Activating transcription factor 7 interacting

Overview
NameActivating transcription factor 7 interacting
Smed IDSMED30017465
Length (bp)1816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Activating transcription factor 7 interacting (SMED30017465) t-SNE clustered cells

Violin plots show distribution of expression levels for Activating transcription factor 7 interacting (SMED30017465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Activating transcription factor 7 interacting (SMED30017465) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Activating transcription factor 7 interacting (SMED30017465) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017465SMESG000077767.1 SmedASXL_004560SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017465SMESG000077767.1 SmedASXL_004560SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Activating transcription factor 7 interacting vs. Ensembl Human
Match: ATF7IP (activating transcription factor 7 interacting protein [Source:HGNC Symbol;Acc:HGNC:20092])

HSP 1 Score: 50.8322 bits (120), Expect = 7.991e-6
Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y +E     P+   W  +GE+ A PLPM CT++      K+YF++R+ D + RF
Sbjct: 1196 YHLYAYHEEPSATVPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRF 1252          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Human
Match: ATF7IP (activating transcription factor 7 interacting protein [Source:HGNC Symbol;Acc:HGNC:20092])

HSP 1 Score: 50.8322 bits (120), Expect = 7.991e-6
Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y +E     P+   W  +GE+ A PLPM CT++      K+YF++R+ D + RF
Sbjct: 1196 YHLYAYHEEPSATVPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRF 1252          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Human
Match: ATF7IP (activating transcription factor 7 interacting protein [Source:HGNC Symbol;Acc:HGNC:20092])

HSP 1 Score: 50.8322 bits (120), Expect = 8.059e-6
Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y +E     P+   W  +GE+ A PLPM CT++      K+YF++R+ D + RF
Sbjct: 1195 YHLYAYHEEPSATVPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRF 1251          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Human
Match: ATF7IP (activating transcription factor 7 interacting protein [Source:HGNC Symbol;Acc:HGNC:20092])

HSP 1 Score: 50.8322 bits (120), Expect = 8.069e-6
Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y +E     P+   W  +GE+ A PLPM CT++      K+YF++R+ D + RF
Sbjct: 1204 YHLYAYHEEPSATVPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRF 1260          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Fly
Match: wde (gene:FBgn0027499 transcript:FBtr0339467)

HSP 1 Score: 49.6766 bits (117), Expect = 8.479e-6
Identity = 29/91 (31.87%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 1149 PELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            P + ISL D    +  T++ S     +   + YQIY+Y  ++   +P+++ W  VG++SA  LPM  T++      ++YF++R VD   RF
Sbjct: 1324 PVIRISLLDTGIVISWTLEDSSPRFAE--CVMYQIYAY--QETINEPSTDSWRHVGDVSAMLLPMAVTLNQFQENQRYYFAVRGVDSHERF 1410          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Fly
Match: wde (gene:FBgn0027499 transcript:FBtr0088253)

HSP 1 Score: 49.6766 bits (117), Expect = 8.479e-6
Identity = 29/91 (31.87%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 1149 PELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            P + ISL D    +  T++ S     +   + YQIY+Y  ++   +P+++ W  VG++SA  LPM  T++      ++YF++R VD   RF
Sbjct: 1324 PVIRISLLDTGIVISWTLEDSSPRFAE--CVMYQIYAY--QETINEPSTDSWRHVGDVSAMLLPMAVTLNQFQENQRYYFAVRGVDSHERF 1410          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Xenopus
Match: ATF7IP (activating transcription factor 7 interacting protein [Source:NCBI gene;Acc:100490711])

HSP 1 Score: 52.373 bits (124), Expect = 2.446e-6
Identity = 22/62 (35.48%), Postives = 36/62 (58.06%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
            Y +Y+Y ++     P+   W  +GE+ A PLPM CT++      K+YF++R+ D F RF  +
Sbjct: 1191 YHLYAYHEDPNATSPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIFGRFGQF 1250          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Xenopus
Match: ATF7IP (activating transcription factor 7 interacting protein [Source:NCBI gene;Acc:100490711])

HSP 1 Score: 52.373 bits (124), Expect = 2.450e-6
Identity = 22/62 (35.48%), Postives = 36/62 (58.06%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
            Y +Y+Y ++     P+   W  +GE+ A PLPM CT++      K+YF++R+ D F RF  +
Sbjct: 1146 YHLYAYHEDPNATSPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIFGRFGQF 1205          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Mouse
Match: Atf7ip (activating transcription factor 7 interacting protein [Source:MGI Symbol;Acc:MGI:1858965])

HSP 1 Score: 50.447 bits (119), Expect = 7.626e-6
Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y +E     P+   W  +GE+ A PLPM CT++      K+YF++R+ D + RF
Sbjct: 1232 YHLYAYHEEPSATVPSQ--WKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRF 1288          
BLAST of Activating transcription factor 7 interacting vs. TrEMBL
Match: A0A3P7WKB0 (Fibronectin type-III domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS261 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.642e-7
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 3
Query: 1146 TPELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYK--DEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
             P+L+I+       L  +I     S   +P++ Y+IYSY   + +     TS  W  VGE++A PLPM CT++     + +YF +RSVD   R+S W
Sbjct:   66 VPQLTIAEAAEGVCLQWSITYPIGSF--EPAISYEIYSYASSEVNLVTVQTSLPWKKVGEVAALPLPMACTLTHVQANNMYYFIVRSVDRLRRYSSW 160          
BLAST of Activating transcription factor 7 interacting vs. TrEMBL
Match: A0A068WFF1 (Activating transcription factor 7 interacting OS=Echinococcus granulosus OX=6210 GN=EgrG_000664300 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.660e-7
Identity = 36/95 (37.89%), Postives = 56/95 (58.95%), Query Frame = 3
Query: 1155 LSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDED---RYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
            LSIS++     L   +D  + S   +P+ +Y++YSY   D   R+   +S+VW  VG I A PLPM CT++     + +YF++RS+D F R S+W
Sbjct:  263 LSISVSSEGICLQWELDSVEFSF--EPAAFYELYSYASSDVDPRFPL-SSDVWQKVGTIEALPLPMACTLTSVQPENVYYFALRSIDRFQRTSEW 354          
BLAST of Activating transcription factor 7 interacting vs. TrEMBL
Match: A0A183L8Y6 (Fibronectin type-III domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.689e-7
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 3
Query: 1146 TPELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYK--DEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
             P+L+I+       L  +I     S   +P++ Y+IYSY   + +     TS  W  VGE++A PLPM CT++     + +YF +RSVD   R+S W
Sbjct:   66 VPQLTIAEAAEGVCLQWSITYPIGSF--EPAISYEIYSYASSEVNLVTVQTSLPWKKVGEVAALPLPMACTLTHVQANNMYYFIVRSVDRLRRYSSW 160          
BLAST of Activating transcription factor 7 interacting vs. TrEMBL
Match: A0A068YAC2 (Activating transcription factor 7 interacting OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.986e-7
Identity = 36/95 (37.89%), Postives = 56/95 (58.95%), Query Frame = 3
Query: 1155 LSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDED---RYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
            LSIS++     L   +D  + S   +P+ +Y++YSY   D   R+   +S+VW  VG I A PLPM CT++     + +YF++RS+D F R S+W
Sbjct:  263 LSISVSSEGICLQWELDSVEFSF--EPAAFYELYSYASSDVDPRFPL-SSDVWQKVGTIEALPLPMACTLTSVQPENVYYFALRSIDRFQRTSEW 354          
BLAST of Activating transcription factor 7 interacting vs. TrEMBL
Match: W6UV25 (Activating transcription factor 7-interacting protein OS=Echinococcus granulosus OX=6210 GN=EGR_07830 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.265e-7
Identity = 36/95 (37.89%), Postives = 56/95 (58.95%), Query Frame = 3
Query: 1155 LSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDED---RYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDW 1430
            LSIS++     L   +D  + S   +P+ +Y++YSY   D   R+   +S+VW  VG I A PLPM CT++     + +YF++RS+D F R S+W
Sbjct:  263 LSISVSSEGICLQWELDSVEFSF--EPAAFYELYSYASSDVDPRFPL-SSDVWQKVGTIEALPLPMACTLTSVQPENVYYFALRSIDRFQRTSEW 354          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Cavefish
Match: atf7ip (activating transcription factor 7 interacting protein [Source:NCBI gene;Acc:558977])

HSP 1 Score: 50.447 bits (119), Expect = 4.676e-6
Identity = 22/61 (36.07%), Postives = 37/61 (60.66%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPT--SEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y  + + A  T  S++W  +GE+ A PLPM CT++       +YF++R+ D + RF
Sbjct:  729 YHLYAYHQDHQGAAATVSSQLWKKIGEVKALPLPMACTLTQFVSGSTYYFAVRAKDVYGRF 789          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Cavefish
Match: atf7ip (activating transcription factor 7 interacting protein [Source:NCBI gene;Acc:558977])

HSP 1 Score: 50.447 bits (119), Expect = 5.332e-6
Identity = 22/61 (36.07%), Postives = 37/61 (60.66%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPT--SEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y  + + A  T  S++W  +GE+ A PLPM CT++       +YF++R+ D + RF
Sbjct:  760 YHLYAYHQDHQGAAATVSSQLWKKIGEVKALPLPMACTLTQFVSGSTYYFAVRAKDVYGRF 820          
BLAST of Activating transcription factor 7 interacting vs. Ensembl Cavefish
Match: atf7ip (activating transcription factor 7 interacting protein [Source:NCBI gene;Acc:558977])

HSP 1 Score: 50.447 bits (119), Expect = 5.332e-6
Identity = 22/61 (36.07%), Postives = 37/61 (60.66%), Query Frame = 3
Query: 1245 YQIYSYKDEDRYAKPT--SEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRF 1421
            Y +Y+Y  + + A  T  S++W  +GE+ A PLPM CT++       +YF++R+ D + RF
Sbjct:  760 YHLYAYHQDHQGAAATVSSQLWKKIGEVKALPLPMACTLTQFVSGSTYYFAVRAKDVYGRF 820          
BLAST of Activating transcription factor 7 interacting vs. Planmine SMEST
Match: SMESG000077767.1 (SMESG000077767.1)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 3
Query:   36 MFDIIKESTEQKIXXXXXXXXXXXXXXXXXYNILLNDFNEAKLLKADXXXXXXXXXXXXXXXXXXLLKTNFLQNITFKTLPSFNNFKTIFNQINCKSQKFVKVTNDLTNKIDLLEEIYDGSEYKKVKVVNKLIQCSIDINTPQKIVLNLISKLNPSNDVSSERSIHPAYSNEINDEVQLSMDNSETFKVPGLYQDQLSPNHSQSMSSTKDFFADYLPVDCEPSSQDDQFFLEHDGNTYVRVDETNYHLIQSVSDDGIITTETGLQLVVPEGVKIPFSTSNHVADMIHDDLNISNNTNDYVSPLDQNQYYSXXXXXXXXXXXNNRKSYKDNGYLSQYTYQTSNPAKPFSDYVGXXXXXXXXXXFTLSSQLYTPELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDWXXXXXXXXXXXXXXTNGR 1484
            MFDIIKESTEQKIKSNLKKPLLKDSSKSNNYNILLNDFNEAKLLKADTSQSGSQSPSSFTTPSSPLLKTNFLQNITFKTLPSFNNFKTIFNQINCKSQKFVKVTNDLTNKIDLLEEIYDGSEYKKVKVVNKLIQCSIDINTPQKIVLNLISKLNPSNDVSSERSIHPAYSNEINDEVQLSMDNSETFKVPGLYQDQLSPNHSQSMSSTKDFFADYLPVDCEPSSQDDQFFLEHDGNTYVRVDETNYHLIQSVSDDGIITTETGLQLVVPEGVKIPFSTSNHVADMIHDDLNISNNTNDYVSPLDQNQYYSDPIPDPIPIQPNNRKSYKDNGYLSQYTYQTSNPAKPFSDYVGLPPRPPPLMPFTLSSQLYTPELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDWSNVVQVEVESNQNSTNGR
Sbjct:    1 MFDIIKESTEQKIKSNLKKPLLKDSSKSNNYNILLNDFNEAKLLKADTSQSGSQSPSSFTTPSSPLLKTNFLQNITFKTLPSFNNFKTIFNQINCKSQKFVKVTNDLTNKIDLLEEIYDGSEYKKVKVVNKLIQCSIDINTPQKIVLNLISKLNPSNDVSSERSIHPAYSNEINDEVQLSMDNSETFKVPGLYQDQLSPNHSQSMSSTKDFFADYLPVDCEPSSQDDQFFLEHDGNTYVRVDETNYHLIQSVSDDGIITTETGLQLVVPEGVKIPFSTSNHVADMIHDDLNISNNTNDYVSPLDQNQYYSDPIPDPIPIQPNNRKSYKDNGYLSQYTYQTSNPAKPFSDYVGLPPRPPPLMPFTLSSQLYTPELSISLTDHDCELMLTIDCSKKSLPQQPSLYYQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHYFSIRSVDEFNRFSDWSNVVQVEVESNQNSTNGR 483          
The following BLAST results are available for this feature:
BLAST of Activating transcription factor 7 interacting vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ATF7IP7.991e-637.29activating transcription factor 7 interacting prot... [more]
ATF7IP7.991e-637.29activating transcription factor 7 interacting prot... [more]
ATF7IP8.059e-637.29activating transcription factor 7 interacting prot... [more]
ATF7IP8.069e-637.29activating transcription factor 7 interacting prot... [more]
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wde8.479e-631.87gene:FBgn0027499 transcript:FBtr0339467[more]
wde8.479e-631.87gene:FBgn0027499 transcript:FBtr0088253[more]
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ATF7IP2.446e-635.48activating transcription factor 7 interacting prot... [more]
ATF7IP2.450e-635.48activating transcription factor 7 interacting prot... [more]
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atf7ip7.626e-637.29activating transcription factor 7 interacting prot... [more]
back to top
BLAST of Activating transcription factor 7 interacting vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7WKB01.642e-735.05Fibronectin type-III domain-containing protein OS=... [more]
A0A068WFF11.660e-737.89Activating transcription factor 7 interacting OS=E... [more]
A0A183L8Y61.689e-735.05Fibronectin type-III domain-containing protein OS=... [more]
A0A068YAC21.986e-737.89Activating transcription factor 7 interacting OS=E... [more]
W6UV252.265e-737.89Activating transcription factor 7-interacting prot... [more]
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atf7ip4.676e-636.07activating transcription factor 7 interacting prot... [more]
atf7ip5.332e-636.07activating transcription factor 7 interacting prot... [more]
atf7ip5.332e-636.07activating transcription factor 7 interacting prot... [more]
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activating transcription factor 7 interacting vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077767.10.000e+0100.00SMESG000077767.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017465 ID=SMED30017465|Name=Activating transcription factor 7 interacting|organism=Schmidtea mediterranea sexual|type=transcript|length=1816bp
TCTATATAAATCTTATATGATTACTAAATTAATTAATGTTTGATATTATA
AAAGAAAGTACAGAACAAAAAATTAAATCAAATTTAAAAAAACCTTTATT
GAAAGATTCTTCGAAGTCAAACAATTACAATATTTTATTAAATGACTTCA
ATGAAGCCAAGTTACTTAAAGCTGATACAAGTCAATCTGGTTCTCAGTCT
CCATCGTCATTCACAACTCCGAGCTCACCATTGTTAAAAACAAATTTCTT
ACAAAATATAACATTCAAAACTCTACCATCGTTTAACAATTTTAAAACTA
TTTTCAATCAGATTAATTGCAAATCTCAAAAATTCGTCAAAGTAACCAAT
GATCTCACAAACAAAATTGATTTACTCGAAGAAATCTATGATGGATCAGA
ATATAAAAAAGTGAAAGTTGTAAATAAATTAATTCAATGCAGTATCGATA
TCAACACTCCTCAGAAAATTGTTTTGAATCTAATTTCCAAGTTAAATCCA
TCTAATGATGTAAGCTCTGAACGATCCATTCATCCTGCATATTCAAATGA
AATCAACGATGAAGTTCAATTGAGTATGGACAATTCAGAAACATTTAAAG
TGCCTGGTTTATATCAAGATCAATTGTCTCCAAACCATTCTCAATCAATG
AGTAGTACGAAGGATTTTTTTGCTGACTATCTACCTGTAGATTGCGAACC
ATCGAGTCAAGACGACCAATTTTTCTTAGAACACGATGGAAATACTTATG
TGCGAGTGGATGAAACGAACTATCACCTCATACAGAGTGTCTCTGATGAT
GGCATAATTACAACAGAAACCGGATTGCAGCTCGTAGTGCCTGAAGGTGT
GAAAATTCCATTCTCGACTTCCAATCATGTAGCTGATATGATCCATGATG
ATCTTAACATATCCAATAACACCAATGATTATGTATCACCACTCGATCAG
AATCAATATTATTCTGACCCTATTCCCGATCCGATTCCAATACAGCCCAA
TAATCGTAAAAGTTATAAGGACAATGGATATCTTTCCCAGTATACATACC
AGACCAGCAATCCTGCTAAACCGTTTTCAGACTACGTAGGGTTGCCTCCA
CGACCGCCCCCACTTATGCCGTTCACTCTCTCATCTCAGCTTTATACCCC
TGAGCTTTCAATCAGCCTAACGGATCACGATTGTGAACTCATGTTGACAA
TTGATTGTTCCAAGAAGTCATTGCCACAACAGCCATCTCTATACTATCAA
ATATACAGCTACAAAGACGAAGACCGCTATGCCAAACCAACATCGGAAGT
CTGGGGTCTTGTTGGTGAAATATCTGCTTGTCCTTTGCCAATGTTCTGTA
CTATTAGCATTCCAAGTGGTGTCCATAAGCACTATTTTTCAATTCGATCA
GTTGATGAATTCAACAGGTTCAGCGATTGGTCGAATGTCGTTCAGGTAGA
AGTCGAGAGTAATCAGAATTCCACCAATGGAAGATGAATGTCAATAATAT
AGAGAAATTGTTATTTCAAGTAAACCGTGTATAGTAATTGTTGTATAGTA
ATCGATCATTGATTTGATTGGGTATTCTGTGTAAAGTGCTTTATGATGAT
TGGTTGATTGATTTGTTTGTTACATTTGATTGTAACACGATTTCTACGGT
ACAAATAGATTTATCACTCTTGTCTTCAATAACTTATATTGATTATAATT
TTATTATTATTATTTGCTCAATTGTGCAATTGATGATTTCATGTCAGACT
GTTTTATTGATTAAATATTTATTTAATTGTGCTAATTATTTTTATAATTC
GATTCTGAAACAAGAG
back to top

protein sequence of SMED30017465-orf-1

>SMED30017465-orf-1 ID=SMED30017465-orf-1|Name=SMED30017465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MFDIIKESTEQKIKSNLKKPLLKDSSKSNNYNILLNDFNEAKLLKADTSQ
SGSQSPSSFTTPSSPLLKTNFLQNITFKTLPSFNNFKTIFNQINCKSQKF
VKVTNDLTNKIDLLEEIYDGSEYKKVKVVNKLIQCSIDINTPQKIVLNLI
SKLNPSNDVSSERSIHPAYSNEINDEVQLSMDNSETFKVPGLYQDQLSPN
HSQSMSSTKDFFADYLPVDCEPSSQDDQFFLEHDGNTYVRVDETNYHLIQ
SVSDDGIITTETGLQLVVPEGVKIPFSTSNHVADMIHDDLNISNNTNDYV
SPLDQNQYYSDPIPDPIPIQPNNRKSYKDNGYLSQYTYQTSNPAKPFSDY
VGLPPRPPPLMPFTLSSQLYTPELSISLTDHDCELMLTIDCSKKSLPQQP
SLYYQIYSYKDEDRYAKPTSEVWGLVGEISACPLPMFCTISIPSGVHKHY
FSIRSVDEFNRFSDWSNVVQVEVESNQNSTNGR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR003961FN3_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIIPFAMPF16794fn3_4coord: 371..469
e-value: 1.3E-15
score: 57.2