFELSSFEPYC---RIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRS-----EGIAGIGMENVLS--NPSIKFYRWKVHN-DWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEI-SRNKFIVSVGWD-----------RAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLM---SGHVFF----------------KLIS--------PVAXXXXXXXX-----XXXXXSINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIE 2827
            I VA   +E+ F++L S E +    ++  L+  P+C+DY+ D  + ++ ++ +GD  G V  +   A    L +  ++P S     E    I    +LS  +        K+H  DWV ++ Y  SL  IIS +     ++V+   E S                            K+R+  + T FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+             H++     +C +                   K   F      DE H      G  +    +Q  +L  K     +    +H+  VTC  YN    QV++   GSTV  W + TG+K+ +F   H ++ ++ +  D+   RLLTG  DG V++W+F NG+C          L   +  AV+  +I    K I+  GW+           RAI V+  Q     ++ +     W   +   H +DIL  A L    L T  Y G I++WN     + HV                  KL+S        P+AD             +   ++ +L FL++R        A+LV+ G  G V FW++ +  +L   F   +  G  + +       D  ++ L  GD  G++ +W+IE
Sbjct:    1 IAVAFTSKEVCFYDLLSKEEFACQYKLQGLKGTPICMDYWYDPLDANESILSFGDITGKVQAIAFTAA---LISLFERPASACEDGEATMTINWAELLSGCHKCCHILEHKLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREKS----------------------------KKRL--NMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQ------------HQLSIQRIACSFP------------------KSQDFRCLFHFDEAH------GRLFISFNNQLALLAMKSEA--SKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTGSTDGTVKIWDF-NGYC-------HHTLNVGQDGAVDISQILILKKKILVTGWERYDYASWKTIGRAITVFRPQ---NFNQFFIQPEEWKGGIQ--HHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLL-AEFLAHSGVGSIIMST------DKMNRYLTTGDLDGWLKIWNIE 600          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 149.443 bits (376), Expect = 3.729e-37
Identity = 121/486 (24.90%), Postives = 228/486 (46.91%), Query Frame = 2
Query:  419 IEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPA--RIENTP--HRENVIRITSTSDGS-FIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYC---RIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRS-----EGIAGIGMENVLS--NPSIKFYRWKVHN-DWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVR---PKGHRIRGDMQSCHYSDFAKSLMIA-TDQVSMLNIK 1816
            +E ++ +    +++ AFE+ +  +   +   +F   + E +   T E+     LF K+D A  G INWD+  +++ LE  E++E     R  A  +P    +E  P  H++ + ++    + S ++  S +G+L+ W   L+L++   + +   + ++K  W+   + +   NKI VA   +E+ F++L S E +    ++  L+  P+C+DY+ D  + ++ ++ +GD  G V  +   A    L +  ++P S     E    I    +LS  +        K+H  DWV ++ Y  SL  IIS +     ++V+   E S                            K+R+  + T FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+     +  +    PK    R      H+ +    L I+  +Q+++L +K
Sbjct:   38 LENQLSVGDFVKIQKAFESPQPRKIICMSREDFTQKMTEIVGWGTKEEYGE--LFDKVDVAQDGFINWDKLTSFILLELYEQDE-----RAKATVVPQWKDLEFLPVKHKDTIQKVIFLKNSSHYLTISKEGLLAIWGEHLKLQETFPITS--DATKLKHLWVTSLVSLENVNKIAVAFTSKEVCFYDLLSKEEFACQYKLQGLKGTPICMDYWYDPLDANESILSFGDITGKVQAIAFTAA---LISLFERPASACEDGEATMTINWAELLSGCHKCCHILEHKLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREKS----------------------------KKRL--NMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQDFRCLF---HFDEAHGRLFISFNNQLALLAMK 478          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 53.9138 bits (128), Expect = 4.806e-7
Identity = 56/250 (22.40%), Postives = 106/250 (42.40%), Query Frame = 2
Query: 1580 LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN-KFIVSVGWDRAINVY 2326
            L GH K +     +     + +  ADK VK+W++    C  T+   GH++   +    +S  ++ ++ A+D  ++   KI   V  +                                  T     H + V CC +N   + VV+     +V++W++ TG  +     AH D  V+ ++F+  G  + +G  DG+VR+W+  NG C+  L  +E+         V +V+ S N K+I++   D  + ++
Sbjct:   83 LEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLT--GHKL--GVNDIAWSSDSRCVVSASDDKTL---KIFEIVTSRM---------------------------------TKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTL-PAHSDP-VSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDEN-------PPVAFVKFSPNGKYILASNLDSTLKLW 283          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 53.9138 bits (128), Expect = 4.806e-7
Identity = 56/250 (22.40%), Postives = 106/250 (42.40%), Query Frame = 2
Query: 1580 LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN-KFIVSVGWDRAINVY 2326
            L GH K +     +     + +  ADK VK+W++    C  T+   GH++   +    +S  ++ ++ A+D  ++   KI   V  +                                  T     H + V CC +N   + VV+     +V++W++ TG  +     AH D  V+ ++F+  G  + +G  DG+VR+W+  NG C+  L  +E+         V +V+ S N K+I++   D  + ++
Sbjct:   83 LEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLT--GHKL--GVNDIAWSSDSRCVVSASDDKTL---KIFEIVTSRM---------------------------------TKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTL-PAHSDP-VSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDEN-------PPVAFVKFSPNGKYILASNLDSTLKLW 283          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Celegans
Match: Y53C12B.1 (pep chromosome:WBcel235:II:9742982:9746074:-1 gene:WBGene00013143.1 transcript:Y53C12B.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53C12B.1)

HSP 1 Score: 50.8322 bits (120), Expect = 7.330e-6
Identity = 24/89 (26.97%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1466 KGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGM---LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGH 1723
            K +   D  +S  ++ TGG+D++++LW    +    G+   L GH + +  V  A+  +++ S   D  +K+W++ + +CL T+   GH
Sbjct:  478 KDVNCVDISESDALIATGGMDKLVKLWQVDTHKMQLGIAGTLSGHRRGVGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTI--SGH 564          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Fly
Match: WDY (gene:FBgn0267449 transcript:FBtr0347028)

HSP 1 Score: 130.954 bits (328), Expect = 2.381e-30
Identity = 103/368 (27.99%), Postives = 169/368 (45.92%), Query Frame = 2
Query: 1442 DQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLT----VRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHE--------DSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVF 2509
            +++ F I  G+ TF   +S N++VTGG D  +R+W+ Y+ ++P+ +L GHN  +V V +  +EN+++S+   K +KVWDLH+H  L T    VR   H    D+ + +Y    + L++A  +  +++IK  P V     D                                    TH  PV+   YN  F  +V+C   S + +W+  TG +       H         D  +T   FD   + LLTG RDG +++WN+NN   +  +    S +   E++AV +V + R   I+++GWDR +  + D     + + Y    +W       H +DI       G  + TA Y G II W L +G  +
Sbjct:  317 ERSNFRIPLGVSTFFVAESHNIVVTGGPDTFVRIWDVYIPTEPSAILTGHNGGIVLVFVQPEENKVYSVDYQKIIKVWDLHEHTLLQTYGDLVRLIHHS-ETDL-TYYYHSHLRELVVAGRK--LISIKCCPRVRVDLTD----------------------------------GNTHAAPVSVVLYNRLFRNIVSCGLDSYIIVWDPWTGRRKIIMKSCHTKMIYGEIIDIEITAACFDPLEQFLLTGARDGSLKIWNYNNAVVVRNM----SIMPDQEVTAVIWV-VDR---ILAMGWDRQVTEFNDV----VGREYGDPKKW----PKFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPY 630          

HSP 2 Score: 62.3882 bits (150), Expect = 2.432e-9
Identity = 44/186 (23.66%), Postives = 75/186 (40.32%), Query Frame = 2
Query: 2573 SINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY------------------------------ANNKVETDC-PELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNP 3037
            S+  +LFLQ+R +     S+  S   G +  ++  + G     F    ++G  +  M  C D+   ++ L+ G  FG+I VW I N+                              A   V     P L+  ++ H+ +I S+  +   +++ T S D + R+WT  G Y+GT G    W    P
Sbjct:  699 SVQAVLFLQTRPQTLKHGSVFISLDTGFIQVYSHHQRGGYIVEFLAVHKTGDCVLTM--CTDRK--NRYLYTGTAFGYIKVWYIVNFCVPESEKTHVCMPKLRLEFIFLRKELFMTRAKRAVRNQAEPLLVSSYKGHLKAINSIAFINLPKIIFTGSHDYSCRLWTQGGRYLGTLGTVLPWSRLTP 880          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 60.077 bits (144), Expect = 5.307e-9
Identity = 68/318 (21.38%), Postives = 126/318 (39.62%), Query Frame = 2
Query: 1580 LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN-KFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKED----ILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKL 2518
            L GH K +  V  +     + S  ADK +K+W  +D     T+   GH++   +    +S  ++ L+  +D  ++   K+      K L      ++Y                                 V CC +N   N +V+     +V++W++ TG K  +   AH D  V+ + F+  G  +++   DG+ R+W+  +G CL  L  +++         V +V+ S N K+I++   D  + ++ D  +    K+Y            GHK +        +   G  + +      + +WNL S  V  KL
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTIS--GHKL--GISDVAWSSDSRLLVSGSDDKTL---KVWELSTGKSLKTLKGHSNY---------------------------------VFCCNFNPQSNLIVSGSFDESVRIWDVRTG-KCLKTLPAHSDP-VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDN-------PPVSFVKFSPNGKYILAATLDNTLKLW-DYSKGKCLKTY-----------TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL 324          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 60.077 bits (144), Expect = 5.307e-9
Identity = 68/318 (21.38%), Postives = 126/318 (39.62%), Query Frame = 2
Query: 1580 LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN-KFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKED----ILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKL 2518
            L GH K +  V  +     + S  ADK +K+W  +D     T+   GH++   +    +S  ++ L+  +D  ++   K+      K L      ++Y                                 V CC +N   N +V+     +V++W++ TG K  +   AH D  V+ + F+  G  +++   DG+ R+W+  +G CL  L  +++         V +V+ S N K+I++   D  + ++ D  +    K+Y            GHK +        +   G  + +      + +WNL S  V  KL
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTIS--GHKL--GISDVAWSSDSRLLVSGSDDKTL---KVWELSTGKSLKTLKGHSNY---------------------------------VFCCNFNPQSNLIVSGSFDESVRIWDVRTG-KCLKTLPAHSDP-VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDN-------PPVSFVKFSPNGKYILAATLDNTLKLW-DYSKGKCLKTY-----------TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL 324          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Fly
Match: CG3909 (gene:FBgn0027524 transcript:FBtr0082172)

HSP 1 Score: 50.447 bits (119), Expect = 6.467e-6
Identity = 72/307 (23.45%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1481 FDFGK----SKNVLVTGGLDRIIRLWNPYVNS--KPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLH--DHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATD--QVSMLNIKINPFVAEKQLDERHQR-----ASYLGGCYFEQISQNTVL----VNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEP 2344
            FDF K     K+ LVTGGLD ++++W+   ++  K    L+GH   +V V ++     I S   D  + +WD    D   LL+  P       D+ +  +S   K ++   +  ++SM +++     AE+ LD ++ +     A    G Y    + + ++    V    V+ T     H  PV    ++     ++T  +   +KL++++  + V   +  H  S V C+ F   G+   +   D  V++W+ +   CL     E +D    ++  V Y     N  + S   D+++N+Y   C P
Sbjct:   42 FDFDKKEARPKDFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPV------DLWTVQFSPCNKYVISGLNDGKISMYSVETGK--AEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQT--LEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLS-GHA-SWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTF-AEHTD----QVWGVRYSP--GNDKVASASEDKSLNIYY--CPP 327          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Zebrafish
Match: wdr95 (WD40 repeat domain 95 [Source:ZFIN;Acc:ZDB-GENE-131127-243])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 379/998 (37.98%), Postives = 579/998 (58.02%), Query Frame = 2
Query:  431 IDLTVLEELKAAFENAEYDRSG--KLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMK-LKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRA---KNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTP 3406
            + +  L+ +K AF+  E+ ++G   LD +EF+ +++    L T +D Q + LF KID+   G I W E CTY+ LE  +KEET  +++  AF LPA ++     E ++RI    +G+ +    DG++SFW+  L LK  K++   E+S   +  W  DF++M E+NK+I+ATG RE++F+E SS EP C++ +LE VPL LDY   +   D+C+I++GD +GCVNIL + +  E LR WK+ P+ + I  I +++ + +P + F RWKVH DWV K+KY++S+  I+S S  E TALVIG +  ST   +QM+    +   +S  +T        +R + +QT+F + KG+ TFD  K+ N+LVTGG+D+++R+W PYV   PTG+L+GH+ P+ YV +  +   I+S+  D   K+W + D  CL T  P   +I+G++ +C YS  AK L IA+D +++L++K  P     Q+                                    V+HK+PV CC Y+E F QVV+C EGS +K+W++ TG  +FEF  AH DS +TC+TFD++GRRL+TGGRDG++++WNFNNG C+  L +E    K  EI    Y+ +  N F++SVGW R I++Y+D  E        P   W DDM NGHKEDIL +A    HLLAT  + G IIVWN++SG +  +  +P +   + +    ++ S+  L+FL++RA   +  SSA LV+SG  G V+FW+V  GG     F+  +   Q +T +   +    DD +LF  D  GFI V++++ YA    E + PE +  WRAH+ SIT L +V + Q L+TSS DC+VR+W   G+Y+GTFGQ E W +  P +++HP VPY++L+ P S+P HPVL   +         K+E+ +K         Q +N T +    I ++D +I        ++   G+R R    K  N  S   G  +Y +L+  +L   P
Sbjct:    2 VSINDLKHIKQAFD--EFAKAGIDMLDYAEFQTVMRSCPSLKTVKDTQIQHLFMKIDYTGDGKIEWHEICTYIFLENKKKEETVHRSKMAAFVLPAIVKFLNCGEPLLRIHFPPNGTVVTLREDGLVSFWTPKLHLKSKKNLFP-ERSITRRPNWATDFVLMPEYNKLIIATGSRELQFYEFSSLEPCCQLSALETVPLNLDYCSTRP--DECVIVYGDTEGCVNILLMKSIREKLRLWKRSPQVDNIPNISIDHAVESPEVTFIRWKVHQDWVSKVKYFESISSIVSSSAHEETALVIGSIHPSTYKQEQMRGTAEVSDERSTKVT--------QRATCNQTIFIVPKGVTTFDLCKNLNLLVTGGMDKVVRMWIPYVPRNPTGILKGHSAPVAYVCVTSENGHIYSVSTDNTAKIWHIKDQTCLFTAHPNSSQIKGELSACIYSSAAKGLYIASDSIALLSLKTKPQPKGIQI------------------------------------VSHKEPVLCCGYSEQFRQVVSCSEGSVIKIWDVETGALIFEFGCAHGDSAITCMTFDTSGRRLMTGGRDGLIKLWNFNNGQCVKILSREG---KCPEICDCSYLTLHGNTFVISVGWSRRIDIYLDSKEETQFIQ-RPTPSWQDDMRNGHKEDILCIAHCTPHLLATGSFDGEIIVWNVVSGRIQCRFQTPQS--QKISSSHVQNTSVLSLIFLKTRAFVPELASSAWLVSSGSRGYVNFWSVLNGGKFVASFQ-ASHLQQQITKLALTQ----DDSMLFTADHVGFIYVYNVKQYAMGP-EQNPPEKINFWRAHIRSITGLKIVDKDQFLLTSSMDCSVRLWNIHGDYIGTFGQEEDWRIETPSSWKHPAVPYEILIDPLSMPSHPVLDEEINQSDVLSSEKSENVNK---------QLDNQTDSDPPTI-LNDRDIEDGSISSWFRSEPGRRQRHAIFKHLNRASNRTGLKDYNTLKDLDLIVMP 928          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Zebrafish
Match: si:dkey-202c14.3 (si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-357])

HSP 1 Score: 232.646 bits (592), Expect = 2.649e-62
Identity = 229/884 (25.90%), Postives = 383/884 (43.33%), Query Frame = 2
Query:  476 AEYDRSGKLDLSEFKALLKEKLQLPTFEDIQ---TETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRE----NVIRITSTSDGSFIAGSTDGILSFWSNTLE----LKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIH--SLENVPLCLDYYVDKDNL-DDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRW--KVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTL--ATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDC----PELLRRWRAHVSSITSLDLVL-QSQVLITS-SDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQ 3049
            +E   +  +   ++   LKE     T +D Q    E  F ++  +  G + W  F T+M   Y    ++    + +    P   + T +++     V+ +T +    +++ S  G L  W+  L     L+           ++    W+ D + M   +KI VAT +R I FF++++   + +IH   L +    L Y+ + +   + C+++WGD KG VN+L      + L       +S G   I ++++  + ++  Y+   K+H+  + ++ Y      II+ S+  A+A+VI        +D   K                          ++ V+ I KG++ FDF  S  +LVT G+   +RLWN YV S+PT +LR H   +V V I +   +IFS   D  +K+WD+    C+ T+      I+  + S     F   L +++D V ++  +   +VA  QLD+   R                               +  D  TC  YN    QV   C  ST+ +W++ TG +  E   AH +  V+C+  D   RRL+T   +G +++WN  N             +   E++    +    +  +++ GW R I  Y            Y ++         H EDIL +    + G LLAT  Y G II+W L     F ++                 L +++LLFLQSRA+      A+++ S   G V  W+V      +G+F    +SG+++T        D ++ LL  GD  G I VWDI  YA N  + +     P LL  W  H  +I S +++L +S+  I S S D    +WT EG  VG FG+ + WDL+NP T+Q
Sbjct:   62 SERVSANSMSFEDYFCCLKEA----TGQDYQRSDVEDFFNEMSISCDGRVEWQTFQTFMLQHYKHITQSMQPCQNLPISHPLIRKCTYNKQEAIVRVLALTRSPPMRYVSVSKRGTLIAWNRHLNHLKPLEMWGEAFNKRHHRKRFQGWVTDAVYMANVHKIAVATLNRGIHFFDVTTASGFEQIHLYGLTHFASALCYWYETEAPGEKCVLMWGDEKGSVNLLWFLQPFKGLFAMPFTIQS-GPVKISLQDIYMHSALASYQHIPKIHSMLINRILYEPRDDIIITSSDSSASAVVI--------IDVNQK-------------------------REKYVWRIEKGVKCFDFSCSLGLLVTAGVGPAVRLWNRYVTSRPTAVLRSHQTTVVDVVIHQALGKIFSYSKDAVLKIWDIPSQQCVKTLHLNFPNIQAGV-SPEQGSFPLLLNLSSDPVLLVTCR--EYVALLQLDKTETR-------------------------------SRSDLYTCALYNPHLQQVA--CADSTLTVWDVKTGIRRMEIRNAHGNEEVSCMALDVHQRRLITAATNGTIKVWNLLN----GLNLHNLEPVSNKEVTG---IICHHDDQLLATGWSRLITQY----SIAFSSDIYIKANLSWKSGCQHSEDILAMDHCPVLG-LLATGSYDGEIIIWALALQKPFTRV-------------QTVHLPVHRLLFLQSRAQQSHLRKAAVLLSSQAGFVCCWSVCGPRHNHGQFYVPDKSGENVTGF----STDPENNLLVTGDTTGCIKVWDIAQYALNNGDMESAAGFPPLLHSWSGHERAIVSSEVLLYESRFFILSVSMDRRACLWTHEGSCVGCFGEEQQWDLSNPDTYQ 842          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 56.9954 bits (136), Expect = 7.252e-8
Identity = 68/318 (21.38%), Postives = 127/318 (39.94%), Query Frame = 2
Query: 1580 LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN-KFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKED----ILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKL 2518
            L GH K +  V  +     + S  ADK +K+W  +D     T+   GH++   +    +S  +  L+ A+D  ++   KI    + K L      ++Y                                 V CC +N   N +V+     +V++W++ TG K  +   AH D  V+ + F+  G  +++   DG+ R+W+  +G CL  L  +++         V +V+ S N K+I++   D  + ++ D  +    K+Y            GHK +        +   G  + +      + +WNL +  +  KL
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTIS--GHKL--GISDVAWSSDSNLLVSASDDKTL---KIWDVSSGKCLKTLKGHSNY---------------------------------VFCCNFNPQSNLIVSGSFDESVRIWDVKTG-KCLKTLPAHSDP-VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDN-------PPVSFVKFSPNGKYILAATLDNTLKLW-DYSKGKCLKTY-----------TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKL 297          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Zebrafish
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 53.9138 bits (128), Expect = 1.140e-6
Identity = 55/255 (21.57%), Postives = 99/255 (38.82%), Query Frame = 2
Query: 1469 GIQTFDFGKSKNVLVTGGLDRIIRLW------NPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELK 2215
            G+       + N L T G D IIR+W      +PY+ S     +  H   +  + +      + S  +D  VKVW+ H   C+ T+R              + D+ K+L  A D+           VA   LD +          +   ++  T L      + T     +KD +     N+    +V+      +++W+  T  K+ +  + H D+ V  L  +  G + L+G  DG +R+W+     C+   +
Sbjct:   32 GVNALQLDPALNRLFTAGRDSIIRIWSVNQHKDPYIAS-----MEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRT-------------HKDYVKALAYAKDK---------ELVASAGLDRQ---------IFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGTVIVSGSTEKVLRVWDPRTCAKLMKL-KGHTDN-VKSLLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYR 248          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Zebrafish
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 53.5286 bits (127), Expect = 1.506e-6
Identity = 55/255 (21.57%), Postives = 99/255 (38.82%), Query Frame = 2
Query: 1469 GIQTFDFGKSKNVLVTGGLDRIIRLW------NPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELK 2215
            G+       + N L T G D IIR+W      +PY+ S     +  H   +  + +      + S  +D  VKVW+ H   C+ T+R              + D+ K+L  A D+           VA   LD +          +   ++  T L      + T     +KD +     N+    +V+      +++W+  T  K+ +  + H D+ V  L  +  G + L+G  DG +R+W+     C+   +
Sbjct:   30 GVNALQLDPALNRLFTAGRDSIIRIWSVNQHKDPYIAS-----MEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRT-------------HKDYVKALAYAKDK---------ELVASAGLDRQ---------IFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGTVIVSGSTEKVLRVWDPRTCAKLMKL-KGHTDN-VKSLLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYR 246          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Xenopus
Match: ENSXETT00000025824.1 (WD repeat-containing protein 64-like [Source:NCBI gene;Acc:100498290])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 314/925 (33.95%), Postives = 523/925 (56.54%), Query Frame = 2
Query:  680 KAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMK-LKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDV-AVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNG--HCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDI--DDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNV---IYIDDEEINQQIEQ-KIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFEL-AKTPSPRQP 3421
            + ++++F LPA +  TPHRE +I+I+   D S +    DG++S W++ L+LKK + ++   + Q  K KWI D  +M ++NK+IV T DRE+ F+ELS+FEPYC+I  LE +PL L Y     + D+ ++ +GD +GC+N++ + +  E +R+W K    + I  + M+ + S   +K  RWKVHNDWV +++Y +++  IIS SND+ TALVIGCVEG+  + +++K L     T+SK       + PKR IS D+++F + +G++ FDF K  N+LVTGGLDRI+R+WNPYV   PTG LRGH+ P+ ++ IA++ ++I+S+  D  V VWD+ +H CL+ V  K  +I+G++ +C +S   ++L IATD  SML ++ +                                     + H DV +V+HK+PVTCC+YN+   QVV+C EGS +K+W+L TG+ V E   AH  + +TCL  D+TG R+ +  +DG ++ W+ ++    CLT LK+  +D          Y  +   +F++S G  + I ++ DQ +  + ++ YP   W+ +M N HK +IL +A+   +L+A++   G I +W++ SG++   L  P    +   +    DL I KL+FL SR      A L ASGP G + FW++ +GG ++G F        S     A +D  I  DD  L   D+  ++ +W+I  YA +  E   P L+  WRAH   IT +  V + ++++TSS DCTVR+W+ +GE +GTFGQ+E+W+    +++          +  QS         R   ++    S   + H +   +Q+     N +++ + +   + +DD++I +++ + + +   +GK    ++++        G  N Y+SLQ+ +L + T + R+P
Sbjct:   16 RNKKVSFHLPATVAETPHREPLIQISPMPDNSLLVVGQDGLISVWTSDLKLKKNRFILDENKQQNRKMKWIADLTLMPQYNKLIVGTCDRELRFYELSNFEPYCQIIGLETLPLHLGY--STRDTDEGVLYFGDEQGCINVILISSVAETIRSWTKCQIIDDIPSVSMDIIESAGHVKLIRWKVHNDWVTQIRYVNAIDSIISSSNDDYTALVIGCVEGTKNMQKRLKDLMDSSSTRSKRSMLSGNVPPKRNIS-DESLFKVKRGVKAFDFCKENNILVTGGLDRIVRIWNPYVPGWPTGSLRGHSSPITFLQIADENSKIYSVSTDCTVMVWDIEEHTCLINVISKASQIKGEIATCFFSSQFRALYIATDSFSMLQLQHS-------------------------------------ITHPDVPSVSHKEPVTCCQYNQYLEQVVSCSEGSVIKIWDLLTGKLVSEVRGAHGSAAITCLALDNTGSRMFSVAKDGSLKQWDLSSTSVSCLTTLKEAVADSLTDGQYDCTYAWLHNKRFMISAGCGKQITIFPDQQDSAVVENQYPNHTWISNMRNKHKGEILCVASCPPNLVASSSSDGEIFIWDVTSGNMMCSLGIP-KQEELSNETGSSDLIIQKLIFLSSRDWKNECAVLAASGPNGQITFWHIFDGGKVFGSFP-------SSHYQTAVRDMAISEDDSTLCAADQLFYVYIWNISQYALHGPEAHPPPLIHCWRAHQCDITRVVPVSKYKLVVTSSVDCTVRLWSMKGEPIGTFGQSELWEAKKRESW----------IGQQS-------DGRANTDEHPSASGCGAQHSSSSEEQN-----NKSYSPEFIGISVPVDDKDIAEELHRSRSHSAQRGKMFGPKQVELHQTC---GKLNAYQSLQICDLMSVTTNVRRP 867          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Xenopus
Match: ENSXETT00000044342.1 (WD repeat-containing protein 64-like [Source:NCBI gene;Acc:101734744])

HSP 1 Score: 414.075 bits (1063), Expect = 2.731e-126
Identity = 253/707 (35.79%), Postives = 391/707 (55.30%), Query Frame = 2
Query:  107 KIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRI-------IEPKDEIRKPRRRTIEIVDGMDITKFIGREM--SLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIA-GIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSK----DMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICAD---KCVKVWDLHDHNCLLTVRPKGHRIRGDMQ-SCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLV---------------------NKP-PVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEA-HEDSG 2104
            K K+R SSA G ++T    +     ++   ++ + K +L  S  +       GF++E   +       +E +   RK RR ++ +V+ +   + +  +   + +LRK    +K+E ++ L  L++LK AF+  E +    LD+ +FK +LK+   L    D Q E LF KID+ +SG I WDEFCTYMQL+Y+E EE+  ++R ++F LPA +    H + ++R+    D + I    DG + FWS  L+LK+ K++   E+S +   KW+ DF IM ++NK+I+ TGDRE++F+ELS+ EPYC+I  LE +PL LDY     + D+CLIL+GD +GCVNIL L + G+ LR WKK PR + I   IG++N + +P + F  WKVH DWV ++KYYDS++ IIS SNDEATALVIGC  G+T ++QQMK    H   +K      T G    P++R + DQT F++YKG++TF F K  +++VTGG+DRIIR+WN YV ++ TGMLRGH  P+  + I+ +EN+IFSI  D   K VKVWD      L       +   GD   +C   D +   +I   +   L I  +         +R  ++  +  C + +I++N  ++                      +P P    D+   H++ + C   N   N + +      + +WN+ +G      N   H D+G
Sbjct:    4 KKKVRHSSALGKLETSNVPSLFGEIRQINGVQQRAKTALGAS--ITHTAPPNGFIEECSNLHLDLPDWLEKELIRRKQRRHSLGLVENVTEKESLQNQSDPARNLRK----EKMERQVTLEQLKKLKDAFKELENNGHKSLDVEKFKWVLKKCTGLQGANDEQIEKLFMKIDFTASGKIRWDEFCTYMQLDYSELEESNSRSRRISFILPATVHEMIHGDPILRVFPMPDNTLIMLREDGHIYFWSTQLKLKRDKAI--FEKSVKKMPKWVTDFTIMLQYNKLILGTGDRELQFYELSNLEPYCQITGLETMPLKLDYCA--TDTDECLILYGDDQGCVNILLLSSVGQTLRMWKKMPRPDNIVPTIGIDNAILSPHVSFISWKVHGDWVTQMKYYDSIKAIISASNDEATALVIGCTTGTTNVEQQMKDIKDHMKDTKWKKGPATIG---PPQKRAAGDQTAFHVYKGVKTFAFCKKNSLVVTGGMDRIIRMWNVYVPARVTGMLRGHTAPIFSLDISSEENKIFSIATDNTIKVVKVWDFETGKQLFEF----NGAHGDAGITCSTFDHSGRRLITGGRDGRLKIWNHNTGQCLHTLKRGAKSDEVCDCTYAEINKNRYIMAVGWDRRINMYYDSENDLHHFQEPQPCWQDDLIRGHREDILCIAQNPP-NLLASSSYDGEIIVWNMISGHIHCRLNSPIHADAG 692          

HSP 2 Score: 347.436 bits (890), Expect = 6.876e-102
Identity = 192/496 (38.71%), Postives = 304/496 (61.29%), Query Frame = 2
Query: 1931 PVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGST---VKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKN-KSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTP 3406
            P   T +   H  P+     +   N++ +    +T   VK+W+  TG+++FEFN AH D+G+TC TFD +GRRL+TGGRDG +++WN N G CL  LK+     K  E+    Y EI++N++I++VGWDR IN+Y D  E  +H    PQ  W DD+  GH+EDIL +A    +LLA++ Y G IIVWN++SGH+  +L SP+     D      D S++K+LFL++R KN + +ASL+++GP G V+FW++ +GG +   FK      Q+ +  +     + DD L+F  D  G+I V+DI  YA  + E +  +L+  WRAHV +IT L+++ + +V+++SS D  VR+W   GE++GTFGQ ++W++  P +++HPMVP+++L+ P+S+P HPVL      E+  + S+  S  K +  +   +Q E S     +V  I +E+IN++I+ +   + +GKRLR ER    +   + GGPN + +L+ F+LA  P
Sbjct:  489 PARVTGMLRGHTAPIFSLDISSEENKIFSIATDNTIKVVKVWDFETGKQLFEFNGAHGDAGITCSTFDHSGRRLITGGRDGRLKIWNHNTGQCLHTLKR---GAKSDEVCDCTYAEINKNRYIMAVGWDRRINMYYD-SENDLHHFQEPQPCWQDDLIRGHREDILCIAQNPPNLLASSSYDGEIIVWNMISGHIHCRLNSPI---HADAGKQFTDRSVSKILFLRTRTKNQRPTASLLSNGPQGSVNFWSLLQGGKMIASFKPSRMGSQASSLAV-----NEDDTLMFAADHTGYIYVYDITEYAMQETEKEPAKLVTLWRAHVDTITHLEVIDEDKVILSSSMDGAVRLWGLSGEFIGTFGQMDLWEIFTPASWKHPMVPFEILIDPESMPTHPVL------EEPADISEIISPEKKEAQEASHVQKEISYNPKLSVPAITEEDINEEIKNQHLSQSQGKRLRQERHVITHKPLDHGGPNTFHTLRYFDLANNP 966          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Xenopus
Match: ENSXETT00000029824.1 (EF-hand calcium binding domain 8 [Source:NCBI gene;Acc:100494912])

HSP 1 Score: 316.235 bits (809), Expect = 1.677e-91
Identity = 280/990 (28.28%), Postives = 454/990 (45.86%), Query Frame = 2
Query:  230 SNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSL-RKHNLLDKIEERIDLTVLEELKAAFENAEYD-------------------------RSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEE------TYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVT-IEQSQRVKSK---WIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIH--SLENVPLCLDYYVDKDNLDD-CLILWGDRKGCVNILHL--HATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRW--KVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIR-GDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSR-WLDDMSNGHKEDILTLATLKG-HLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY---ANNKVETDCPELLRRWRAHVSSITSLD-LVLQSQVLITS-SDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTF 3046
            +N L++    +  L+E +  +         +++ ++   G  + KF   E  LS  R  NL  ++EE+  L  L  L+ AF     D                          +G + L EF+ +L +      F+D   E LF ++D +  G ++W EFCTY+ L+Y +++       T+L    +  C   + E T     ++ I+S      ++ S  G+L+ W   L  +K   V      SQ  K +   W+ D + +   NKI +AT  R+I FF++S+   +   H  +L +VP    Y+ +K + +   L+LWG   G VN+L L    TG   + + + P   G   I M+ +  +  +  Y+    VH + + KL Y    + II+ S    ++L+I        ++Q+ K+ +                           + I KG+Q FD+ ++ N+LVTGG D  +RLWN YV  +P  +L  H+  ++ V I +   +IFS   D  +KVWD+    CL T+  K   I+ G +Q      F   L++ T+   +L +  + ++   +L     RA    G +F                      TH+ PVTC  Y+   + +VT  E STV +W++ TG K      AH    VTC+  D   RRL+TG R+G +++WN  NGH L +L+  E     AEI+ +  V    N F+ +VGW+R I  Y     P  ++ Y P +  W       H+EDILT        LLATA + G II+WN  +  ++  L                   ++KL FLQ R+  + +A LV+S   G + +W V  GG  +G F    E+  S+  + +    D  +++L  GD  G + VWDI  Y   A  +  T  P LL  W AH S++ S++  +  S+  I S S D T ++WT +G+ VGTFGQ++ W L++P ++
Sbjct:   11 ANALQRQLLSVTLLQELEHFL---------KKQGLQKCSGQKV-KFCNEESILSFDRNENL--RLEEKFRLDDLRLLQEAFAKHNSDGKETNCKEESDDLRATRRRAKQEARPAGNMTLDEFRRVLCDLFGSECFDD-DMELLFNEVDTSCDGYVDWGEFCTYLLLQYRKRDYRMIGRVTFLGQPVIRLCTRNKQEPT---SRILAISSPPPMWLLSVSKTGVLTTWDLALHPQKSYEVAAEYPDSQAGKRRFKCWVTDAVHLPNANKIAIATTSRDIHFFDVSTMNLFEEFHLFALNHVPTTFSYWYNKQSPESRSLLLWGGDNGAVNVLWLLQPQTGVFEKPFSQHP---GPTKIYMQELKDHSKLLSYQVIPDVHPEAITKLIYCPEKQLIITSSGSAQSSLLI------MDINQKGKVYT---------------------------WKINKGVQCFDYCRALNLLVTGGFDHKVRLWNQYVTCRPIAVLPEHSMAILDVMIYQPLGQIFSFSKDSVLKVWDIPSQTCLHTLVLKFPCIQPGRIQEQGSFPF---LLVPTNPSRLL-VCYSDYIGILRL----ARAEPTEGTFF----------------------THRAPVTCLLYSSFCHLIVTGSEDSTVAVWDVETGAKSLLLGNAHGQEEVTCMALDKAQRRLITGARNGTIKIWNIQNGHNLHQLEPVED----AEITCI--VASQENVFL-TVGWNRKIVTYDI---PKTNEVYVPANHSW--KGGQLHQEDILTADFCPSLGLLATASFDGEIILWNAETQRLYLYL--------RQCPQARSPAPVDKLFFLQKRSAKREAAILVSSEA-GTLRWWRVTNGGQEWGSFYAQDEADCSVLGLAS----DKANRVLVSGDTLGLVQVWDISAYGLQAAAQTYTCRPPLLYSWGAHDSAVVSVEHFLYDSEPFIASGSSDKTAKLWTVDGKQVGTFGQSKCWKLSDPTSY 893          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Xenopus
Match: ENSXETT00000013976.1 (EF-hand calcium binding domain 8 [Source:NCBI gene;Acc:100494912])

HSP 1 Score: 313.923 bits (803), Expect = 6.473e-91
Identity = 263/893 (29.45%), Postives = 423/893 (47.37%), Query Frame = 2
Query:  449 EELKAAFENA--EYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEE------TYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVT-IEQSQRVKSK---WIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIH--SLENVPLCLDYYVDKDNLDD-CLILWGDRKGCVNILHL--HATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRW--KVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIR-GDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSR-WLDDMSNGHKEDILTLATLKG-HLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY---ANNKVETDCPELLRRWRAHVSSITSLD-LVLQSQVLITS-SDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTF 3046
            ++L+A    A  E   +G + L EF+ +L +      F+D   E LF ++D +  G ++W EFCTY+ L+Y +++       T+L    +  C   + E T     ++ I+S      ++ S  G+L+ W   L  +K   V      SQ  K +   W+ D + +   NKI +AT  R+I FF++S+   +   H  +L +VP    Y+ +K + +   L+LWG   G VN+L L    TG   + + + P   G   I M+ +  +  +  Y+    VH + + KL Y    + II+ S    ++L+I        ++Q+ K+ +                           + I KG+Q FD+ ++ N+LVTGG D  +RLWN YV  +P  +L  H+  ++ V I +   +IFS   D  +KVWD+    CL T+  K   I+ G +Q      F   L++ T+   +L +  + ++   +L     RA    G +F                      TH+ PVTC  Y+   + +VT  E STV +W++ TG K      AH    VTC+  D   RRL+TG R+G +++WN  NGH L +L+  E     AEI+ +  V    N F+ +VGW+R I  Y     P  ++ Y P +  W       H+EDILT        LLATA + G II+WN  +  ++  L                   ++KL FLQ R+  + +A LV+S   G + +W V  GG  +G F    E+  S+  + +    D  +++L  GD  G + VWDI  Y   A  +  T  P LL  W AH S++ S++  +  S+  I S S D T ++WT +G+ VGTFGQ++ W L++P ++
Sbjct:   63 DDLRATRRRAKQEARPAGNMTLDEFRRVLCDLFGSECFDD-DMELLFNEVDTSCDGYVDWGEFCTYLLLQYRKRDYRMIGRVTFLGQPVIRLCTRNKQEPT---SRILAISSPPPMWLLSVSKTGVLTTWDLALHPQKSYEVAAEYPDSQAGKRRFKCWVTDAVHLPNANKIAIATTSRDIHFFDVSTMNLFEEFHLFALNHVPTTFSYWYNKQSPESRSLLLWGGDNGAVNVLWLLQPQTGVFEKPFSQHP---GPTKIYMQELKDHSKLLSYQVIPDVHPEAITKLIYCPEKQLIITSSGSAQSSLLI------MDINQKGKVYT---------------------------WKINKGVQCFDYCRALNLLVTGGFDHKVRLWNQYVTCRPIAVLPEHSMAILDVMIYQPLGQIFSFSKDSVLKVWDIPSQTCLHTLVLKFPCIQPGRIQEQGSFPF---LLVPTNPSRLL-VCYSDYIGILRL----ARAEPTEGTFF----------------------THRAPVTCLLYSSFCHLIVTGSEDSTVAVWDVETGAKSLLLGNAHGQEEVTCMALDKAQRRLITGARNGTIKIWNIQNGHNLHQLEPVED----AEITCI--VASQENVFL-TVGWNRKIVTYDI---PKTNEVYVPANHSW--KGGQLHQEDILTADFCPSLGLLATASFDGEIILWNAETQRLYLYL--------RQCPQARSPAPVDKLFFLQKRSAKREAAILVSSEA-GTLRWWRVTNGGQEWGSFYAQDEADCSVLGLAS----DKANRVLVSGDTLGLVQVWDISAYGLQAAAQTYTCRPPLLYSWGAHDSAVVSVEHFLYDSEPFIASGSSDKTAKLWTVDGKQVGTFGQSKCWKLSDPTSY 860          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Xenopus
Match: ENSXETT00000013991.1 (EF-hand calcium binding domain 8 [Source:NCBI gene;Acc:100494912])

HSP 1 Score: 275.404 bits (703), Expect = 7.400e-79
Identity = 232/776 (29.90%), Postives = 367/776 (47.29%), Query Frame = 2
Query:  776 FIAGSTDGILSFWSNTLELKKCKSVVT-IEQSQRVKSK---WIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIH--SLENVPLCLDYYVDKDNLDD-CLILWGDRKGCVNILHL--HATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRW--KVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIR-GDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSR-WLDDMSNGHKEDILTLATLKG-HLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY---ANNKVETDCPELLRRWRAHVSSITSLD-LVLQSQVLITS-SDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTF 3046
             ++ S  G+L+ W   L  +K   V      SQ  K +   W+ D + +   NKI +AT  R+I FF++S+   +   H  +L +VP    Y+ +K + +   L+LWG   G VN+L L    TG   + + + P   G   I M+ +  +  +  Y+    VH + + KL Y    + II+ S    ++L+I        ++Q+ K+ +                           + I KG+Q FD+ ++ N+LVTGG D  +RLWN YV  +P  +L  H+  ++ V I +   +IFS   D  +KVWD+    CL T+  K   I+ G +Q      F   L++ T+   +L +  + ++   +L     RA    G +F                      TH+ PVTC  Y+   + +VT  E STV +W++ TG K      AH    VTC+  D   RRL+TG R+G +++WN  NGH L +L+  E     AEI+ +  V    N F+ +VGW+R I  Y     P  ++ Y P +  W       H+EDILT        LLATA + G II+WN  +  ++  L                   ++KL FLQ R+  + +A LV+S   G + +W V  GG  +G F    E+  S+  + +    D  +++L  GD  G + VWDI  Y   A  +  T  P LL  W AH S++ S++  +  S+  I S S D T ++WT +G+ VGTFGQ++ W L++P ++
Sbjct:    3 LLSVSKTGVLTTWDLALHPQKSYEVAAEYPDSQAGKRRFKCWVTDAVHLPNANKIAIATTSRDIHFFDVSTMNLFEEFHLFALNHVPTTFSYWYNKQSPESRSLLLWGGDNGAVNVLWLLQPQTGVFEKPFSQHP---GPTKIYMQELKDHSKLLSYQVIPDVHPEAITKLIYCPEKQLIITSSGSAQSSLLI------MDINQKGKVYT---------------------------WKINKGVQCFDYCRALNLLVTGGFDHKVRLWNQYVTCRPIAVLPEHSMAILDVMIYQPLGQIFSFSKDSVLKVWDIPSQTCLHTLVLKFPCIQPGRIQEQGSFPF---LLVPTNPSRLL-VCYSDYIGILRL----ARAEPTEGTFF----------------------THRAPVTCLLYSSFCHLIVTGSEDSTVAVWDVETGAKSLLLGNAHGQEEVTCMALDKAQRRLITGARNGTIKIWNIQNGHNLHQLEPVED----AEITCI--VASQENVFL-TVGWNRKIVTYDI---PKTNEVYVPANHSW--KGGQLHQEDILTADFCPSLGLLATASFDGEIILWNAETQRLYLYL--------RQCPQARSPAPVDKLFFLQKRSAKREAAILVSSEA-GTLRWWRVTNGGQEWGSFYAQDEADCSVLGLAS----DKANRVLVSGDTLGLVQVWDISAYGLQAAAQTYTCRPPLLYSWGAHDSAVVSVEHFLYDSEPFIASGSSDKTAKLWTVDGKQVGTFGQSKCWKLSDPTSY 687          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Mouse
Match: Wdr95 (WD40 repeat domain 95 [Source:MGI Symbol;Acc:MGI:1923042])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 306/791 (38.69%), Postives = 461/791 (58.28%), Query Frame = 2
Query: 1085 KGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCV----------EGSTQLDQQM-KLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAK--NKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLG---PRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGK----RLRFERMKPRNALSEDGGPNEYRSLQVFELA 3397
            +GCVNIL L + GE LRTWKK PR E +  I + +V+++P+ ++ RWKVH D+V +L YY+S++ +IS SN E TALVIG +           G+T + +++ +++++ +      +   +  P+R+   ++TVF ++KG++ F F + KN+LVTGGLDRIIR+WNPY+  KPTG+LRGH  P++YVH+A +EN++FS+ AD  VKVWDL  H C  T+  K   I+G++ +C Y    ++L +AT  ++ L++K+   V E  L   HQ                                   +PV CC+YN AF  VV+CCE S VK+W+  TG +V EF   H ++G+TCLTFDS+GRRL+TGGRDG +++W++NNGHCL  L+ +E+    +E+    Y+E++RN+ +++VGWDR INVY D      H    PQ  W DD+++GHKEDIL +A     LLAT+ Y G IIVWN++SGH++ KL +P + +D        D S+++L FL++R    + +SA+L+++GP G V FW +  G  L   F    E  Q    ++        D L ++ D+ GFI V+DI+ Y     E   P  +  WRAHVS +TSL+L+    ++++SS DCTVR+W+ +G Y+GTFGQ   WD+  P ++ HP VP+++L  P+S+P H VL    P   +E R+EQ              H  + ++     K       E +  + E K  K         RL   R KPR  + E   P+ Y++L+  ELA
Sbjct:    5 QGCVNILFLASVGELLRTWKKMPRVEDMPSITLHSVMASPNAEYVRWKVHGDFVSQLNYYESMKAVISSSNHEPTALVIGSLLNRLEHGGFTVGATDIKEKLNEIRNVGKNVKMGNSSACLALPQRQAECNRTVFRVHKGVKAFSFCRRKNLLVTGGLDRIIRVWNPYLPGKPTGVLRGHRAPVMYVHVAFEENKVFSMSADNTVKVWDLETHGCCCTISSKASGIKGELTACLYLPGPRALCVATGTLAFLHLKVGS-VPESHLVRSHQ-----------------------------------EPVVCCRYNPAFRHVVSCCEASVVKVWDFETGRQVSEFIGTHGNAGITCLTFDSSGRRLVTGGRDGCLKIWSYNNGHCLHTLQHDENQ---SEVCDCTYMEVNRNRCVIAVGWDRRINVYFD-IPRDFHHFRKPQPHWQDDLNHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTP-SPMDGQDHREGPDRSVSQLAFLKTRLTKLDSASAALISNGPGGSVCFWKLFSGSGLVANFTPSREKAQVSGIVVTS-----GDTLAYLADQHGFIHVYDIQEYGLQGTELQAPNTVTSWRAHVSMVTSLELIEGGSIVLSSSLDCTVRLWSQDGAYIGTFGQNHPWDVFTPDSWGHPRVPFEILTDPRSMPTHRVLETDVPAGCLEGRQEQ-------------DHGTEEKDPCEAEKTPNPPSPEGLTVEAEAKADKSRWAAFCHGRLLSARRKPRWKMPELRWPSIYQALRCHELA 736          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Mouse
Match: Wdr95 (WD40 repeat domain 95 [Source:MGI Symbol;Acc:MGI:1923042])

HSP 1 Score: 447.203 bits (1149), Expect = 5.622e-143
Identity = 252/644 (39.13%), Postives = 368/644 (57.14%), Query Frame = 2
Query: 1493 KSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAK--NKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLG---PRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGK----RLRFERMKPRNALSEDGGPNEYRSLQVFELA 3397
            + KN+LVTGGLDRIIR+WNPY+  KPTG+LRGH  P++YVH+A +EN++FS+ AD  VKVWDL  H C  T+  K   I+G++ +C Y    ++L +AT  ++ L++K+   V E  L   HQ                                   +PV CC+YN AF  VV+CCE S VK+W+  TG +V EF   H ++G+TCLTFDS+GRRL+TGGRDG +++W++NNGHCL  L+ +E+    +E+    Y+E++RN+ +++VGWDR INVY D      H    PQ  W DD+++GHKEDIL +A     LLAT+ Y G IIVWN++SGH++ KL +P + +D        D S+++L FL++R    + +SA+L+++GP G V FW +  G  L   F    E  Q    ++        D L ++ D+ GFI V+DI+ Y     E   P  +  WRAHVS +TSL+L+    ++++SS DCTVR+W+ +G Y+GTFGQ   WD+  P ++ HP VP+++L  P+S+P H VL    P   +E R+EQ              H  + ++     K       E +  + E K  K         RL   R KPR  + E   P+ Y++L+  ELA
Sbjct:   10 RRKNLLVTGGLDRIIRVWNPYLPGKPTGVLRGHRAPVMYVHVAFEENKVFSMSADNTVKVWDLETHGCCCTISSKASGIKGELTACLYLPGPRALCVATGTLAFLHLKVGS-VPESHLVRSHQ-----------------------------------EPVVCCRYNPAFRHVVSCCEASVVKVWDFETGRQVSEFIGTHGNAGITCLTFDSSGRRLVTGGRDGCLKIWSYNNGHCLHTLQHDENQ---SEVCDCTYMEVNRNRCVIAVGWDRRINVYFD-IPRDFHHFRKPQPHWQDDLNHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTP-SPMDGQDHREGPDRSVSQLAFLKTRLTKLDSASAALISNGPGGSVCFWKLFSGSGLVANFTPSREKAQVSGIVVTS-----GDTLAYLADQHGFIHVYDIQEYGLQGTELQAPNTVTSWRAHVSMVTSLELIEGGSIVLSSSLDCTVRLWSQDGAYIGTFGQNHPWDVFTPDSWGHPRVPFEILTDPRSMPTHRVLETDVPAGCLEGRQEQ-------------DHGTEEKDPCEAEKTPNPPSPEGLTVEAEAKADKSRWAAFCHGRLLSARRKPRWKMPELRWPSIYQALRCHELA 594          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Mouse
Match: Efcab8 (EF-hand calcium binding domain 8 [Source:MGI Symbol;Acc:MGI:3644206])

HSP 1 Score: 219.164 bits (557), Expect = 1.543e-57
Identity = 202/789 (25.60%), Postives = 340/789 (43.09%), Query Frame = 2
Query:  188 CLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNL-LDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSD-----GSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRV--KSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYC----RIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRS---EGIAGIGMENVLSN--PSIKFYRWK-VHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQP-KRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIF-SICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFN-EAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNL 2491
            CL L    +   P     +K G       + Q++ +P    +K   R++ + D                  HN  +++ +++     L +L+  FE  E D +G L    F  ++K  L   +  +   E LF K+D   +G + W ++  YM  E+  KEE       + F LP  +    H   V+++   +      G F+  + DGIL FWS T  + +      + QS++   +  W+ID   ++  + I VA+ + +IEFF++  ++  C     +  L++  + +DY+ D      C   +GD KG   I         L   +  PR+   +    + ++ +L+   P  + +R K +H +W  ++KY   L  + SCS  E ++LV+  + G                           +P K R+S+     N+ KGI  FD+   +N L TGG D  IRLWNP V+ KP  +++GH   + ++ +  +   I  SI  DK ++VWDL D+ CL +   K   +     +  Y   + +L+ +T  + +L                          Y E  SQ          L T    TH  P+    Y++ F QVV+ C    V +W++STG+K  E      ++S +T +  D + R LLTG RDG ++MWN+N G CL      +      EIS + ++    NK   + GW + I  +  Q        Y+ QS         H EDIL++   +   L T+ Y+G I+ WN+
Sbjct:   45 CLLLFFPFRARWPRLMSSEKPGES----PKPQKMAQPGGSQKKETSRSVPVTDPTS---------------HNSEINQRDQQFSDMHLADLQKVFEK-EADENGALKKEGFIRIMKGVLS--SMSEEMLELLFLKVDSDCNGFVTWQKYVDYMMREFQGKEEMRKSQYRLRFHLPMTVIPLHHGSEVVKVACLTKRFKKMGRFLTVTKDGILQFWSETFSMLES---FHLSQSKQYGHQQMWVIDVAYLHNMSLIAVASTELKIEFFDIGGYK--CIRAFTVIDLDSCVMVMDYWTDCHKAVFC---YGDTKGNATIFISDNVAGGLFNPQILPRASKWDHWFTVSLKKLLNEKAPLYRSFRMKGLHPNWCQQVKYIPQLNVVASCSAVEKSSLVLIILPGK--------------------------EPEKPRLSS----LNLRKGILCFDYCPDRNFLATGGYDPHIRLWNPLVSKKPVWLMKGHQTSVTHLLVNSRNASILISISRDKNIRVWDLQDYVCLQSFCGKLFPLGNCPITSTYFYRSSTLICSTYNIGILR------------------------GYLE--SQGP--------LKTGRMTTHNTPLCAVLYSKIFKQVVSGCLQGLVSVWDISTGKKRMEIPVSGIQESELTAMALDQSERCLLTGLRDGTMQMWNYNTGECLMTFPNPDR----VEISGIVHM----NKVFYTTGWSKRITNFTFQKITQALSCYHWQSF--------HTEDILSMDKYQNQFLGTSSYNGDIVFWNV 723          

HSP 2 Score: 78.9518 bits (193), Expect = 3.327e-14
Identity = 50/193 (25.91%), Postives = 85/193 (44.04%), Query Frame = 2
Query: 2573 SINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY-----------ANNKVETDC-------------------------------------PELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFG 3007
            S+ K+LFLQ+R +   +A+L++S   G ++ W++   G L G+F    E G+S+   +A    D +D +L  GD  G I +WDI++Y           + N +  D                                      P LL  W +H+ S+T +  V   Q+++++  D  V+ W   G+ +GTFG
Sbjct:  851 SVEKILFLQTRPRLPHTAALLSSSIDGFIYAWSIHGNGGLLGKFSVDNEVGESVVGAMAT---DENDWILLTGDSKGNIKIWDIKDYCYFIDQQPLQSSGNSLSVDTENKFRLLIPKQLQVCSEHHLPQEEKEVVEGQTFSLVPPPLLITWNSHLDSVTDILYVNSFQLVVSAGQDRDVKAWRLSGDAIGTFG 1040          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Mouse
Match: Wdr49 (WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:3645287])

HSP 1 Score: 176.792 bits (447), Expect = 2.453e-45
Identity = 179/701 (25.53%), Postives = 301/701 (42.94%), Query Frame = 2
Query: 1448 TVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQS-RWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWN---------LMSGHVFFKLISPVAXXXXXXXXXXXXXS-----------------------INKLLFLQSRAKNKSS--ASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVE---TDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEIL 3430
            T FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+             H++     +C +                   K   F    Q DE H      G  +    +Q  +L  K     +    +H   V+C  YN    QV++   GSTV  W + TG+K+ +F   H ++ ++ +  D+   RLLTG  DG V++W+F NG+C   L   +  +   +IS +  ++    K I+ VGW+RA+ V+     P     ++ QS  W   +   H++DIL  A      L T  Y G I++WN         L  G+   +L S V    +  +      S                       + +L FL++R    ++  A+LV+ G  G V FW+  +  +L   F      G  + +       D  ++ L  GD  G++ +W+IE Y  N  E   T  P LLR  + H   I+SL++       ++I+SS DC+V V          FGQ   W++ N   F  P    + L+  ++  +   + P  +    KE+   +ST  + +T++     +NST       ++  EE+N  ++ K     +   L+ +  KP          + + SL +  L + P  ++P  L
Sbjct:   22 TSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSASVIAVQFFAERKQLFSFSRDKVLRLWDIQ------------HQLSIQRITCSFP------------------KSQDFRCLFQFDETH------GRLFISFNNQLALLAIKNEA--SKRVKSHLKAVSCVLYNSLLKQVISSDVGSTVSFWMIETGQKIKQFAGCHGNAEISTMALDANKTRLLTGSTDGTVKVWDF-NGYCHYTLNVGQDGV--VDISQILVLK----KTILVVGWERALIVF----RPQNFNQFFIQSEEWKGGVH--HQDDILCAAFSPPQTLVTGSYDGEIVLWNNNTENAHHALHPGYQ-RQLTSMVDVEAQKLNSRRSCESHGVADQATQAARNVKIDTEGNNAVMRLCFLEARKTKAATGGANLVSCGASGYVRFWDTFK-KVLLAEFLAHAGVGSIIMST------DKLNQYLATGDSDGWLKIWNIEEYCTNSTESKITQPPPLLRSSQPHEDRISSLEMCESCGRLLIISSSADCSVCVTGLSSAPALIFGQASHWNIEN--HFSLPERDTN-LIESKNQEERMKVNPLFS----KEELCLDSTEHSLLTEE---DEDNST-------HLSTEEMNFSLKYK-----RRNSLKKKAYKPCYGEIIQTSTSTFGSLCLRTLKELPEVKKPAFL 641          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Mouse
Match: Wdr49 (WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:3645287])

HSP 1 Score: 140.969 bits (354), Expect = 1.242e-34
Identity = 122/485 (25.15%), Postives = 220/485 (45.36%), Query Frame = 2
Query:  413 DKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPA--RIENTP--HRENVIRITSTSDGS-FIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPY-C--RIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECL--RTWKKQPRSEGIAGIGMENVLS--NPSIKFYRWKVHN-DWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVR---PKGHRIRGDMQSCHYSDFAKSLMIA-TDQVSMLNIK 1816
            D  E ++ +    +++  FE+ +  ++  +   EF   + E +   T E+     LF K+D A  G I+WD+  +++ L   E++E     R  A  +P    +E  P  H++ + ++      S ++  S +G+L  W   L+L++  S+     + ++K  W+   + +   NKI VA   REI F++L S E + C  ++  L+  P+C+DY+ D  +  D ++ +GD  G V  +   A    L  R        E    I    ++S  +      +  +H+ DWV ++ Y  SL   IS +      +V+   E S +L   +K+ S                           FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+     +  +    PK    R   Q   + +    L I+  +Q+++L IK
Sbjct:   44 DLFENKLSVEDFVKIQQVFESQDPSQTICMPREEFVQKMAETVGWGTKEEYGE--LFDKVDVARDGFIDWDKLTSFILLLLYERDE-----RAKATVVPQWKDLEFLPGKHKDTIQKVVFLKSSSRYLTVSKEGLLGIWGENLKLQE--SLPITSDAIKLKHLWVTSLVSLENVNKIAVAFTSREICFYDLLSKEEFPCQYKLQGLQGAPICMDYWYDPIDPKDSILSFGDITGKVQAVAFTAAMISLFERPANACDNEEATMTIDWAELVSGCHKCCHVLQHTLHHGDWVRQVTYNASLDAFISSTMSGINTVVLAWREKSKKL---LKMTS---------------------------FNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSASVIAVQFFAERKQLFSFSRDKVLRLWDIQHQLSIQRITCSFPKSQDFRCLFQ---FDETHGRLFISFNNQLALLAIK 486          
BLAST of WD repeat-containing protein on Y chromosome vs. UniProt/SwissProt
Match: sp|Q8IV35|WDR49_HUMAN (WD repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=WDR49 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.256e-45
Identity = 157/580 (27.07%), Postives = 257/580 (44.31%), Query Frame = 2
Query: 1418 QPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEI-SRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLM---SGHVFF----------------KLIS--------PVAXXXXXXXX-----XXXXXSINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY----ANNKVETDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTN 3034
            + K+R+  + T FNI +GI  FD+    N++ T G++  + LWNPYV SKP G+L GH+  ++ V    +  ++FS   DK +++WD+             H++     +C +                   K   F      DE H      G  +    +Q  +L  K     +    +H+  VTC  YN    QV++   GSTV  W + TG+K+ +F   H ++ ++ +  D+   RLLTG  DG V++W+F NG+C          L   +  AV+  +I    K I+  GW+RAI V+  Q     ++ +     W   +   H +DIL  A L    L T  Y G I++WN     + HV                  KL+S        P+AD             +   ++ +L FL++R        A+LV+ G  G V FW++ +  +L   F   +  G  + +       D  ++ L  GD  G++ +W+IE Y    + NK+ T  P L+R ++ H   I+SL++       ++I+SS DC++ V       V  FGQ + W + N
Sbjct:    6 KSKKRL--NMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQ------------HQLSIQRIACSFP------------------KSQDFRCLFHFDEAH------GRLFISFNNQLALLAMKSEA--SKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTGSTDGTVKIWDF-NGYC-------HHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQ---NFNQFFIQPEEWKGGIQ--HHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLL-AEFLAHSGVGSIIMST------DKMNRYLTTGDLDGWLKIWNIEEYCLNSSKNKI-TKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIEN 524          
BLAST of WD repeat-containing protein on Y chromosome vs. UniProt/SwissProt
Match: sp|B0WYR6|WDY_CULQU (WD repeat-containing protein on Y chromosome OS=Culex quinquefasciatus OX=7176 GN=WDY PE=4 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.579e-45
Identity = 198/934 (21.20%), Postives = 378/934 (40.47%), Query Frame = 2
Query:  554 FEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLK-AREMAFCLPARIENTPHRENVIRITST-----------SDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFEL--SSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQP----RSEGIAGIGMENVL--SNPSIKFYRW-KVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSC-HYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAH--------EDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGH--LLATADYHGTIIVWNLMSGHVF--FKLISP------------------------------------VAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIE---NYANNKVE-------------------TDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMW-----DLTNPKTFQHPMVP 3064
            F D + ETLF KI+        WDE  +Y+ L +   +   ++ + ++   L   ++       VI+I  +           S G +   + + +++FW    + +K     +++  +R K+ WI+D  ++ + N   VA  + E+  +++  S F     ++ + N    L Y+         ++  GD KG + ++  +         +K+P     +  +  +   ++L  S P ++   + ++  D V +L++ +     ++CS ++  A         ++      +   H TK   +                T   + KG+  F +   K+ LVTGG D  +R+W+      P   L GHN  +V++ + +   +I+S+   K VK+WD+ +   + T       +   + +C +Y+D  + L+I  ++V  L+    P                                 K P+  TD   +H  P++   YN  F  +++C   S + +W+ +   K+    +AH        E   +T   FD   + LLTG RDG +++WNFN+G C++ +  +E      E++AV +   S    I+++GW+ A+ V       GM    +P+     D    H +DIL  +        +AT  Y G I+ W + +G  +  F    P                                       +          L+I++LLFL+SR  +    +L++S   G++  ++    G   G F     +G  + +M      D  +K LF G   G++  W +E   N A  K++                      P LL  ++AH + IT+L  +  +++L+++S D T+R+W+  G Y+G  G    W     D+  PK +   + P
Sbjct:   64 FSDEEFETLFMKINTDRDNFCQWDELISYLILGFHNDDPLAVQESLDLPISLDMSVKLGRQTYPVIKIEYSPMVSYDGTVNWSQGFWATSTQEAVINFWKRDWKHEKTGKAFSVDL-KRAKT-WILDTAVLPDLNYFCVACLEHELRIYDIIGSGFTLKIIVNRIPNPINALKYHFSASTRSKLIM--GDYKGVLRVVEFYPE-------RKEPFKFDAASTVTRLSFRDLLNGSYPQMECVDYGRLLPDIVRQLQFVEPTYSFLACSENDPLA------PSGSRKKLYTSVIIQHLTKLDKI----------------TKIKVPKGVTCFAYDHVKDFLVTGGPDGELRMWDIRRPENPVASLSGHNAGVVFMFLQDGSQKIYSMDTKKIVKIWDVLNRILIQTYSQFSTTLYKTVPACAYYNDLNRELVIGANKV--LSAPCCP---------------------------------KIPLEVTD-GESHTQPISVLLYNPLFKVLISCGLDSYIIVWDHTMNRKLTIITDAHTQVVNGLLEQVQITAACFDPKLQLLLTGARDGTLKVWNFNSGSCMSSMSIQEG----CEVTAVFWEPTS----ILAMGWNHAV-VEFPVGTTGMD---FPRGI---DWQKLHSDDILCASVTHSEPKAIATCSYTGEIVFWLMETGQPYQRFNAAKPQQKIPVNAMTTKIGKPKRRSRMSVFMPQEQLRQRRLTRIVMPVKAEQLRQLTIHELLFLESRPMHPEVGTLLSSLDTGVIQVYSHHVDGGFLGSFNAVHMAGDRVVSMTT----DPYNKFLFTGSYLGYVKTWLLEASFNRAALKMQFPFLLDDIIPGRAKRSVANQPLPWLLNSYQAHRNCITALSYIPATKLLLSASSDHTIRIWSLAGRYIGLLGSPVKWATIDADVPIPKEYGFRIPP 909          
BLAST of WD repeat-containing protein on Y chromosome vs. UniProt/SwissProt
Match: sp|B7FF06|WDY_DROGR (WD repeat-containing protein on Y chromosome OS=Drosophila grimshawi OX=7222 GN=WDY PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.708e-42
Identity = 151/615 (24.55%), Postives = 248/615 (40.33%), Query Frame = 2
Query: 1442 DQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQS-----CHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHE--------DSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVF--FKLISPVAXXXXXXXX-------------------------------------XXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETD--C-----------------------------PELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNP 3037
            D+  F I  G+  F   +SKN+LVTGG D  +R+W+ Y++S+P+ +L GHN  +V V +  +EN+++S+   K +KVWDL +H  L T    G  +R    S      +Y    + L++A  +  ++ IK  P V     D                                    TH  PV+   YN  F  +VTC   S + +W+  TG +       H         D  +T   FD   + LLTG RDG +++WN+NN   +  +  +       E++AV +V I R   I+++GWDR +  + D       + Y    +W    +  H +DI       G  + TA Y G II W L +G  +  + +++P   ++   +                                       +  +S+  +LFLQ R   K   S+  S   G +  ++  + G    +F    + G  +  M +    D  ++ L+ G  FG+I +W I NY   + E    C                             P L+  ++ H+ +I S+  +   ++L T S D + R+WT  G Y+GT G    W    P
Sbjct:  326 DRNNFRIPLGVSVFYVAESKNILVTGGPDTFVRIWDVYISSEPSAILTGHNGGIVAVFVQPEENKVYSVDYHKVIKVWDLQEHTLLQTF---GELVRIIHHSETDIKYYYHSHLRDLLVAGRK--LIQIKCCPRVRVDLTDGN----------------------------------THAAPVSVVLYNRLFRNIVTCGLDSYIIVWDPWTGRRKIIMKNCHTKMIYGEIIDIEITAACFDPLEQFLLTGARDGSLKIWNYNNAVVVRNMSIQPDQ----EVTAVIWV-IDR---ILAMGWDRQVTEFNDVAG----REYGDPKKW----AKFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPYRRYNVMNPYQFIELKLNTEEEKLTRRSKRISSLMGAGRRTLVLQNFKPDEIKDYGANIPVSVQAVLFLQKRPMTKDHGSVFISLDTGYIQVYSHHQHGGFIKQFFAVHKVGDCVLTMAS----DRKNRFLYTGTAFGYIKIWHIVNYCIPQAEKTEVCMPRLRLDFIFLRKDLFLTRAKRVIRNQPEPMLVSSYKGHLKAINSIGFINLPKILFTGSHDYSCRLWTQGGRYLGTLGTVLPWSKLTP 881          
BLAST of WD repeat-containing protein on Y chromosome vs. UniProt/SwissProt
Match: sp|B7FF08|WDY_DROVI (WD repeat-containing protein on Y chromosome OS=Drosophila virilis OX=7244 GN=WDY PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.185e-41
Identity = 151/614 (24.59%), Postives = 249/614 (40.55%), Query Frame = 2
Query: 1442 DQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLT----VRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHE--------DSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVF--FKLISP-------------------------------------VAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETD--C-----------------------------PELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNP 3037
            D+  F I  G+  F   + KN+LVTGG D  +R+W+ Y++S+P+ +L GHN  +V V +  +EN+++S+   K +KVWDL +H  L T    VR   H    D++  ++S   + LM+A  +  ++ IK  P V     D                                    TH  PV+   YN  F  +VTC   S + +W+  TG +       H         D  +T   FD   + LLTG RDG +++WN+NN   +  +  +       E++AV +V + R   I+++GWDR +  + D       + Y    +W    +  H +DI       G  + TA Y G II W L +G  +  + ++ P                                     +   +      +  +S+  +LFLQ R   K   S+  S   G++  ++  + G    +F    ++G  +  M      D  ++ L+ G  FG+I VW I NY   K E    C                             P L+  ++ H+ +I S+  +   +++ + S D + R+WT  G Y+GT G    W    P
Sbjct:  318 DRNNFRIPLGVSVFYVSEIKNILVTGGPDTFVRIWDVYISSEPSAILTGHNGGIVAVFVQPEENKVYSVDYHKIIKVWDLQEHTLLQTYGDLVRII-HHSETDIKYYYHSHL-RELMVAGRK--LIQIKCCPRVRVDLTDGN----------------------------------THAAPVSVVLYNRLFRNIVTCGLDSYIIVWDPWTGRRKIIMKNCHTKMIYGETIDIEITAACFDPLEQFLLTGARDGSLKIWNYNNAVVVRNMSIQPDQ----EVTAVIWV-VDR---ILAMGWDRQVTEFNDV----EGREYGDPKKW----AKFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPYRRYNVMDPSRFIELKLNAEEEKLTRRSKRMSSLIGVNRRSTSVQAIKPDEIKDYGANIPVSVQAVLFLQRRPMTKEHGSVFISLDTGIIQVYSHHQHGGYIKQFTAVHKTGDCVLTMAT----DRKNRFLYTGTAFGYIKVWHIVNYCIPKAEQTYVCMPRLRLEFIFLRKELFLTRAKRMVRFQPEPMLVSSYKGHLKAINSIGFINLPKIIFSGSHDYSCRLWTQGGRYLGTLGTVLPWSKLTP 873          
BLAST of WD repeat-containing protein on Y chromosome vs. UniProt/SwissProt
Match: sp|B7FF07|WDY_DROMO (WD repeat-containing protein on Y chromosome OS=Drosophila mojavensis OX=7230 GN=WDY PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 2.017e-40
Identity = 148/615 (24.07%), Postives = 245/615 (39.84%), Query Frame = 2
Query: 1442 DQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQS-----CHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHE--------DSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVF--FKLISP-------------------------------------VAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETD--C-----------------------------PELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNP 3037
            D+  F I  G+  F   + KN+LVTGG D  +R+W+ Y++S+P+ +L GHN  +V V +  +EN+++S+   K +KVWDL +H  L T    G  +R    S      +Y    + LM+A  +  ++ +K  P V     D                                    TH  PV+   YN  F  +VTC   S + +W+  TG +       H         D  +T   FD   + LLTG RDG +++WN+NN   +  +  +       E++AV +V + R   I+++GWDR +  + D       + Y    +W    +  H +DI       G  + TA Y G II W L +G  +  + ++ P                                     +   +      +  +S+  +LFLQ R   K   S+  S   G++  ++  + G     F    + G  +  M      D  ++ L+ G  FG+I +W I NY   + E    C                             P L+  ++ H+ +I S+  +   ++L + S D + R+WT  G Y+GT G    W   +P
Sbjct:  318 DRNNFRIPLGVSVFYVSEVKNILVTGGPDTFVRIWDVYISSEPSAILTGHNGGIVAVFVQPEENKVYSVDYHKIIKVWDLQEHTLLQTY---GELVRIIHHSEMDIKYYYHSHLRELMVAGRK--LIQVKCCPRVRVDLTDGN----------------------------------THAAPVSVVLYNRLFRNIVTCGLDSYIIVWDPWTGRRKIIMKNCHTKMIYGETIDIEITAACFDPLEQFLLTGARDGSLKIWNYNNSVVVRNMSIQMDQ----EVTAVIWV-VDR---ILAMGWDRQVTEFNDV----EGREYGDPKKW----AKFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPYRRYNVMDPSQFIELKLTAEEEKLSRRSKRISSLLGANRRSASMLAIKPDEIKDYGANIPVSVQAVLFLQKRPMTKDHGSVFISLDTGIIQVYSHHQHGGHIKEFIAVHKVGDCVLTMAT----DRKNRFLYTGTAFGYIKIWHIVNYCIPEAEKTHVCMPKLRLDFIFLRKELFLTRAKRMVRNQPEPMLVSSYKGHLKAINSIGFINLPKILFSGSHDYSCRLWTQSGRYLGTLGTVLPWSKLSP 873          
BLAST of WD repeat-containing protein on Y chromosome vs. TrEMBL
Match: A0A2C9JDI5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057318 PE=4 SV=1)

HSP 1 Score: 1020.38 bits (2637), Expect = 0.000e+0
Identity = 526/1135 (46.34%), Postives = 745/1135 (65.64%), Query Frame = 2
Query:   50 TFKMSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKL--KKAGTHIGFLKE--SQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRK-HNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIE-QSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEG-IAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMK-LKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKK--EESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQC-EPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQP 3421
            + KM S R       + P K +IRP+SAS N+QTH SYTTGLYD     L+     SL   N+   ++  T  G  +E  S R ++  + ++ PRR T+  V+G+     I R  ++ +     L DKIEE+I++  LEELK+AF +A+ +R+G LDL EFK LLKE+L L   +D Q ++LF KIDW+S GAI+WDEFCTYMQLEYAEKE++YL+A+E++F LPA+IE+ PHR+ V+RIT TSDG+FIA S +G ++FWS+  ELK+ +SVV  +  S R KSKWI DF +M  FNK+IV TGDREI+FFELSSF+PYC+I+ LE VPL LDY       D+CLIL+GD  GCVNI  + + GECLRTWKK    +G IA I ++ V+S  ++ F RW+VH DWV ++KYY  + Q+ISCSN  +TALVIG   GST ++QQ++ +K ++ ++ K+         K+R+  D+TVF +YKG++ FDF K+KNV+VTGG+DRIIRLWNPYV+ KPT MLRGH  P+ Y+ IAE++NRI+SI  D+C++VWD+ DH CLLT+RPK H+IRGD+Q+ +YS+ ++SL +ATDQ++++N+K             H+ +                       L+ D+ V+HKDPVTCCKYN  F Q+VTCC GS VKLW+  TG  +FE+ EAH +  +TC+TFD+T RRL+TGGRDG +++WN+NNGHCL  LKK  +++++   EI  V Y+E+++N+++++VGWD+ IN+Y D   +  +    +P   WLDD+ NGHKED+L++A    +LLAT  Y G +IVWN++SGH+F  L  P      +   +D D++I KL+FLQ+RA  K + +LV SGP   +H WNV +GG L  +F+G +  G  ++ +++    +  + +L+  D  GFI  W++ +Y   +   + PELL +WR HV S+ S+DLV  + VL+TSS DCTVR+WT +G Y+GT GQ+E WDL NP TFQHPMVPY+VL+ P SLP HPVL         ++QS  +  H+    K     S    F  K    +DDE+I   +E++ + +G GKRLR E+ K      E  G + ++ +   +L   P    P
Sbjct:    4 SVKMPSNREISPFSPLPPIKKRIRPTSASANLQTHPSYTTGLYDN---VLR---TSSLATGNQTIKQRPHTQAGGPREQNSYRPVDTHENVKHPRRLTLGTVEGIAELDSILRVGNIQISAAQQLKDKIEEKINIDTLEELKSAFMSADVNRTGSLDLEEFKKLLKEQLGLGPSKDAQIDSLFMKIDWSSEGAISWDEFCTYMQLEYAEKEDSYLRAKEVSFHLPAKIESIPHRDLVLRITDTSDGTFIACSQEGTVTFWSSNTELKRTRSVVNQDIMSNRTKSKWITDFCLMPHFNKLIVGTGDREIQFFELSSFDPYCQIYGLETVPLKLDY--SSTGHDECLILFGDNVGCVNIFVIKSAGECLRTWKKMTVPDGFIATIHLDAVISGFNVNFIRWQVHEDWVGQIKYYHDIGQVISCSNHPSTALVIGSTTGSTHVEQQLREIKDVNYSQEKNKQKAAYNIVKKRLGADETVFKVYKGVKVFDFSKAKNVIVTGGMDRIIRLWNPYVSLKPTAMLRGHAAPIFYLTIAEEDNRIYSISTDRCIRVWDIQDHTCLLTIRPKSHKIRGDLQAVYYSNISRSLAVATDQMAIMNLK-------------HKSS-----------------------LNADMVVSHKDPVTCCKYNPEFKQIVTCCCGSIVKLWDFETGSLIFEYGEAHGEEAITCMTFDNTKRRLITGGRDGSLKIWNYNNGHCLRVLKKKAKKNNVHTDEICDVTYIEMNKNRYVIAVGWDKRINIYYDTVNDTNIQYVQHPTPYWLDDLKNGHKEDVLSIAHCLPNLLATGSYDGEVIVWNMVSGHIFCHL-RPPPPPGYEDQNLDGDMNIAKLIFLQTRASKKDAGALVVSGPRAHIHIWNVSQGGTLMAQFQGSSIKGSMVSQLVS----NSANTVLYSSDTSGFIYAWNLTDYCLTRPAHEPPELLYKWRGHVESVASMDLVESNNVLVTSSSDCTVRLWTHQGHYIGTLGQSEQWDLYNPSTFQHPMVPYEVLIDPLSLPSHPVL--------LEKQSTHDIIHQGDEDKSLRSVSPQVVFNTKQSYVVDDEKIKALLEERPFDKGTGKRLRHEKHK--KMRDESSGTSVWQEISCHQLQDPPKRESP 1079          
BLAST of WD repeat-containing protein on Y chromosome vs. TrEMBL
Match: A0A210QEC0 (WD repeat-containing protein 49 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12579 PE=4 SV=1)

HSP 1 Score: 1014.99 bits (2623), Expect = 0.000e+0
Identity = 531/1129 (47.03%), Postives = 737/1129 (65.28%), Query Frame = 2
Query:  107 KIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAG----THIGFLKESQRIIEPKDE-----IRKPRRRTIEIVDGMDITKFIGR-EMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQ-VSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYID--QCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGP-RMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIY---------IDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPE 3424
            K KIRPSSA+  +Q+H S+ T ++D       +    +   S +  +AG    TH    +   R   P+DE      ++PRR T+  VDG+   + I R  M        L  KIEE+I+L  LE LK AF  A+ D SG+L+L EFKALLKE+L L    D Q ++LF KIDW+S GAI WDEFCTYMQLEYAEKE++YL+++++AF LPA+I N   RE+++RIT TSDG+F+A S DG +SF    +++KK K ++  E   + K KWI DF+IMNEFNK +V TGDREI+F+ELSS +PYC++  L+ VPL LDY       D+CLIL+GD  GC+NIL +++ GECLRTWKK P+ +GIA + +++V+    +++ RW+VH DWV +LKYY ++ QIISCSN+  TALVIGC  GST ++ Q+K     + +++     N+ +P  R+  DQ+VF +YKG++ FDF K+KNV+VTGG+DRI+RLWNPYV  KPT +LRGHN P+ Y+ IAE+E+RIFSI  DKCVK+WD+ DHNCLLT+RPK H+I GD+Q+CHYS+ AKSL +ATDQ ++ LN++                                    + PVLH D+ +THK+PVTCCKYN +FNQV+TC EGS +KLW+  +G  +FEF +AH ++ +TC+TFDSTGRRLLTGGRDG +++WN+NNGHCL  LKK   D +  E+  + YVE++RN++++SVGWDR IN+Y D    +  +H    P   W DD  NGHKEDIL +A    +L+AT  Y G +IVWN++SGH+F  L + V   + + + +D D+S+NKL+FL+SR   K+SASL+ASGP+G +HFWNV +GG +  +FKG   SG  +T M      D  + +LF GD  GFI ++D++ Y  N      P L+  WR HV S+ +L++V +++V++T+S DCTVR+WTF  +Y+GT+GQ E WDL +P TFQHPMVPYDVL+ P SLP HP+      T +  K+ +K E       T Q  LQ +N  F   + I          + DE++N++  QK     +GK LR E+ K +   ++ GGPNEY  L+   L  TP P  P+
Sbjct:   86 KKKIRPSSAAAKLQSHPSFYTNIFD-------NSRPATATTSTRSPEAGQRPVTHAAGGRRQYRA-PPEDERLKEIAKQPRRLTLGAVDGISELEHIPRPSMGNGAISAQLKSKIEEQINLDTLEILKQAFVEADEDGSGELELDEFKALLKERLHLKGTNDAQIDSLFMKIDWSSDGAITWDEFCTYMQLEYAEKEDSYLRSKDVAFHLPAKIINC--RESILRITDTSDGTFVACSLDGNVSFMGTNMDIKKHKCLINNEPGLKQKQKWITDFVIMNEFNKFLVGTGDREIQFYELSSLDPYCQVSGLDTVPLKLDYC--STGTDECLILYGDSLGCINILLVNSAGECLRTWKKAPKHDGIASVSLDSVIKVQKVQYLRWQVHGDWVQQLKYYHNIGQIISCSNNANTALVIGCTTGSTHVEAQLKETKDPEDRARRT---NVAKP--RLEADQSVFYVYKGVKCFDFCKNKNVIVTGGMDRIVRLWNPYVPGKPTALLRGHNAPIFYLFIAEEESRIFSISTDKCVKIWDIQDHNCLLTIRPKAHKIHGDLQACHYSNIAKSLAVATDQKLAALNLR------------------------------------QKPVLHADITITHKEPVTCCKYNPSFNQVITCSEGSVIKLWDFESGAGIFEFGDAHGEAAITCMTFDSTGRRLLTGGRDGTIKIWNYNNGHCLRMLKK---DAETDEVCDLTYVEMNRNRYVISVGWDRTINIYSDDANADSNIHLVQNPNLFWADDKKNGHKEDILAIAQSPPNLIATGSYDGEVIVWNMVSGHIFCHLRAAVP-PNYEDESLDGDMSVNKLVFLKSRESRKASASLIASGPHGHIHFWNVFQGGSMMAQFKGSKSSGGMITTMAT----DDANTMLFCGDSLGFILIYDVDGYCLNGKTKAPPTLIHSWRGHVDSVLNLEMVEKNKVILTASMDCTVRMWTFNSDYIGTYGQPEPWDLYDPSTFQHPMVPYDVLIDPMSLPPHPIFDQISETPDLLKDTTKTEDAPVRTPTPQ-VLQGKNQFFVDDDTIARQLKDLSGTLKDEKLNEEEIQKF----RGKWLRHEKTKIKP--TDRGGPNEYHMLKWSPLKDTPMPPPPK 1146          
BLAST of WD repeat-containing protein on Y chromosome vs. TrEMBL
Match: A0A2C9JDI7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057318 PE=4 SV=1)

HSP 1 Score: 1013.83 bits (2620), Expect = 0.000e+0
Identity = 527/1136 (46.39%), Postives = 740/1136 (65.14%), Query Frame = 2
Query:   50 TFKMSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHI--GFLKE--SQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRK-HNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIE-QSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEG-IAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMK-LKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYA---EISAVEYVEISRNKFIVSVGWDRAINVYIDQC-EPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQP 3421
            + KM S R       + P K +IRP+SAS N+QTH SYTTGLYD     L+     SL   N+  K   H   G  +E  S R ++  + ++ PRR T+  V+G+     I R  ++ +     L DKIEE+I++  LEELK+AF +A+ +R+G LDL EFK LLKE+L L   +D Q ++LF KIDW+S GAI+WDEFCTYMQLEYAEKE++YL+A+E++F LPA+IE+ PHR+ V+RIT TSDG+FIA S +G ++FWS+  ELK+ +SVV  +  S R KSKWI DF +M  FNK+IV TGDREI+FFELSSF+PYC+I+ LE VPL LDY       D+CLIL+GD  GCVNI  + + GECLRTWKK    +G IA I ++ V+S  ++ F RW+VH DWV ++KYY  + Q+ISCSN  +TALVIG   GST ++QQ++ +K ++ ++ K+         K+R+  D+TVF +YKG++ FDF K+KNV+VTGG+DRIIRLWNPYV+ KPT MLRGH  P+ Y+ IAE++NRI+SI  D+C++VWD+ DH CLLT+RPK H+IRGD+Q+ +YS+ ++SL +ATDQ++++N+K             H+ +                       L+ D+ V+HKDPVTCCKYN  F Q+VTCC GS VKLW+  TG  +FE+ EAH +  +TC+TFD+T RRL+TGGRDG +++WN+NNGHCL  LKK+          EI  V Y+E+++N+++++VGWD+ IN+Y D   +  +    +P   WLDD+ NGHKED+L++A    +LLAT  Y G +IVWN++SGH+F  L  P      +   +D D++I KL+FLQ+RA  K + +LV SGP   +H WNV +GG L  +F+G +  G  ++ +++    +  + +L+  D  GFI  W++ +Y   +   + PELL +WR HV S+ S+DLV  + VL+TSS DCTVR+WT +G Y+GT GQ+E WDL NP TFQHPMVPY+VL+ P SLP HPVL         ++QS  +  H+    K     S    F  K    +DDE+I   +E++ + +G GKRLR E+ K      E  G + ++ +   +L   P    P
Sbjct:    4 SVKMPSNREISPFSPLPPIKKRIRPTSASANLQTHPSYTTGLYDN---VLR---TSSLATGNQTIKQRPHTQAGGPREQNSYRPVDTHENVKHPRRLTLGTVEGIAELDSILRVGNIQISAAQQLKDKIEEKINIDTLEELKSAFMSADVNRTGSLDLEEFKKLLKEQLGLGPSKDAQIDSLFMKIDWSSEGAISWDEFCTYMQLEYAEKEDSYLRAKEVSFHLPAKIESIPHRDLVLRITDTSDGTFIACSQEGTVTFWSSNTELKRTRSVVNQDIMSNRTKSKWITDFCLMPHFNKLIVGTGDREIQFFELSSFDPYCQIYGLETVPLKLDY--SSTGHDECLILFGDNVGCVNIFVIKSAGECLRTWKKMTVPDGFIATIHLDAVISGFNVNFIRWQVHEDWVGQIKYYHDIGQVISCSNHPSTALVIGSTTGSTHVEQQLREIKDVNYSQEKNKQKAAYNIVKKRLGADETVFKVYKGVKVFDFSKAKNVIVTGGMDRIIRLWNPYVSLKPTAMLRGHAAPIFYLTIAEEDNRIYSISTDRCIRVWDIQDHTCLLTIRPKSHKIRGDLQAVYYSNISRSLAVATDQMAIMNLK-------------HKSS-----------------------LNADMVVSHKDPVTCCKYNPEFKQIVTCCCGSIVKLWDFETGSLIFEYGEAHGEEAITCMTFDNTKRRLITGGRDGSLKIWNYNNGHCLRVLKKKAKKNNAVHTDEICDVTYIEMNKNRYVIAVGWDKRINIYYDTVNDTNIQYVQHPTPYWLDDLKNGHKEDVLSIAHCLPNLLATGSYDGEVIVWNMVSGHIFCHL-RPPPPPGYEDQNLDGDMNIAKLIFLQTRASKKDAGALVVSGPRAHIHIWNVSQGGTLMAQFQGSSIKGSMVSQLVS----NSANTVLYSSDTSGFIYAWNLTDYCLTRPAHEPPELLYKWRGHVESVASMDLVESNNVLVTSSSDCTVRLWTHQGHYIGTLGQSEQWDLYNPSTFQHPMVPYEVLIDPLSLPSHPVL--------LEKQSTHDIIHQGDEDKSLRSVSPQVVFNTKQSYVVDDEKIKALLEERPFDKGTGKRLRHEKHK--KMRDESSGTSVWQEISCHQLQDPPKRESP 1080          
BLAST of WD repeat-containing protein on Y chromosome vs. TrEMBL
Match: A0A1S3JIB5 (WD repeat-containing protein on Y chromosome OS=Lingula unguis OX=7574 GN=LOC106173522 PE=4 SV=1)

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 507/1035 (48.99%), Postives = 677/1035 (65.41%), Query Frame = 2
Query:  389 SLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQT------KSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN---------------KFIVSVGWDRAINVY-IDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEI 3427
            +L +  L  KIEE+I++  L  LK AFE A+ D SG+LDL EFK LLK KL+L   ++ Q + LF KID++S G I WDEFCTYMQLEYAEKE++Y + ++++F LPARIE TPHR+ V++IT  SDG+ +A S DG +SFW+  L+LK+ +S+V  + + + K KWI D ++M +FNKIIV TGDREI+F+ELSSFEPYC+I  LE VPL +DY       D+CLIL+GD  GC+NIL +  TGECLR WKK P+ EGIA +G+E V      KF RWKVH DWV ++KYYD + Q+ISCSN   TALVIGC  GST +DQQ+K      T      K K+ T      PK R+ +DQ VF +YKG++TF F K KN LVTGG+DRI+R+WNPYV +KPTGMLRGHN P+ Y+ ++E+++RIFSI  DKCVKVWD+ D NCL+TVRPK H+IRGD+QSC+YS   K L++ATDQ+S+L IK                                      P+L  ++ +TH+DPV   +YN  F Q++TC   STVKLW+  +G  +F+F+ AH D+ +TCL FD+TGRR +TG RDG +++WN+NNGHCL  L KE  +    EI +  Y+E+++N               +++VSVGWD  +N+Y  DQ +  +  +  PQ  W DD+ NGHKEDIL++A    +LLAT+ Y G +IVWN++SGH+F  L +PV         +D DLSINKLLFL+SRA  K +ASL+A GP G +HFWNV  GG LY +F G   +G  +TAM   K    +D +LF  D  GFI  W++E Y      TD PEL+  WR HV SIT++D++ + +++I+SS DCTVR+WT EG YVGT GQ + WD+ NP TFQHPMVPYDVLV P+SLP HPV+  ++ +E+     K +   + K+        + S F       +DD  I +QI+QK + +G GKR+R ERMK R    +  GP+EYR LQ F L +TP  + PEI
Sbjct:   71 ALAEDALKKKIEEKINIDTLNLLKQAFEEADEDGSGELDLDEFKVLLKSKLKLEGTKEQQIDALFYKIDYSSDGLITWDEFCTYMQLEYAEKEDSYRRLKDVSFQLPARIETTPHRDTVLKITDASDGTILACSQDGTVSFWNGNLDLKRVRSIVPNDPAMKPKQKWITDMVLMPQFNKIIVVTGDREIQFYELSSFEPYCQISGLETVPLKIDYC--GTGPDECLILYGDSIGCINILSIENTGECLRLWKKMPKVEGIATVGIEAVAGGGMTKFIRWKVHGDWVQEVKYYDEIGQVISCSNHSQTALVIGCTSGSTNVDQQLKDTKDSNTLVDNSSKGKNKTNTAYAVPKERLPSDQHVFRVYKGVKTFAFSKDKNTLVTGGMDRIVRMWNPYVPAKPTGMLRGHNAPIFYLFVSEEDDRIFSISTDKCVKVWDIQDQNCLVTVRPKSHKIRGDLQSCYYSAPNKCLVVATDQISLLAIKSR------------------------------------PILQAEIVLTHRDPVHTARYNPQFKQIITCSAASTVKLWDFESGNPIFDFSNAHGDAAITCLCFDNTGRRCITGARDGCLKIWNYNNGHCLRVLMKESGN---DEICSCAYIEMNKNRKLLDVNTEIEIRPQRYVVSVGWDHRVNIYSDDQDDDDVRHTIDPQPPWQDDLENGHKEDILSVAFCPPNLLATSSYDGEVIVWNMVSGHIFCHLFAPVP-KGYKDQSLDGDLSINKLLFLRSRAYKKDAASLIAGGPRGYLHFWNVFHGGSLYAQFTGTKHTGAMVTAMELYK----NDTILFTADSVGFIYCWNVEGYCAKSKATDSPELITYWRGHVESITNIDVIEEHKMMISSSLDCTVRLWTIEGHYVGTLGQPDPWDVFNPNTFQHPMVPYDVLVDPKSLPSHPVIAGKLNLEEVLHGDKKKDKVEEKIPPAPVYGEQTSYF-------VDDATIAEQIKQKPFNKGTGKRVRHERMKARQMKIDRDGPSEYRLLQTFPLVETPDIKPPEI 1052          
BLAST of WD repeat-containing protein on Y chromosome vs. TrEMBL
Match: A0A2T7PLK9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05579 PE=4 SV=1)

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 485/988 (49.09%), Postives = 664/988 (67.21%), Query Frame = 2
Query:  416 KIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEG-IAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMK-LKSMH-QTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKE-------ESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQ-CEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKA------KMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMK 3328
            +IEE+I++  LE LK AF  A+ + SG+L+L EFK LLK +L LP   + Q + LF KIDW+S G+I WDEFCTYMQLEYAEKE++YL+A+E+ F  PARIEN PHR+ ++RIT TSDG+FIA S +G ++FWS++ ELK+ + VV  E + R K KWI DF+IM+ FNKIIV TGDREI+FFELSSFEPYC+I  L+ VPL LDY       D+CLIL+GD +GCVNIL + + GECLR   K    EG IA IG++ V + P+++F RW+VH+DWV ++KYY  + Q+ISCSN+   ALVIGC  GST ++QQ+K L+ +    K++  T+      K R+  DQ VF +YKG++ FDF K KN+++TGG+DRIIRLWNPYV+ KPT MLRGHN P+ ++HIA+Q++RI+S+  D+C+KVWD+ D  CLLTVRPK HRIRGD+Q+ HYS  ++++ +ATDQ+++L +             RH+ +++L                       D+ ++HKDPVTCCKYN +F QVVTCC GS VKLW+L TG  +FE+ +AH+ S +TC+TFD+T RRL+TGGRDG++++WN+NNGHCL  LKK+       E D    EI  + YVE+++N++++SVGWDR IN+Y D   +  +H   +P   W DD  +GHKED+L +A    +LLATA Y G IIVWN++SGH+F  L  P +    +   +D DL I++LLFL++RA  K + SLVASGP G +H W+V +GG L  +F G    G S++AM+  K     + +L+  D  GF+ VWDI  Y   K     PE++  WR HV  IT L+LV Q +VL++SS DCTVR+WTF+G Y+GTFGQ   WD+ NP T+QHPMVPYDVLV P SLP HPV+  R            ESTH+       K  +   + S    +  K   +I DE+I+  ++++ + +  GKRLR E+ K
Sbjct:  271 EIEEKINIDTLETLKQAFAAADRNHSGELELDEFKKLLKAQLHLPPNRENQIDALFMKIDWSSEGSITWDEFCTYMQLEYAEKEDSYLRAKEVVFQTPARIENIPHRDPILRITGTSDGTFIACSHEGYVTFWSSSAELKRTRCVVNTESTSRTKPKWITDFVIMSHFNKIIVGTGDREIQFFELSSFEPYCQISGLDTVPLKLDY--SSTGYDECLILYGDTQGCVNILIIKSAGECLRQMVKH---EGFIASIGLDAVANGPNVQFIRWQVHDDWVQQIKYYHEIGQVISCSNNPNKALVIGCTVGSTHVEQQLKELRDLGCAEKARSKTYYAYNNTKTRLEADQAVFKVYKGVKCFDFSKDKNIIITGGMDRIIRLWNPYVSHKPTAMLRGHNAPIFFLHIADQDDRIYSLSTDRCLKVWDIQDQTCLLTVRPKSHRIRGDLQAVHYSPVSRAIAVATDQMAVLCL-------------RHKSSTHL-----------------------DIVMSHKDPVTCCKYNSSFKQVVTCCSGSVVKLWDLETGAPIFEYGDAHDGSAITCMTFDNTLRRLITGGRDGVLKIWNYNNGHCLRTLKKKTENTDFNEQDSSQNEICDLTYVEMNKNRYVISVGWDRRINIYYDSVADSNIHHVQHPVPYWADDERDGHKEDVLAIAHCLPNLLATASYDGEIIVWNIVSGHIFCHL-RPPSPPGYEDQSLDGDLGISRLLFLKTRAYKKDAGSLVASGPRGHIHIWSVFQGGQLLAQFPGSKVPGASVSAMVTNK----VNTVLYTADSLGFVYVWDISTYCLEKSADGPPEVIATWRGHVEHITCLELVEQHKVLLSSSVDCTVRIWTFDGHYIGTFGQPVPWDVYNPATYQHPMVPYDVLVDPMSLPVHPVIAQR------------ESTHEVIHLDSKKDGEDKRIPSPPPQYGSKQQFFISDEQISAMLKERPFDKATGKRLRHEKNK 1200          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Cavefish
Match: wdr95 (WD repeat-containing protein on Y chromosome-like [Source:NCBI gene;Acc:103021898])

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 431/1109 (38.86%), Postives = 646/1109 (58.25%), Query Frame = 2
Query:  119 RPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKP------RRRTIEIVDGMDITKFIGREMSLSLRKHNLLD-KIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMK--LKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPY---GLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPS 3409
            RPSSA G IQT         +   +  +       P    +K+ G+ +   K S++ + P D + +       RR ++ + D    TK I ++ S+     +L   KIE+R+ L  L +LK AFE+ E   +  LDL  F+  ++  L L    D Q   LF KID++  G++ WDEFCTYMQLEY EKEE  ++++++AF LPA ++   H E +++I   SDG  +    DG +S+WS+TL+L+K KSV   E+    K+KW  D + M ++NK+I+ TGDREI+ +ELSS EP+C+I+SLE VPL LDY       D+C +++GD +GCV+I+ + + GE LR WKK P+ E +  I +++ + +P+I + RWKVH DWV K+KY+ S+  ++S SN EA+ALVIGC+  ST ++QQM+   ++  + K K   FG +  P++R++ DQTVF+IYKG++TFDF  ++N+L+TGG+DR+IR+WNPYV   PTG+L+GH+ P+ Y+HIA ++ R+FS+  D   ++WD+ D +CL    PK   +RG++ +C YS   + L I+TD +++L++K     AE Q            G Y                       +HK+ V CC Y+  F QVV+C EGS +K+W++ TG ++FEF  AH  S VTC+TFD  GRRL+TGGRDG +R+WNFNNGHCL  L +E+      EI    Y+++ RN F++SVGW R I+VY+D  E   H    P+  W DD+  GH+ED+L +A    +LLAT  Y G II+WNL+SG +  + ++P        D    D S+  L+FL++RA + + +S  +       G VHFWNV+ GG     F       Q     +       DD+LLF GD  G++ V+DI++ A   +  D P  +  WRAH+SSIT L L+   QVL+TSS DCTVR+W+  GE++GTFGQ E W L    +++HP VPY+VL+ P SLP H  L  +  I+   +   +EST           +S++       +    D E+ ++I    Y + +  R R E  K  N   +  GP  Y +L+ +++   P+
Sbjct:   42 RPSSAQGRIQTQ--------NVSSVLTETGPGPGAPGPVLIKQTGSELQE-KRSEKSVNP-DWLERALLKQEYRRHSLPLGDA---TKLITQQRSIRNPASSLSKLKIEQRVSLENLTKLKLAFEDYEKAGTRSLDLPRFRQTIRRCLGLRDITDAQIRELFMKIDYSGQGSVEWDEFCTYMQLEYTEKEELVVRSKQVAFALPATMKPLSHGEPILKIHQISDGMIVTLKEDGAVSYWSSTLQLRKSKSVFH-ERPIGRKAKWATDLVTMPQYNKLIIGTGDREIQLYELSSLEPHCQINSLETVPLKLDYCYT--GPDECAVVYGDAQGCVSIILMTSVGETLRLWKKLPKVENVPSISIDHAVQSPNITYIRWKVHEDWVTKVKYFQSIPAVVSTSNHEASALVIGCILPSTNIEQQMREIKEACREGKGKKAGFG-VSSPQQRVACDQTVFSIYKGVKTFDFCTTRNLLITGGMDRLIRMWNPYVPGSPTGILKGHSAPIFYLHIATEDGRVFSVSTDNSARIWDIQDQSCLFAAHPKASFLRGELTACLYSPAVRGLYISTDSLALLSLKTK---AEPQ------------GSY---------------------TTSHKEAVLCCGYSAGFRQVVSCSEGSVIKVWDVDTGNEMFEFGGAHGLSAVTCMTFDPKGRRLVTGGRDGCLRIWNFNNGHCLKTLSREDG---APEICDCCYLQVHRNTFVMSVGWARRIDVYLDSAEDTRHVQ-RPKPAWEDDLMKGHREDVLCVAQCPPYLLATGSYDGEIIMWNLVSGRIQSRFLTPPP--PNAEDPQTVDRSVLSLVFLRTRAIDAAFSSAASLLSSGAQGQVHFWNVQNGGKFVQSFNASRLQQQIRKLAVTA-----DDRLLFAGDDVGYVCVYDIQHCA-LALRQDPPPTVNFWRAHISSITGLHLIESEQVLLTSSTDCTVRLWSITGEFIGTFGQRERWSLHTASSWKHPAVPYEVLIDPLSLPSHCRLDGK--IQTLSDVLSSESTEDT--------ESDSPNKVRNRLPSSSDREM-EEINSAFYPQHRKWR-RHEIFKHANKSPDHAGPKLYHALKCYDVDDVPA 1073          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Cavefish
Match: si:dkey-202c14.3 (si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-357])

HSP 1 Score: 189.889 bits (481), Expect = 7.722e-49
Identity = 152/542 (28.04%), Postives = 249/542 (45.94%), Query Frame = 2
Query: 1451 VFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQS-RWLDDMSNGHKEDILTLATLKG-HLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKS--SASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYA---NNKVETDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQ 3049
            ++ I KGI  FD   S  +LVT GLD  +R+WN YV S+P  +L GH   +V V I +  ++IFS   D  +K+WD+    C+ T+  +   I+    +C     +  L+++      L I    +++  +L                   QN     +P               +C  Y     QVVT C  S+V +W+++TG K  E N AH    +T +T D + RRL+T   +G +++W+  NG  L +L+     +  AE++ V  +    +  +++VGW R +  Y      G H  Y      W       H EDIL      G  LLAT  Y G IIVW L +     +L  P+               I++LLFLQ R +++   + +L+ S   G + +W++      + +F       + + A+      + D+ LL  GD  G I VW+I  Y     ++V ++ P L+  WRAH  ++ S++++   +   L++ S D    +WT  G  VG+FGQ  +WDL +  T++
Sbjct:  319 IWKIEKGILCFDISWSLGLLVTAGLDPALRIWNRYVTSRPAAVLHGHRTTVVDVVIHQTLDKIFSYSKDAVLKMWDICSQQCVKTLSLRFPNIQ---PACFPEQGSFPLLLSLAAAPALLISCREYLSLLRL-------------------QNPTSNCRPSTF------------SCTLYIPKLKQVVTACAKSSVVVWDVNTGRKCMELNNAHGQEEITAMTADPSQRRLITAASNGTIKVWSLQNGRPLHKLEA----VSDAEVTGVICLH---DDQLLAVGWSRLVARY---SIGGSHDMYVKADVSW--KSGRLHSEDILAADHCAGKRLLATGSYDGEIIVWTLDTQRPVARLQRPLP--------GRVYPPIDRLLFLQKRVEDQQWRNRALLLSSQAGYICWWSICGPTHNHAKFYVPQREDERVNAL----RTNHDNSLLITGDTTGSIQVWNISQYGLYDGDEVVSEQPPLVHTWRAHEEAVVSMEVLEHGKDLFLVSVSVDLNACLWTSCGVCVGSFGQELLWDLNDLHTYR 802          

HSP 2 Score: 51.9878 bits (123), Expect = 4.279e-6
Identity = 45/173 (26.01%), Postives = 77/173 (44.51%), Query Frame = 2
Query:  488 RSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPH--RENVIRITSTSDGS---FIAGSTDGILSFW-SNTLE----LKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSS 976
            ++G  DL + +  L  ++   ++     E L  ++D +  G   W++ CTY+  + A  E+     + +    P  I +  H  RE V RI   S      +I  S  G L+ W S++L+    L+ C        S R    WI D + M   +K+ VA+  R+I   ++SS
Sbjct:   65 KTGSSDLEQLRTALTAEVGEESWNS-SLEELVNELDLSCEGGDGWEKLCTYVLQKSAHNEDLSEPKQSIISSDPL-IRHCRHVKREPVTRIVEVSQPPPLRYITISKGGTLTVWNSSSLQAIRSLELCGGAGETGGSGRQFRGWITDAVYMPNIHKVAVASMSRDIHLIDVSS 235          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Cavefish
Match: si:dkey-202c14.3 (si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-357])

HSP 1 Score: 133.265 bits (334), Expect = 3.017e-32
Identity = 105/360 (29.17%), Postives = 174/360 (48.33%), Query Frame = 2
Query: 1997 AFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMH-KSYYPQSRWLDDMSNGHKEDILTLATLKG-HLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKS--SASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPM 3058
            A   VVT C  S+V +W+++TG K  E N AH    +T +T D + RRL+T   +G +++W+  NG  L +L+     +  AE++ V  +    +  +++VGW R +  Y      G H +  Y ++         H EDIL      G  LLAT  Y G IIVW L +     +L  P+               I++LLFLQ R +++   + +L+ S   G + +W++      + +F       + + A+      + D+ LL  GD  G I VW+I  Y     +   P L+  WRAH  ++ S++++   +   L++ S D    +WT  G  VG+FGQ  +WDL +  T++ P+
Sbjct:  113 AAAPVVTACAKSSVVVWDVNTGRKCMELNNAHGQEEITAMTADPSQRRLITAASNGTIKVWSLQNGRPLHKLEA----VSDAEVTGVICLH---DDQLLAVGWSRLVARY---SIGGSHVRDMYVKADVSWKSGRLHSEDILAADHCAGKRLLATGSYDGEIIVWTLDTQRPVARLQRPLP--------GRVYPPIDRLLFLQKRVEDQQWRNRALLLSSQAGYICWWSICGPTHNHAKFYVPQREDERVNAL----RTNHDNSLLITGDTTGSIQVWNISQYGLYDGDEQ-PPLVHTWRAHEEAVVSMEVLEHGKDLFLVSVSVDLNACLWTSCGVCVGSFGQELLWDLNDLHTYRLPL 449          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Cavefish
Match: ENSAMXT00000043902.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002257.1:21799:28727:-1 gene:ENSAMXG00000036864.1 transcript:ENSAMXT00000043902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 4.055e-16
Identity = 54/190 (28.42%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  578 LFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSD-GSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSS--FEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRT 1138
            LF  +D +  G +NW+   +Y  L  +EK+E ++K   +    PAR    PHR+ +  IT   + G ++  S DG L+ W     L   +S      + R K  W    +++    KI V+   +EI F++L S  F    ++H L   P+ L Y+   D  D  ++ +GD  G V       +G C R+
Sbjct:   61 LFDSVDVSREGWVNWERLTSYFLLGLSEKDE-HIKTTAVLRWRPARTLPVPHRDRLHSITHLPNAGRYLTLSKDGTLTVWEEK-NLTLLRSHRLTNDTVRPKDLWATGLVLLPNVQKIAVSFTSKEICFYDLMSKDFNLQYKLHGLHYTPISLHYWYHPDRPDQAVLSFGDAGGQV-------SGVCFRS 241          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 56.6102 bits (135), Expect = 8.023e-8
Identity = 68/318 (21.38%), Postives = 127/318 (39.94%), Query Frame = 2
Query: 1580 LRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRN-KFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKED----ILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKL 2518
            L GH K +  V  +     + S  ADK +K+W  +D     T+   GH++   +    +S  +  L+ A+D  ++   KI    + K L      ++Y                                 V CC +N   N +V+     +V++W++ TG K  +   AH D  V+ + F+  G  +++   DG+ R+W+  +G CL  L  +++         V +V+ S N K+I++   D  + ++ D  +    K+Y            GHK +        +   G  + +      + +WNL +  +  KL
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTIS--GHKL--GISDVAWSSDSNLLVSASDDKTL---KIWDVSSGKCLKTLKGHSNY---------------------------------VFCCNFNPQSNLIVSGSFDESVRIWDVKTG-KCLKTLPAHSDP-VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDN-------PPVSFVKFSPNGKYILAATLDNTLKLW-DYSKGKCLKTY-----------TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKL 297          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005521.1 (pep scaffold:Pmarinus_7.0:GL477585:56150:70911:-1 gene:ENSPMAG00000005018.1 transcript:ENSPMAT00000005521.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 437.958 bits (1125), Expect = 3.055e-142
Identity = 224/533 (42.03%), Postives = 333/533 (62.48%), Query Frame = 2
Query: 1493 KSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQ-VSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASL-VASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHP 3085
            K ++++VTGG+DR +RLWNPYV  +PTG+LRGH  P+ Y+ I E+ +RIFS+ +D+ VKVWD  +  CL +V PK   +RG++ +CHY   A++L +AT+  V++L+++          D  H  A                            A +H++PV CC+Y+  F QVV+C E S VKLW+L +G   FEF  AH +S +TC+ FDS+GRRL+TGGRDG +++WN+NNG CL  L+K+ +     EI    YV +++NK+I+SVGWD+ IN+++D  E       +PQ  W DD+  GH+ED+L +A     LLAT+ Y G +IVWNL+SGHV  +L  P A    D    D+  S++K++FL+SR  +K  A+L VASGP G +HFWNV  GG L+ RF  G +        + C    + D +L   D+ G +  WD+ +YA    E + P+L+  WRAHVS+ITS+D++ + ++L+T++ DC+VR+W+ +G +VGTFGQ  +WD+ N  T+ HPM P ++LV P
Sbjct:    9 KERSLVVTGGMDRTVRLWNPYVPGRPTGVLRGHTSPICYLSICEETSRIFSVGSDRNVKVWDAQEQTCLCSVSPKMSGLRGEVSACHYLPAARALCVATEGGVALLSVR----------DGLHMDAG--------------------------AATSHREPVRCCRYSAEFRQVVSCSEDSVVKLWDLDSGLPTFEFCGAHGESAITCMAFDSSGRRLITGGRDGCLKVWNYNNGQCLRTLRKQRN---AEEICDCTYVVVNKNKYIISVGWDKRINIFLDSQE-DQQLIQFPQPHWADDLRKGHREDVLCVAQCPPSLLATSSYDGEVIVWNLVSGHVSCRLPPPPAQRSADPAEDDDL-SVSKVIFLKSRVAHKDRAALLVASGPRGFIHFWNVYHGGRLFARFPAGRQGRP-----VCCLASALGDSVLLAADQTGHVYAWDVSSYAMQGPEEEPPQLVSLWRAHVSAITSMDVIEEHKLLLTAALDCSVRLWSVDGAFVGTFGQDTLWDIHNRATWSHPMGPLEILVDP 495          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Sea Lamprey
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 52.7582 bits (125), Expect = 3.965e-7
Identity = 56/256 (21.88%), Postives = 99/256 (38.67%), Query Frame = 2
Query: 1469 GIQTFDFGKSKNVLVTGGLDRIIRLWN-------PYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELK 2215
            G+       S N L T G D I+R+WN       P++ S     +  H   +  V +      + S  +D  VKVW+ H   C+ T+R              + D+ K+L  A D+           VA   LD +          +   ++  T L      + T     +KD +     N+    +V+      +++W+  T  K+ +  + H D+ V  L  +  G + L+G  DG +R+W+     C+   +
Sbjct:   32 GVNALQLDHSLNRLFTAGRDSIVRIWNVSQHKQDPFIAS-----MEHHTDWVNDVVLCCNGRTLISASSDTTVKVWNAHKGFCMSTLRT-------------HKDYVKALAYAKDKEQ---------VASAGLDRQ---------IFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGTIIVSGSTEKVLRVWDPRTCAKLMKL-KGHTDN-VKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYR 249          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Sea Lamprey
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 52.7582 bits (125), Expect = 4.141e-7
Identity = 56/256 (21.88%), Postives = 99/256 (38.67%), Query Frame = 2
Query: 1469 GIQTFDFGKSKNVLVTGGLDRIIRLWN-------PYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELK 2215
            G+       S N L T G D I+R+WN       P++ S     +  H   +  V +      + S  +D  VKVW+ H   C+ T+R              + D+ K+L  A D+           VA   LD +          +   ++  T L      + T     +KD +     N+    +V+      +++W+  T  K+ +  + H D+ V  L  +  G + L+G  DG +R+W+     C+   +
Sbjct:   32 GVNALQLDHSLNRLFTAGRDSIVRIWNVSQHKQDPFIAS-----MEHHTDWVNDVVLCCNGRTLISASSDTTVKVWNAHKGFCMSTLRT-------------HKDYVKALAYAKDKEQ---------VASAGLDRQ---------IFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGTIIVSGSTEKVLRVWDPRTCAKLMKL-KGHTDN-VKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYR 249          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 51.9878 bits (123), Expect = 4.237e-7
Identity = 88/406 (21.67%), Postives = 160/406 (39.41%), Query Frame = 2
Query: 1835 EKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFN-EAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDI-LTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGL-------VHFWNVKEG--------------GILY---GRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVW 2974
            E +L+E  +     GG    Q    +  + +PP  +      H+ PVT   ++  F+ +V+  E +T+K+W+  TG+  FE   + H DS V  ++FD +G+ L +   D  V++W+F +  CL  +   + +     +S+V +  +     +VS   D+ +            K +  Q+ +      GH+E + +      G L+A+     T+ VW   +     +L                  + + ++   + A+ K        GPY L       +  W++  G              G+L+   G+F            +++C     DDK L          VWD   Y N + +       +   AH   +TSLD    +  +IT S D +V+VW
Sbjct:    6 ESKLNEAKEEFVSGGGPLGGQRRDPSEWIPRPPEKY--ALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGD--FERTLKGHTDS-VQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHN-----VSSVAF--MPNGDHLVSASRDKTM------------KMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELRE---HEHVVECVSWAPDAASPVILEATGAEAKKGGK---PGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKF------------ILSCA----DDKTL---------RVWD---YKNKRCQ-------KSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVW 346          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Sea Lamprey
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 51.2174 bits (121), Expect = 9.881e-7
Identity = 27/81 (33.33%), Postives = 41/81 (50.62%), Query Frame = 2
Query: 1961 HKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCL 2203
            H D VT   YN   N  V+C    T+KLW+  +   V  ++ AH  + V  + F    + +L+ G+D MVR+W  + G  L
Sbjct:  265 HTDAVTGVAYNPTANSYVSCSRDGTIKLWDGVSSRCVATYDRAHGGAPVCSVVFSRNAKYVLSSGKDSMVRLWELSAGRAL 345          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 48.9062 bits (115), Expect = 4.684e-6
Identity = 67/255 (26.27%), Postives = 111/255 (43.53%), Query Frame = 2
Query: 1469 GIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPF--VAEKQLDERHQRASYLGGCYFEQISQNTVLVNKP---PVLHTDVAVTHKDPV----TCCKYNEAF-NQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCL 2203
            G++T  F   K  L+TG LD+ IR+WN Y+  +     RGH+  ++ V     +  I S  ADK VKVW +    C  T+R  GH    +    H   F+         + M +I+ N    V    + +  +             + NT   + P   P + TD A     P     T    N  +   +++C   +T+KLW++ TG K       H + GV  +  D+   R+++G  DG +++W+  +G C+
Sbjct:  344 GVKTLYFDDRK--LITGSLDKTIRVWN-YITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWHVESRTC-YTLR--GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTM-TDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTG-KCIRTQFGHVE-GVWDIAADN--FRIISGSHDGSIKVWDLQSGKCM 585          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 48.1358 bits (113), Expect = 7.424e-6
Identity = 26/78 (33.33%), Postives = 39/78 (50.00%), Query Frame = 2
Query: 1490 GKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGH 1723
            G S+ ++VT   D  + LWNP  ++KP   + GH K + +V  +     I S   D  +K+WD  D   + T R  GH
Sbjct:  368 GNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFR--GH 443          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Nematostella
Match: EDO38627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCA8])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 373/792 (47.10%), Postives = 510/792 (64.39%), Query Frame = 2
Query:  467 FENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNML--QPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIAT-DQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENY 2833
             + A+ D SG LDL EFK +++         D Q   LF KID +S G INWDEFCT+MQLEYAEKEE+Y +++E +F LPA  EN+  RE VIR+  TSD +F+  S DG++SFWS  LE K+ K +    +S   K+KWI D+++M  FNK I++TGDREI+FFELS+FEPYC+I  LE  PL +DY     + D+C+I++GD +GCVNI  +H+TGE LR WKK P+ EGIA + +++V+++ + KF RWKVHNDWV +LKYYDSLR +ISCSN + TALVIG   GST ++ Q++  +  Q + K      +   QP+RR+ +DQTVF +YKG++TFDF K KN++VTGG+DR++R+WNPYV SKPTG+LRGH  P+ ++ I  +++RIFSI  DK VKVWDLHD +CLLTVRPK H+IRGD+ + HY+  ++ L +AT DQV++L +K  P                                        D+  THK+ VTC KYN++F  VVT  EGS  ++W++ TG  VFEFN+ H D+ +TC+ FDST RRL++GGRDG +R+WN+NNGHC+  L+KE+      E++ + Y+ + +N++I+SVGWDR INV+ D  +   H    P   W DD+ NGHKEDIL++A    +LLAT+ Y G II+WN +SGH+F  + SP+                           NK SA+LVASGP G VHFWNV  GG LY  F+    S       ++C   D D+K L   D  GF+ VWD+E+Y
Sbjct:    1 MQEADTDGSGTLDLDEFKDVIQALFGFKFKNDDQMTALFMKIDSSSDGEINWDEFCTFMQLEYAEKEESYFRSKETSFQLPALTENSSQREQVIRVCHTSDNNFLVVSQDGLVSFWSQNLEFKRMKHI----ESSSKKTKWITDYVLMPHFNKFIISTGDREIQFFELSTFEPYCQISGLETTPLRVDYC--SPSTDECIIIYGDSQGCVNIFIMHSTGETLRNWKKMPKVEGIASVNIDSVVNSENTKFIRWKVHNDWVAQLKYYDSLRAVISCSNHQETALVIGQTTGSTHIEAQLRENTTSQGERKKNVAAVVRDNQPRRRLDSDQTVFRVYKGVKTFDFCKEKNLIVTGGMDRLVRMWNPYVPSKPTGILRGHTAPIFHLFIVAEDDRIFSISTDKTVKVWDLHDQSCLLTVRPKAHKIRGDVSAIHYNPSSRGLAVATSDQVALLPLKTKPSAR-------------------------------------DMTTTHKEAVTCLKYNKSFKHVVTASEGSVCRVWDVETGHAVFEFNQLHGDTAITCMAFDSTERRLISGGRDGRLRIWNYNNGHCIRTLEKEKD---IDEVTDLTYIVMHKNRYIISVGWDRRINVFSDDTD-DFHHVQRPYIDWSDDLLNGHKEDILSVAVCPPNLLATSSYDGEIIIWNRVSGHIFCHIHSPL-------------------------PSNKESATLVASGPQGYVHFWNVYNGGQLYAAFRASQYS-------VSCMATDSDNKRLVTTDSAGFLYVWDVEDY 713          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Nematostella
Match: EDO44327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW01])

HSP 1 Score: 318.546 bits (815), Expect = 2.905e-92
Identity = 261/893 (29.23%), Postives = 403/893 (45.13%), Query Frame = 2
Query:  416 KIEERIDLTVLEELKAAF--ENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGS-FIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSK--WIIDFLIMNEFNKIIVATGDREIEFFELSS---FEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXX-------XXXXXXXXSINKLLFLQSRAKNKSS--ASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVE---TDCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDL 3028
            K+  R+ +  L+ ++ AF    +   R   LD+ +F  +L   L     E+   E LF KID A  G ++WD+F ++M LEY EK++  +K  ++      R  ++PH+E + RI+   + S +++ S +GIL  WS  L +K+ ++V        VK +  W+ DF+ M    K+ +A   +EI  ++LSS   F    RI +L++ PLCLD Y + D  ++ ++ +GD  G VN L   A    L     QP        G + V+                     Y   L   ISCS     +LV+G +E         K KS  +T                     T F I +G+  FD+ +  N++ T G++  + LWNPYV SKP G+LRGH + +V VH  E   ++ S+  DK +++WD H   CL   R  G   +G  +                      + I  F      DE H   S L   + +Q+   T++V KP V   D  ++H+ PVT   YN  FNQVVT C GS + +W + TG+KV +F  AH ++ +T +T D+T  RL T   DG V++W+F NGHC + L     D   AEI                                                S  H++DIL++A      +A+A Y G I++WN+ S      L++                   D   ++ KL+FL SR    SS  A+LV+    G+V FWN ++   L   F     +G SLT  +     D  +  L  GD  G I VWDI  Y   + +   T  P LL++++ H   I  + L+ +++  +++T+S DC+  +W  EG  +G FGQ E W +
Sbjct:   40 KLVSRLTMHDLKAIQDAFTINQSGQQRELSLDVDQFCEILSIVLNKGVREEY--EELFNKIDVAKEGFVDWDKFSSHMLLEYYEKDDR-MKTTQVPQWRELRNISSPHKEVIRRISPLINPSRYLSVSKEGILCLWS--LGMKQLRTVQVQPDQDEVKQRDLWVTDFIPMQNLYKLAIALTSKEIAIYDLSSKSEFNCQFRIKNLDDTPLCLD-YCNPDKPNEAILAFGDVSGQVNALLFSAVNIALFDRPAQP-------AGSKQVM---------------------YSAHLDCFISCSTSYKGSLVLGWIE---------KTKSNMRT---------------------TAFKIPQGVNAFDYNEKANLVATAGVNHHVCLWNPYVISKPVGVLRGHMQSVVAVHFIESRGQLISLSKDKVLRIWDTHLQVCLQ--RLSGMFPKGPAE----------------------VSITMF-----YDEEH---SKLFTAFNQQL---TLMVMKPEV--KDRVMSHEQPVTAAIYNSKFNQVVTACAGSVITMWMIDTGQKVKQFANAHGNAEITTITQDATETRLFTASADGTVKIWDF-NGHCHSILMAGNGD--PAEI------------------------------------------------SQEHQDDILSVAYSPPTTIASASYDGEIVIWNMNSEQASRHLVAEKRRKPPRSSRRNRLRADSDIGSAVTKLIFLNSRPLPTSSPGANLVSCCGSGIVRFWNSQKHAFL-AEFLAHQHAG-SLTMAV-----DGTNSYLVTGDADGLIKVWDISEYCVEEPDNTITQPPPLLKQFQPHTDIINHIGLLTRNERLLVLTASSDCSAALWDIEGRQIGVFGQEEHWKI 773          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Nematostella
Match: EDO36438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN2])

HSP 1 Score: 143.665 bits (361), Expect = 9.177e-35
Identity = 133/531 (25.05%), Postives = 222/531 (41.81%), Query Frame = 2
Query:  776 FIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHS---LENVPLCLDYYVDKDN-LDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGME-NVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTV-----RPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSG-VTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAE-ISAVEYVEISRNKFIVSVGWDRAINVYID 2332
            +I  S  GI+  WSN                   +S W+     +    +I  AT +R I  ++  +      I+    +EN P C+     K N +++  IL+GD +G VNIL + +    ++    +  S   A + +E N LS+   +  R K  +DWVLK+KY+  L     CS   + + ++G V                     D    N   P R +        + KG+  FD+    NV+VT G D+I+R+W+P + ++PTG L GH   +V + + E++ ++ S+   +  +VWDL    CL        RP   RI              S M+                     D +H R   + GC        T  +         V  TH  P++   YN   NQV++ C    +K+W + TG+ V++  +AH  S  VT +  D+TG RL+TG  DG ++ W+F +G    +   E +  +    I+ + Y  +   + ++   W + I +  D
Sbjct:  150 YITASQKGIICQWSNK------------------ESSWVTGCGFLPSLRRI-AATSERAIALWDYRAKRKQSTIYQIKPMENSPQCMTCIPWKANSMNEDTILFGDDQGYVNILTISSKDLHMKNSSAKGDS---AVVTIEPNKLSS---EIKRRKFFDDWVLKIKYFPQLEMFGCCSPGSSCSFILGGV---------------------DRVLNN--GPVREL-------GVPKGVNCFDYCTRANVIVTAGADKIVRIWHPLIFTRPTGKLLGHLFTIVEIAVNEKDQQLISLSTARVFRVWDLQTLTCLQVFTDNEERPGEKRI--------------SAML--------------------FDAKHDR--LITGCSVIDTWPLTRAIQD----SLQVPHTHDRPISQLLYNPQMNQVISVCTEGVMKVWEMETGQMVYQVTDAHGTSNEVTAMNVDNTGYRLITGAYDGSIKAWDFGSGQLYKKYPDEPAKKRQENTITGLVYHTVDNKRCVLVSSWGQGITLLED 585          

HSP 2 Score: 68.9366 bits (167), Expect = 1.198e-11
Identity = 46/158 (29.11%), Postives = 77/158 (48.73%), Query Frame = 2
Query: 2618 SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFE-GEYVGTFGQTEMWDLTNPKTFQH-PMVPYDVLVHP 3085
            S  +LV++   G + FW +   G L    +  T    S    + C D D   + +  GD  G+++VWD     N   +  C      WRAH++ +  ++ V  +  ++T+S D +VRVW  + G ++G FGQ  +W L + K+    P+ PYD+   P
Sbjct:  783 SDPALVSAHHDGYLRFWTLS--GRLLTEIRAVTRRQASAVTSL-CTDADC--RHVISGDAKGYVTVWD-----NVIKQVVC------WRAHLTRVVGVEHVDSADAVVTASTDLSVRVWYRDTGHFIGFFGQPRLWHLPSAKSVPSTPVRPYDITESP 924          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Nematostella
Match: EDO38984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD4])

HSP 1 Score: 134.035 bits (336), Expect = 2.894e-34
Identity = 84/257 (32.68%), Postives = 133/257 (51.75%), Query Frame = 2
Query:  398 KHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFK-ALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRIT-------------STSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELS--SFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHAT 1120
            KH+ + ++E++++   LE L+  FE A+ D  G LD  EF+ A++K        +D Q    F K+D    G ++W+EFC+YM LE   K+      REM F  PAR   + HR+N+ RIT               + G ++  S +G+L FWS  L   +  +V    + +  KS WI D +++    KI V++ DREI F++ S  S E    +  LEN  LC+DY+ D  + +  ++L+GD  G V+ +   A 
Sbjct:   45 KHHAI-RLEDQMNNEHLEVLQRIFEEADEDGGGGLDYEEFRRAMIKTMSCKEVPDDNQLAITFMKVDANCDGTVDWEEFCSYMLLENQLKDVMTSDEREMEFPHPAREIPSAHRDNIARITYFAKMSHGPDESGDNNVGRYVTVSREGVLHFWSMDLNPIRTITVSNASEGKASKSVWITDCVVLPNAKKIAVSSADREIAFYDCSANSVEKQFVLSGLENCALCMDYWYDPRHPNQSILLFGDSGGKVSCIKFSAV 300          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Nematostella
Match: EDO29890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2C9])

HSP 1 Score: 94.7449 bits (234), Expect = 6.963e-22
Identity = 72/221 (32.58%), Postives = 111/221 (50.23%), Query Frame = 2
Query: 2402 HKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRA--KNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVET----DCPELLRRWRAHVSSITSLDLVLQSQ--VLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPK 3040
            H++DIL  A    +LLAT  + G II+   +   +F +            +     L ++ LLFL SRA  K + SA LV+S   G + FW +       G F   +E   S+ A+      D  + +L  GD  G ISVWDI +Y  ++ E+      P  +  W AH  ++ SL++V + +   L++SS DCT R+WT +G+YVG FGQ    D+ + +
Sbjct:   13 HQDDILASAYCSPNLLATGSFDGDIILILKLIKLLFCR----------RKETKGGCLPVDTLLFLSSRAQWKTQDSAILVSS-ESGSLEFWCLYGAARPMGMFYAASEDSASVLALA----TDPSNDILVSGDSAGRISVWDITSYCISRAESIIAQGSPPCVITWHAHGGAVVSLEVVSRDEKLFLVSSSVDCTARLWTLDGKYVGMFGQVRHVDVISGR 218          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Medaka
Match: ENSORLT00000004931.2 (pep primary_assembly:ASM223467v1:13:8822834:8840121:-1 gene:ENSORLG00000003946.2 transcript:ENSORLT00000004931.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 1.017e-51
Identity = 118/357 (33.05%), Postives = 180/357 (50.42%), Query Frame = 2
Query: 1460 IYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPV 2530
            ++  + T     +  +LVTGG+DR+IRLW+P+   KPTG+L+GH+ P+ ++ I+ ++++I S+  D  VK     D  CL T   K   I G++ +CHYS   KSL IA D +++L +K   F   ++L E                                   +H +PV CC Y+E F QVV+C EGS +K+W+L TG +      +   + +TC+T D  GRRL+TG RDG +++WNFN+G CL  LKK  ++             ++ N            N+Y            Y  + ++    NGHK+DIL +A     LLAT+   G IIVWN +SG +  + + PV
Sbjct:    8 LWSPVGTVSRVMNPKMLVTGGMDRLIRLWHPHFPGKPTGILKGHSAPIFFLWISSEDSQIVSVSVDCTVK-----DECCLFTGESKASSIYGEISACHYSPAMKSLYIAADSIAVLKLKPRSFFPRRRLTE-----------------------------------SHNEPVLCCCYSEEFRQVVSCGEGSVLKVWDLDTGRQGPVSERSSHGATITCMTMDDKGRRLITGRRDGSLKIWNFNSGQCLKTLKKGHAN------HCTTMQTMNSN------------NLY----------KRYKATTFVSFQINGHKDDILCVAHCPPSLLATSSCDGEIIVWNAVSGCILCRFVGPV 296          

HSP 2 Score: 74.3294 bits (181), Expect = 2.177e-13
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 2903 TSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLG-----PRMTIEQRKEQSKAE 3160
            +SL +V   QV++TSS D TVR+W+  GE +GTFGQ E+W++    ++ HP  PY+VL+ P S+P+H  L      P+     + E  + E
Sbjct:  323 SSLQIVDSDQVVLTSSTDHTVRLWSAYGECIGTFGQPEIWNIHVSSSWMHPTDPYEVLIDPLSMPNHGTLNGKPRQPKPITRDKTEPDRGE 413          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Medaka
Match: ENSORLT00000015414.2 (WD repeat-containing protein 64 [Source:NCBI gene;Acc:101165086])

HSP 1 Score: 116.316 bits (290), Expect = 1.257e-26
Identity = 97/384 (25.26%), Postives = 163/384 (42.45%), Query Frame = 2
Query:  608 GAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITS-TSDGSFIAGSTDGILSFWS--NTLELKKCKSVVTIEQSQRVKSK--WIIDFLIMNEFNKIIVATGDREIEFFELSS---FEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHAT------GECLRTWKKQPRSEGIAGIGMENVLS--NPSIKFYRWKVHND-WVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTV 1708
            G ++W   C+++ LE   ++    K   +    P R    PHR++V ++    S   ++  S  G +  W   +   L  C+      Q+  V S+  W+ D +++    KI V+    E+ F++L S   F    ++  L   P CLDY++D  + D  ++  GD  G V+ LH  +         CL     Q  S+    +  + ++   +   +    K H   WV K+ Y  SLR   SCS    +++VIG                      +D   G M     RI    T +   KG+   D+ +  N++ T GLD  + LWNPYV S+P   L GH   +  V   + ++++ S   DK + +WD+    C+  V
Sbjct:   84 GHVDWGALCSFL-LEETWRKLNQTKDFNVPLWKPRRTLTCPHRDSVQKVLYLQSSDQYLTVSKGGKVVLWQEVDLSVLSTCRL-----QNSTVASRDLWVTDVVLLQNVQKIAVSFTCEEVCFYDLRSKQDFPCKYKLQGLRFAPWCLDYWMDPCDADQAVLTIGDTGGQVSALHFTSAQTSLFESRCL-----QLDSDSAKVVSWDQLVKGRHSCCRMETHKAHAPAWVRKVLYLSSLRAFASCSTRPQSSMVIGW---------------------RDEGAGKM-----RI----TSYVTRKGVWDIDYHRQWNLIATAGLDDQVLLWNPYVTSEPVCALAGHLNEVTAVRFMQTKDQLLSFSKDKVLCLWDVSSQLCVQRV 426          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Medaka
Match: ENSORLT00000043076.1 (WD repeat-containing protein 64 [Source:NCBI gene;Acc:101165086])

HSP 1 Score: 116.316 bits (290), Expect = 1.257e-26
Identity = 97/384 (25.26%), Postives = 163/384 (42.45%), Query Frame = 2
Query:  608 GAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITS-TSDGSFIAGSTDGILSFWS--NTLELKKCKSVVTIEQSQRVKSK--WIIDFLIMNEFNKIIVATGDREIEFFELSS---FEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHAT------GECLRTWKKQPRSEGIAGIGMENVLS--NPSIKFYRWKVHND-WVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTV 1708
            G ++W   C+++ LE   ++    K   +    P R    PHR++V ++    S   ++  S  G +  W   +   L  C+      Q+  V S+  W+ D +++    KI V+    E+ F++L S   F    ++  L   P CLDY++D  + D  ++  GD  G V+ LH  +         CL     Q  S+    +  + ++   +   +    K H   WV K+ Y  SLR   SCS    +++VIG                      +D   G M     RI    T +   KG+   D+ +  N++ T GLD  + LWNPYV S+P   L GH   +  V   + ++++ S   DK + +WD+    C+  V
Sbjct:   84 GHVDWGALCSFL-LEETWRKLNQTKDFNVPLWKPRRTLTCPHRDSVQKVLYLQSSDQYLTVSKGGKVVLWQEVDLSVLSTCRL-----QNSTVASRDLWVTDVVLLQNVQKIAVSFTCEEVCFYDLRSKQDFPCKYKLQGLRFAPWCLDYWMDPCDADQAVLTIGDTGGQVSALHFTSAQTSLFESRCL-----QLDSDSAKVVSWDQLVKGRHSCCRMETHKAHAPAWVRKVLYLSSLRAFASCSTRPQSSMVIGW---------------------RDEGAGKM-----RI----TSYVTRKGVWDIDYHRQWNLIATAGLDDQVLLWNPYVTSEPVCALAGHLNEVTAVRFMQTKDQLLSFSKDKVLCLWDVSSQLCVQRV 426          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Medaka
Match: ENSORLT00000037247.1 (WD repeat-containing protein 64 [Source:NCBI gene;Acc:101165086])

HSP 1 Score: 116.316 bits (290), Expect = 1.257e-26
Identity = 97/384 (25.26%), Postives = 163/384 (42.45%), Query Frame = 2
Query:  608 GAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITS-TSDGSFIAGSTDGILSFWS--NTLELKKCKSVVTIEQSQRVKSK--WIIDFLIMNEFNKIIVATGDREIEFFELSS---FEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHAT------GECLRTWKKQPRSEGIAGIGMENVLS--NPSIKFYRWKVHND-WVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTV 1708
            G ++W   C+++ LE   ++    K   +    P R    PHR++V ++    S   ++  S  G +  W   +   L  C+      Q+  V S+  W+ D +++    KI V+    E+ F++L S   F    ++  L   P CLDY++D  + D  ++  GD  G V+ LH  +         CL     Q  S+    +  + ++   +   +    K H   WV K+ Y  SLR   SCS    +++VIG                      +D   G M     RI    T +   KG+   D+ +  N++ T GLD  + LWNPYV S+P   L GH   +  V   + ++++ S   DK + +WD+    C+  V
Sbjct:   84 GHVDWGALCSFL-LEETWRKLNQTKDFNVPLWKPRRTLTCPHRDSVQKVLYLQSSDQYLTVSKGGKVVLWQEVDLSVLSTCRL-----QNSTVASRDLWVTDVVLLQNVQKIAVSFTCEEVCFYDLRSKQDFPCKYKLQGLRFAPWCLDYWMDPCDADQAVLTIGDTGGQVSALHFTSAQTSLFESRCL-----QLDSDSAKVVSWDQLVKGRHSCCRMETHKAHAPAWVRKVLYLSSLRAFASCSTRPQSSMVIGW---------------------RDEGAGKM-----RI----TSYVTRKGVWDIDYHRQWNLIATAGLDDQVLLWNPYVTSEPVCALAGHLNEVTAVRFMQTKDQLLSFSKDKVLCLWDVSSQLCVQRV 426          
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Medaka
Match: ENSORLT00000040952.1 (pep primary_assembly:ASM223467v1:19:4064837:4070371:-1 gene:ENSORLG00000022716.1 transcript:ENSORLT00000040952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.265e-20
Identity = 97/403 (24.07%), Postives = 174/403 (43.18%), Query Frame = 2
Query:  485 DRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPA-RIENTPHRENVIRITSTSDGS---FIAGSTDGILSFWSNTLELKKCKSVVT-IEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLEN----VPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSE-GIAGIGMENVLSNPSIKFYR--WKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICAD 1657
            D+   + L EFK  L     +   E+   E LF +ID + +G + W + C+Y+  EY E++        +    P   + +   RE  +RI S S      +I  S  G ++ WS++L + +   V    E S R++  W+ D   M   +++ + T  R+  F ++S  + +  +H          +C  +   +      L+L GD KG V+++    T + L  +K+  ++E G   I   ++  + ++   R    +H   + ++ +      I++ S  E T++V             MK+ SM Q                    +  ++   +G   FD+  S  +LVTGG DR IRLW+ YV   P  +L+GH   ++ V I +   +IFS   D
Sbjct:   68 DKQPGIKLEEFKKSLSS---VTCSEESWIEELFCEIDISHAGEVTWQQLCSYLLQEYKERQRASTPPAALLDAQPQFTLCSQNKREPTVRILSISQQPPLRYITVSKGGHITVWSSSLRILQTFMVSGDPEHSSRLRG-WVTDAAYMRGLHRVAIVTDHRDAHFVKVSPTDIFEDVHLFGFRCVLTAVCFGFDSQRPEQPPLLLL-GDEKGGVHLMWFLNTSKGL--FKRASKTERGPQRILFSDLDDHDNMVSCRHIANIHRAAINRVMFDPGANVIMTSSESETTSVVF------------MKV-SMKQ--------------------EPYIWKFSQGALCFDYSSSLQLLVTGGKDRKIRLWSRYVTFSPLAVLQGHQASVMDVAIYQPVEQIFSYSRD 430          
BLAST of WD repeat-containing protein on Y chromosome vs. Planmine SMEST
Match: SMESG000033045.1 (SMESG000033045.1)

HSP 1 Score: 2300.4 bits (5960), Expect = 0.000e+0
Identity = 1128/1128 (100.00%), Postives = 1128/1128 (100.00%), Query Frame = 2
Query:   59 MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEILNQKK 3442
            MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSTGRRLLTGGRDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVADLDEDTDYIDEDLSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEILNQKK
Sbjct:    1 MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSTGRRLLTGGRDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVADLDEDTDYIDEDLSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEILNQKK 1128          
BLAST of WD repeat-containing protein on Y chromosome vs. Planmine SMEST
Match: SMESG000033045.1 (SMESG000033045.1)

HSP 1 Score: 2203.71 bits (5709), Expect = 0.000e+0
Identity = 1091/1128 (96.72%), Postives = 1091/1128 (96.72%), Query Frame = 2
Query:   59 MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVAXXXXXXXXXXXXXSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEILNQKK 3442
            MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKI                                     PVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSTGRRLLTGGRDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVADLDEDTDYIDEDLSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEILNQKK
Sbjct:    1 MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDKIKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDITKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKIK------------------------------------PVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSTGRRLLTGGRDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMSGHVFFKLISPVADLDEDTDYIDEDLSINKLLFLQSRAKNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITSLDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPMVPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSENSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGGPNEYRSLQVFELAKTPSPRQPEILNQKK 1092          
BLAST of WD repeat-containing protein on Y chromosome vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 241.891 bits (616), Expect = 8.697e-67
Identity = 197/713 (27.63%), Postives = 338/713 (47.41%), Query Frame = 2
Query:  413 DKIEERIDLTVLEELKAAF-ENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIE----NTPHRENVIRITSTSD-GSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELS---SFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECL--RTWKKQPRSEGIAGIGMENVLSNPSIK---FYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCL---LTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNE-AHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMS 2497
            +K+E ++++  LE L+ AF  +  ++RS   +  EF   L   L   T E+     LF KID    G ++W++F ++M LE+ EK++     R  +  LP   E    + PH++ + RI    +   ++  S +G +  W +  +L+K     T  +S R +  W+ DF  +   NK+ V+   +EI F++++    F    ++ +L  +P+C+DY+   DN  + ++ WGD  G +N++        L  R   K    +    I   N + + SIK   ++  K H DWV K+ Y  +L   +SC+ +  T++VI  +E     +      S     SKD    ++  P+ R  +  + F +++GI +F + ++ N++ T G++  + LWNPYV SKP G+LRGH   +  V   +    + S   DK +++WD+    C+     V PKG            S      +I   ++     K+  F+            ++  G         T+L  KP V   D   +H+ P+  C YN  +NQVVT C+G  +  W + TG++V    E     + +TC+T DST  RL TG  DG V++W+F NGHC   L     +    +IS +  ++    + ++  G+ ++I  +          S  P   W    +  HK+DIL+ A++  H +AT  Y G II+WN+ S
Sbjct:   16 NKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSD--LFDKIDITREGYVDWEKFASHMLLEFYEKDD-----RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHT--ESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNS----TSSEMAGSKDEFISDI--PESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQE----------SALMNPRIILYSKMFYHEEKLRLFI------------TFNFGL--------TMLEMKPDV--KDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQIVILK----RCVLVFGFSKSITAFWTSSFKDHKVSPSP---WKGVQT--HKDDILSGASIPPHAVATGSYDGEIIIWNINS 669          
BLAST of WD repeat-containing protein on Y chromosome vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 244.973 bits (624), Expect = 3.804e-66
Identity = 197/713 (27.63%), Postives = 333/713 (46.70%), Query Frame = 2
Query:  413 DKIEERIDLTVLEELKAAF-ENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIE----NTPHRENVIRITSTSD-GSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELS---SFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECL--RTWKKQPRSEGIAGIGMENVLSNPSIK---FYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCL---LTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNE-AHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMS 2497
            +K+E ++++  LE L+ AF  +  ++RS   +  EF   L   L   T E+     LF KID    G ++W++F ++M LE+ EK++     R  +  LP   E    + PH++ + RI    +   ++  S +G +  W +  +L+K     T  +S R +  W+ DF  +   NK+ V+   +EI F++++    F    ++ +L  +P+C+DY+   DN  + ++ WGD  G +N++        L  R   K    +    I   N + + SIK   ++  K H DWV K+ Y  +L   +SC+ +  T++VI  +E     +      S     SKD    ++  P+ R  +  + F +++GI +F + ++ N++ T G++  + LWNPYV SKP G+LRGH   +  V   +    + S   DK +++WD+    C+     V PKG  +   M    Y +    L I        N  +                              T+L  KP V   D   +H+ P+  C YN  +NQVVT C+G  +  W + TG++V    E     + +TC+T DST  RL TG  DG V++W+F NGHC   L     +    +IS +    +   + ++  G+ ++I  +          S  P   W    +  HK+DIL+ A++  H +AT  Y G II+WN+ S
Sbjct:   16 NKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSD--LFDKIDITREGYVDWEKFASHMLLEFYEKDD-----RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHT--ESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNS----TSSEMAGSKDEFISDI--PESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQEMYSKM---FYHEEKLRLFIT------FNFGL------------------------------TMLEMKPDV--KDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQI----VILKRCVLVFGFSKSITAFWTSSFKDHKVSPSP---WKGVQT--HKDDILSGASIPPHAVATGSYDGEIIIWNINS 660          

HSP 2 Score: 83.9593 bits (206), Expect = 4.955e-16
Identity = 49/160 (30.63%), Postives = 82/160 (51.25%), Query Frame = 2
Query: 2573 SINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVET----DCPELLRRWRAHVSSITSLDLVLQ--SQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDL 3028
            +I++L++L+SR K K    A+L++ G  G+V FWN  EG ++ G F     +   +       + D+ ++ L  GD  G+I VWDI +Y   + E       P L+ +W++H   I+ +    +    ++ITSS D +  +W   G  +G FGQ   W L
Sbjct:  761 NISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLI-GEFVAHENASNIIM------NTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 913          
BLAST of WD repeat-containing protein on Y chromosome vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 244.202 bits (622), Expect = 5.588e-66
Identity = 195/710 (27.46%), Postives = 335/710 (47.18%), Query Frame = 2
Query:  413 DKIEERIDLTVLEELKAAF-ENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIE----NTPHRENVIRITSTSD-GSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELS---SFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECL--RTWKKQPRSEGIAGIGMENVLSNPSIK---FYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTVRPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERHQRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNE-AHEDSGVTCLTFDSXXXXXXXXXXDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMS 2497
            +K+E ++++  LE L+ AF  +  ++RS   +  EF   L   L   T E+     LF KID    G ++W++F ++M LE+ EK++     R  +  LP   E    + PH++ + RI    +   ++  S +G +  W +  +L+K     T  +S R +  W+ DF  +   NK+ V+   +EI F++++    F    ++ +L  +P+C+DY+   DN  + ++ WGD  G +N++        L  R   K    +    I   N + + SIK   ++  K H DWV K+ Y  +L   +SC+ +  T++VI  +E     +      S     SKD    ++  P+ R  +  + F +++GI +F + ++ N++ T G++  + LWNPYV SKP G+LRGH   +  V   +    + S   DK +++WD+    C+        R  G       S      +I   ++     K+  F+            ++  G         T+L  KP V   D   +H+ P+  C YN  +NQVVT C+G  +  W + TG++V    E     + +TC+T DST  RL TG  DG V++W+F NGHC   L     +    +IS +    +   + ++  G+ ++I  +          S  P   W    +  HK+DIL+ A++  H +AT  Y G II+WN+ S
Sbjct:   16 NKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSD--LFDKIDITREGYVDWEKFASHMLLEFYEKDD-----RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHT--ESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNS----TSSEMAGSKDEFISDI--PESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCI-------QRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFI------------TFNFGL--------TMLEMKPDV--KDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQI----VILKRCVLVFGFSKSITAFWTSSFKDHKVSPSP---WKGVQT--HKDDILSGASIPPHAVATGSYDGEIIIWNINS 669          

HSP 2 Score: 84.3445 bits (207), Expect = 4.715e-16
Identity = 49/160 (30.63%), Postives = 82/160 (51.25%), Query Frame = 2
Query: 2573 SINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVET----DCPELLRRWRAHVSSITSLDLVLQ--SQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDL 3028
            +I++L++L+SR K K    A+L++ G  G+V FWN  EG ++ G F     +   +       + D+ ++ L  GD  G+I VWDI +Y   + E       P L+ +W++H   I+ +    +    ++ITSS D +  +W   G  +G FGQ   W L
Sbjct:  764 NISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLI-GEFVAHENASNIIM------NTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 916          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR496.568e-6925.40WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
EFCAB83.996e-5625.96EF-hand calcium binding domain 8 [Source:HGNC Symb... [more]
WDR492.616e-4627.07WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR499.914e-4325.18WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR493.729e-3724.90WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wdr-5.14.806e-722.40WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.14.806e-722.40WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
Y53C12B.17.330e-626.97pep chromosome:WBcel235:II:9742982:9746074:-1 gene... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WDY2.381e-3027.99gene:FBgn0267449 transcript:FBtr0347028[more]
wds5.307e-921.38gene:FBgn0040066 transcript:FBtr0308566[more]
wds5.307e-921.38gene:FBgn0040066 transcript:FBtr0070438[more]
CG39096.467e-623.45gene:FBgn0027524 transcript:FBtr0082172[more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr950.000e+037.98WD40 repeat domain 95 [Source:ZFIN;Acc:ZDB-GENE-13... [more]
si:dkey-202c14.32.649e-6225.90si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
wdr57.252e-821.38WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr48a1.140e-621.57WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
wdr48a1.506e-621.57WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000025824.10.000e+033.95WD repeat-containing protein 64-like [Source:NCBI ... [more]
ENSXETT00000044342.12.731e-12635.79WD repeat-containing protein 64-like [Source:NCBI ... [more]
ENSXETT00000029824.11.677e-9128.28EF-hand calcium binding domain 8 [Source:NCBI gene... [more]
ENSXETT00000013976.16.473e-9129.45EF-hand calcium binding domain 8 [Source:NCBI gene... [more]
ENSXETT00000013991.17.400e-7929.90EF-hand calcium binding domain 8 [Source:NCBI gene... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr950.000e+038.69WD40 repeat domain 95 [Source:MGI Symbol;Acc:MGI:1... [more]
Wdr955.622e-14339.13WD40 repeat domain 95 [Source:MGI Symbol;Acc:MGI:1... [more]
Efcab81.543e-5725.60EF-hand calcium binding domain 8 [Source:MGI Symbo... [more]
Wdr492.453e-4525.53WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:364... [more]
Wdr491.242e-3425.15WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:364... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IV35|WDR49_HUMAN1.256e-4527.07WD repeat-containing protein 49 OS=Homo sapiens OX... [more]
sp|B0WYR6|WDY_CULQU2.579e-4521.20WD repeat-containing protein on Y chromosome OS=Cu... [more]
sp|B7FF06|WDY_DROGR3.708e-4224.55WD repeat-containing protein on Y chromosome OS=Dr... [more]
sp|B7FF08|WDY_DROVI1.185e-4124.59WD repeat-containing protein on Y chromosome OS=Dr... [more]
sp|B7FF07|WDY_DROMO2.017e-4024.07WD repeat-containing protein on Y chromosome OS=Dr... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JDI50.000e+046.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210QEC00.000e+047.03WD repeat-containing protein 49 OS=Mizuhopecten ye... [more]
A0A2C9JDI70.000e+046.39Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3JIB50.000e+048.99WD repeat-containing protein on Y chromosome OS=Li... [more]
A0A2T7PLK90.000e+049.09Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr950.000e+038.86WD repeat-containing protein on Y chromosome-like ... [more]
si:dkey-202c14.37.722e-4928.04si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
si:dkey-202c14.33.017e-3229.17si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
ENSAMXT00000043902.14.055e-1628.42pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
wdr58.023e-821.38WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005521.13.055e-14242.03pep scaffold:Pmarinus_7.0:GL477585:56150:70911:-1 ... [more]
wdr48a3.965e-721.88WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
wdr48a4.141e-721.88WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
pafah1b1b4.237e-721.67platelet-activating factor acetylhydrolase 1b, reg... [more]
cstf19.881e-733.33cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MET304.684e-626.27F-box protein containing five copies of the WD40 m... [more]
RSA47.424e-633.33WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386270.000e+047.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443272.905e-9229.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364389.177e-3525.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389842.894e-3432.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298906.963e-2232.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000004931.21.017e-5133.05pep primary_assembly:ASM223467v1:13:8822834:884012... [more]
ENSORLT00000015414.21.257e-2625.26WD repeat-containing protein 64 [Source:NCBI gene;... [more]
ENSORLT00000043076.11.257e-2625.26WD repeat-containing protein 64 [Source:NCBI gene;... [more]
ENSORLT00000037247.11.257e-2625.26WD repeat-containing protein 64 [Source:NCBI gene;... [more]
ENSORLT00000040952.11.265e-2024.07pep primary_assembly:ASM223467v1:19:4064837:407037... [more]
back to top
BLAST of WD repeat-containing protein on Y chromosome vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033045.10.000e+0100.00SMESG000033045.1[more]
SMESG000033045.10.000e+096.72SMESG000033045.1[more]
SMESG000041940.18.697e-6727.63SMESG000041940.1[more]
SMESG000041940.13.804e-6627.63SMESG000041940.1[more]
SMESG000041940.15.588e-6627.46SMESG000041940.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017474 ID=SMED30017474|Name=WD repeat-containing protein on Y chromosome|organism=Schmidtea mediterranea sexual|type=transcript|length=3527bp
TGTTTGAATTAGTTATATTTAAGTAGTTATTGGTGAATTAATTATTTTCA
CATTTAAAATGTCATCTGTTAGAGTGCCCATTGGTGGGCCAGTAATTAAA
CCATCAAAAATTAAAATCCGACCAAGTTCTGCCTCAGGAAATATACAAAC
TCACCAATCTTATACAACTGGACTTTATGATAAGAAATGTCTCTTTCTAA
AAGACAAGATAAAAGAAAGTTTACCAGATTCTAATAAATTGAAAAAAGCT
GGAACTCATATTGGATTTTTAAAGGAATCCCAAAGAATAATTGAGCCAAA
AGATGAGATCAGAAAACCAAGAAGACGAACAATTGAAATCGTCGATGGAA
TGGATATTACCAAATTTATAGGAAGAGAAATGTCTTTGTCGTTACGAAAA
CATAATTTACTCGACAAAATCGAAGAAAGAATCGACCTAACAGTTTTGGA
AGAACTCAAGGCAGCATTCGAAAACGCAGAATATGATCGATCTGGAAAAT
TAGATTTATCAGAATTTAAAGCTTTACTAAAAGAAAAATTACAACTTCCA
ACATTTGAGGATATCCAAACCGAAACGCTATTCAAAAAAATCGACTGGGC
AAGTTCTGGCGCCATCAACTGGGACGAATTTTGTACCTACATGCAACTTG
AATATGCAGAAAAGGAAGAAACGTATTTAAAAGCTAGAGAAATGGCCTTT
TGTCTACCTGCCCGCATTGAAAATACTCCGCACAGAGAGAATGTTATCAG
GATAACTTCCACCTCCGATGGAAGTTTTATCGCTGGATCTACAGATGGAA
TTTTGTCATTCTGGAGCAATACTTTAGAATTGAAAAAGTGTAAATCAGTA
GTTACCATCGAACAAAGCCAGAGAGTAAAATCAAAATGGATAATAGATTT
TCTCATTATGAATGAATTCAACAAAATTATTGTAGCTACCGGTGATCGGG
AAATTGAATTTTTCGAGCTTTCCTCATTTGAACCGTACTGTAGGATTCAC
AGTCTGGAAAACGTACCCCTATGTCTTGATTACTATGTTGATAAAGATAA
TCTTGATGATTGCCTTATTTTGTGGGGAGATCGGAAAGGCTGTGTTAACA
TTCTTCATTTGCATGCCACTGGAGAATGCTTACGAACTTGGAAAAAACAG
CCACGAAGTGAAGGGATCGCAGGAATTGGAATGGAGAACGTTTTATCAAA
TCCTTCAATCAAATTCTACCGATGGAAGGTTCACAATGACTGGGTGCTAA
AATTGAAATATTATGACTCCTTGCGACAGATTATCAGCTGTTCAAATGAT
GAAGCAACAGCTCTTGTTATAGGCTGCGTCGAAGGGTCTACTCAGCTTGA
TCAACAAATGAAACTGAAATCCATGCATCAAACTAAATCCAAAGATATGA
CTTTTGGTAATATGCTTCAACCAAAAAGAAGAATTTCAACGGATCAAACC
GTCTTTAACATTTATAAAGGAATTCAGACCTTCGATTTCGGTAAAAGCAA
AAACGTTCTCGTAACAGGAGGTCTCGACAGAATTATTCGTCTTTGGAATC
CTTATGTAAATTCTAAACCTACCGGAATGCTTAGAGGACACAACAAACCT
TTGGTCTATGTTCACATTGCAGAACAGGAAAACAGAATATTTTCTATTTG
TGCTGATAAATGTGTAAAGGTATGGGATCTCCATGATCACAATTGCCTAC
TAACTGTCCGTCCTAAGGGACATAGGATTCGAGGTGATATGCAATCTTGT
CACTATTCTGACTTTGCAAAGTCTTTGATGATAGCAACCGACCAAGTGTC
GATGCTTAATATCAAAATTAATCCGTTTGTTGCTGAAAAACAACTTGACG
AAAGGCATCAAAGAGCCTCATATTTAGGTGGATGCTATTTTGAGCAAATT
TCACAGAACACGGTTCTGGTAAATAAACCACCGGTTCTCCATACTGACGT
CGCTGTTACTCATAAAGATCCAGTGACATGTTGTAAATACAACGAAGCTT
TTAATCAAGTCGTCACTTGTTGTGAAGGATCCACTGTGAAATTATGGAAC
TTAAGCACGGGTGAAAAGGTTTTCGAGTTTAATGAGGCTCATGAAGACAG
CGGTGTAACGTGTTTGACTTTTGATTCAACAGGTCGCCGACTCCTCACTG
GTGGTCGAGATGGAATGGTCAGAATGTGGAATTTCAATAATGGGCATTGT
TTAACTGAATTGAAAAAAGAAGAAAGTGATTTAAAATATGCTGAAATTAG
CGCCGTAGAATACGTTGAAATTAGTCGCAACAAATTTATTGTCTCAGTCG
GTTGGGATCGGGCGATAAATGTTTATATTGACCAGTGTGAACCTGGGATG
CATAAATCCTATTACCCCCAGTCTCGGTGGTTAGACGACATGAGTAATGG
CCACAAAGAAGATATACTTACCTTAGCAACCTTGAAAGGCCATTTATTAG
CTACAGCGGATTACCATGGAACAATTATCGTTTGGAATTTGATGAGTGGG
CATGTTTTTTTCAAATTAATTTCTCCAGTTGCCGACCTGGATGAAGATAC
TGATTACATCGACGAAGATTTAAGCATCAACAAACTTTTGTTCTTACAAA
GCAGGGCTAAGAATAAGTCAAGTGCTTCTCTTGTTGCCAGTGGACCGTAC
GGGCTTGTGCATTTTTGGAACGTTAAAGAAGGCGGAATATTATATGGAAG
ATTCAAAGGGGGAACAGAAAGTGGGCAAAGTTTAACAGCTATGATAGCGT
GTAAAGATCAAGATATTGACGATAAGCTGTTATTCATTGGCGACAGATTC
GGATTTATATCGGTGTGGGATATCGAAAATTACGCAAATAACAAAGTAGA
AACTGATTGCCCAGAATTGCTACGAAGATGGCGTGCTCATGTGAGTTCTA
TAACAAGTTTGGACTTAGTTTTACAATCACAAGTATTGATAACATCTTCC
GATGATTGTACTGTTCGTGTATGGACATTTGAAGGAGAATATGTTGGAAC
TTTTGGTCAAACAGAAATGTGGGACTTAACTAATCCTAAAACGTTTCAAC
ATCCCATGGTTCCTTATGATGTCCTCGTCCATCCACAGAGTTTACCTGAT
CATCCTGTTTTGGGTCCTAGAATGACGATTGAGCAGAGGAAAGAACAGAG
TAAAGCTGAATCTACTCACAAAGCCAAAATGACTAAACAGCATGCTTTAC
AATCCGAGAATTCTACATTTACTCATAAAAACGTAATATATATTGATGAT
GAAGAAATCAATCAACAAATAGAACAAAAGATCTACAAAGAAGGCAAAGG
GAAGAGATTAAGGTTTGAAAGGATGAAACCTCGAAATGCATTGTCAGAAG
ATGGGGGACCTAACGAATATCGGTCATTACAGGTGTTCGAGCTAGCTAAA
ACTCCATCTCCCAGGCAACCGGAAATTCTCAATCAAAAAAAGGATATATT
CCAATTTTTCGATTAATATTTTTCTAGTATTTGAAGTGATTATTTTTAAG
ATAAAAATAAAAAAGCGTTCCTTAATT
back to top

protein sequence of SMED30017474-orf-1

>SMED30017474-orf-1 ID=SMED30017474-orf-1|Name=SMED30017474-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1136bp
MSSVRVPIGGPVIKPSKIKIRPSSASGNIQTHQSYTTGLYDKKCLFLKDK
IKESLPDSNKLKKAGTHIGFLKESQRIIEPKDEIRKPRRRTIEIVDGMDI
TKFIGREMSLSLRKHNLLDKIEERIDLTVLEELKAAFENAEYDRSGKLDL
SEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYA
EKEETYLKAREMAFCLPARIENTPHRENVIRITSTSDGSFIAGSTDGILS
FWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIE
FFELSSFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILH
LHATGECLRTWKKQPRSEGIAGIGMENVLSNPSIKFYRWKVHNDWVLKLK
YYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFG
NMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYV
NSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCLLTV
RPKGHRIRGDMQSCHYSDFAKSLMIATDQVSMLNIKINPFVAEKQLDERH
QRASYLGGCYFEQISQNTVLVNKPPVLHTDVAVTHKDPVTCCKYNEAFNQ
VVTCCEGSTVKLWNLSTGEKVFEFNEAHEDSGVTCLTFDSTGRRLLTGGR
DGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWD
RAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATA
DYHGTIIVWNLMSGHVFFKLISPVADLDEDTDYIDEDLSINKLLFLQSRA
KNKSSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKD
QDIDDKLLFIGDRFGFISVWDIENYANNKVETDCPELLRRWRAHVSSITS
LDLVLQSQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDLTNPKTFQHPM
VPYDVLVHPQSLPDHPVLGPRMTIEQRKEQSKAESTHKAKMTKQHALQSE
NSTFTHKNVIYIDDEEINQQIEQKIYKEGKGKRLRFERMKPRNALSEDGG
PNEYRSLQVFELAKTPSPRQPEILNQKKDIFQFFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 170..198
e-value: 79.0
score: 2.4
coord: 132..160
e-value: 0.0014
score: 27.9
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 128..163
score: 10.162
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 166..201
score: 9.409
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1122..1135
score: 5.643
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 213..253
e-value: 18.0
score: 9.0
coord: 772..810
e-value: 1.6
score: 15.7
coord: 934..973
e-value: 1.3E-4
score: 31.3
coord: 711..757
e-value: 260.0
score: 1.8
coord: 501..540
e-value: 0.0019
score: 27.5
coord: 382..421
e-value: 270.0
score: 1.6
coord: 623..664
e-value: 0.0059
score: 25.8
coord: 462..497
e-value: 0.44
score: 19.3
coord: 667..708
e-value: 3.4E-8
score: 43.2
IPR001680WD40 repeatPFAMPF00400WD40coord: 937..972
e-value: 4.7E-4
score: 20.9
coord: 471..497
e-value: 0.17
score: 12.8
coord: 676..708
e-value: 6.5E-6
score: 26.8
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 632..673
score: 9.874
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 472..497
score: 9.005
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 941..972
score: 10.609
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 676..717
score: 12.747
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 508..549
score: 10.508
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 614..766
e-value: 1.3E-26
score: 95.5
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 215..420
e-value: 2.0E-10
score: 42.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 767..1053
e-value: 8.5E-21
score: 75.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 421..589
e-value: 3.3E-13
score: 51.7
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 63..209
e-value: 2.2E-12
score: 48.9
NoneNo IPR availablePFAMPF13833EF-hand_8coord: 145..197
e-value: 3.6E-7
score: 29.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1028..1044
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1028..1047
NoneNo IPR availablePANTHERPTHR44324FAMILY NOT NAMEDcoord: 173..1061
NoneNo IPR availablePANTHERPTHR44324:SF4WD40 REPEAT DOMAIN 95coord: 173..1061
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 527..541
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 695..709
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 465..549
score: 14.266
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 632..982
score: 18.246
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 130..200
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 467..973
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 224..554