Protein disulfide-isomerase

Overview
NameProtein disulfide-isomerase
Smed IDSMED30017430
Length (bp)2357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase (SMED30017430) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30017430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase (SMED30017430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30017430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30017430SMESG000017020.1 dd_Smed_v4_1058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30017430SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30017430SMESG000077847.1 SMESG000072336.1 SMESG000044971.1 SMESG000033570.1 SMESG000031842.1 SMESG000026563.1 SMESG000017020.1 SMESG000014849.1 Contig13526uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30017430SMESG000023147.1 SMESG000017020.1 dd_Smed_v6_250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30017430smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30017430SMESG000023147.1 SMESG000017020.1 SMED30028938smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017430SMESG000023147.1 dd_Smed_v4_250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000017020.1 Contig37625newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000017020.1 Contig37625uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000023147.1 SMESG000036586.1 Contig37626newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000023147.1 SMESG000036586.1 Contig37626uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000023147.1 Contig44747newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017430SMESG000023147.1 Contig44747uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 506.908 bits (1304), Expect = 3.423e-172
Identity = 247/449 (55.01%), Postives = 333/449 (74.16%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDS 1928
            V+ L  SNF E  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFF++G      +Y  GR AD I++WL+K+TGP A TL     A++L+ES +V V+GFFKD  S +AK F   A++ DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    +++  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+T+A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+PEDWDK PVKVLVGKNF+ VA D+ K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +IVIAKMDSTANEVE V++ SFPT+K+FP  +D  ++D+ G+RTL+ FKKF++S
Sbjct:   26 VLVLRKSNFAE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD-GVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 472          

HSP 2 Score: 112.079 bits (279), Expect = 3.260e-25
Identity = 55/106 (51.89%), Postives = 70/106 (66.04%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            EE+ VLVL  SNF E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y   R A  IVN
Sbjct:   22 EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN 127          

HSP 3 Score: 73.559 bits (179), Expect = 7.130e-13
Identity = 39/94 (41.49%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERT 461
            V VL   NF +V  ++ K V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  369 VKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERT 462          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 444.506 bits (1142), Expect = 1.580e-148
Identity = 221/449 (49.22%), Postives = 302/449 (67.26%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDS 1928
            V+ L  SNF E  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFF++G      +Y G   +D+                     AK  +++ + +                       DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    +++  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+T+A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+PEDWDK PVKVLVGKNF+ VA D+ K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +IVIAKMDSTANEVE V++ SFPT+K+FP  +D  ++D+ G+RTL+ FKKF++S
Sbjct:   26 VLVLRKSNFAE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTGDVESDS---------------------AKQFLQAAEAI-----------------------DDIPFGITSNSDVFSKYQLDKD-GVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 428          

HSP 2 Score: 106.686 bits (265), Expect = 1.139e-23
Identity = 51/98 (52.04%), Postives = 67/98 (68.37%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGE 455
            EE+ VLVL  SNF E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y G+
Sbjct:   22 EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTGD 119          

HSP 3 Score: 73.559 bits (179), Expect = 6.463e-13
Identity = 39/94 (41.49%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERT 461
            V VL   NF +V  ++ K V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  325 VKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERT 418          

HSP 4 Score: 65.4698 bits (158), Expect = 2.228e-10
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 3
Query: 1596 PEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQ-LGETYKDNTDIVIAKMDST--ANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFIDS 1928
            PE+ D   V VL   NF + A    K + VEFYAPWCGHCK LAP + +  G+   + ++I +AK+D+T  ++  +   ++ +PTIK+F   D+    ++ GD   ++ K+F+ +
Sbjct:   20 PEEEDH--VLVLRKSNF-AEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTGDVESDSAKQFLQA 131          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 391.349 bits (1004), Expect = 4.305e-127
Identity = 190/447 (42.51%), Postives = 290/447 (64.88%), Query Frame = 3
Query:  627 MVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK-------DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKP-DDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKD-SDEMVDFEGDRTLETFKKFIDSN 1931
            + L+     LVEF+APWCGHC+ALAPEY+ AA  L  ++ ++ LAKVD   + +LA +F +  YPTLKFF++G      +Y G R A+ I  WL ++ GP A  L+    A+ALI  +D+VV+GFF+D        F ++A    D+ FG+T +  +F +F ++ D ++VLFKKFDEGR DF    VD+       D+  F+  + + +V EFN +T+ KIF   I  H+L F+++    + EL   F  +A +F GQVLFV+++    DN+ VL++FG+     P+ R++ LE    K+ P D   +++ ++  F  +VL+G+VKP++++QEIP DWD+ PVK LVGKNF+ VA D++K VFV+FYAPWC HCK++AP W+ L E Y+D+ DI+IA++D+TANE++   +  FPT+KYFP     ++++++  R LETF KF+D+ 
Sbjct:   54 LALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKD-TVVLFKKFDEGRADFP---VDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDV-AADNEHVLQYFGLKAEAAPTLRLVNLETTK-KYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNG 494          

HSP 2 Score: 87.8113 bits (216), Expect = 2.271e-17
Identity = 43/104 (41.35%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERTAGSIV 476
            +G+LVL+       + ++  +LVEFYAPWCGHCQ+LAPE+ KAA  L     VV +  VD      L + +G+  +PT+K F  G   H P++Y G R A  I 
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTH-PEEYTGPRDAEGIA 144          

HSP 3 Score: 72.4034 bits (176), Expect = 1.690e-12
Identity = 40/106 (37.74%), Postives = 63/106 (59.43%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLE 902
            V  L   NF+++     +   V+F+APWC HCK +AP + + AEK ++   II +A++DAT  N+L   F + G+PTLK+F  G   KV++Y   R  +T   +L+
Sbjct:  390 VKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDII-IAELDATA-NEL-DAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLD 492          

HSP 4 Score: 60.4622 bits (145), Expect = 7.566e-9
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 3
Query:  123 SIVLFCFAL--AQCNADITEEE--------GVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 416
            SI  FC A+   Q    +  +E         V  L   NF +V  ++ K V V+FYAPWC HC+ +AP W+  A   +    +   ++D  ++    + + GFPT+K F
Sbjct:  359 SITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYF 467          

HSP 5 Score: 56.225 bits (134), Expect = 1.683e-7
Identity = 26/79 (32.91%), Postives = 45/79 (56.96%), Query Frame = 3
Query: 1626 VLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIV-IAKMDSTANE--VEGVRIQSFPTIKYF 1853
            +++ ++   +A  +  A+ VEFYAPWCGHC+ LAP + +        + +V +AK+D  A     E   +  +PT+K+F
Sbjct:   45 LVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFF 123          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 389.423 bits (999), Expect = 2.014e-126
Identity = 191/447 (42.73%), Postives = 290/447 (64.88%), Query Frame = 3
Query:  627 MVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK-------DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKP-DDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKD-SDEMVDFEGDRTLETFKKFIDSN 1931
            + L+     LVEF+APWCGHC+ALAPEY+ AA  L  ++ ++ LAKVD   + +LA +F +  YPTLKFF++G      +Y G R A+ I  WL ++ GP A  L+    A+ALI  +D+VV+GFF+D+  A   A    A    D+ FG+T +  +F +F ++ D ++VLFKKFDEGR DF    VD+       D+  F+  + + +V EFN +T+ KIF   I  H+L F+++    + EL   F  +A +F GQVLFV+++    DN+ VL++FG+     P+ R++ LE    K+ P D   +++ ++  F  +VL+G+VKP++++QEIP DWD+ PVK LVGKNF+ VA D++K VFV+FYAPWC HCK++AP W+ L E Y+D+ DI+IA++D+TANE++   +  FPT+KYFP     ++++++  R LETF KF+D+ 
Sbjct:   54 LALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDEDVATFLALAQDAL---DMTFGLTDRPRLFQQFGLTKD-TVVLFKKFDEGRADFP---VDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDV-AADNEHVLQYFGLKAEAAPTLRLVNLETTK-KYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNG 491          

HSP 2 Score: 87.8113 bits (216), Expect = 2.283e-17
Identity = 43/104 (41.35%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERTAGSIV 476
            +G+LVL+       + ++  +LVEFYAPWCGHCQ+LAPE+ KAA  L     VV +  VD      L + +G+  +PT+K F  G   H P++Y G R A  I 
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTH-PEEYTGPRDAEGIA 144          

HSP 3 Score: 72.4034 bits (176), Expect = 1.768e-12
Identity = 40/106 (37.74%), Postives = 63/106 (59.43%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLE 902
            V  L   NF+++     +   V+F+APWC HCK +AP + + AEK ++   II +A++DAT  N+L   F + G+PTLK+F  G   KV++Y   R  +T   +L+
Sbjct:  387 VKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDII-IAELDATA-NEL-DAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLD 489          

HSP 4 Score: 60.4622 bits (145), Expect = 7.999e-9
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 3
Query:  123 SIVLFCFAL--AQCNADITEEE--------GVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 416
            SI  FC A+   Q    +  +E         V  L   NF +V  ++ K V V+FYAPWC HC+ +AP W+  A   +    +   ++D  ++    + + GFPT+K F
Sbjct:  356 SITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYF 464          

HSP 5 Score: 56.225 bits (134), Expect = 1.620e-7
Identity = 26/79 (32.91%), Postives = 45/79 (56.96%), Query Frame = 3
Query: 1626 VLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIV-IAKMDSTANE--VEGVRIQSFPTIKYF 1853
            +++ ++   +A  +  A+ VEFYAPWCGHC+ LAP + +        + +V +AK+D  A     E   +  +PT+K+F
Sbjct:   45 LVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFF 123          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 321.242 bits (822), Expect = 9.168e-99
Identity = 223/606 (36.80%), Postives = 323/606 (53.30%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAA---TLKSVEEAKALIESKDVVVVGFFKDQX-XXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVL----FKKFDEGRN---DFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETS-----AKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYFPK-DSDEMVDFE-GDRTLETFKKFIDSN 1931
            GVLVL ++NF+  +     VL+EFYAPWCGHC+  APE++K A  LK     + V  +D    S L   + + G+PTIKI  K +    DY+G RT   IV A ++E+ +                        +      + LT  NFDE V+   +  LVEF+APWCGHCK LAPEY  AA++L +++  I LAKVDAT E DLA +F + GYPTLK F+ G+  DY G R    I+ ++ +++GPP+    TLK V+E   L +  DV+++G FK ++  A  +  ++  + ++D  F  T    +    KVS    +V+    F+   E R+   D  G   D  I+ F+ KY LP+V         K +  + +  V+ + S           QF  S     AK F  +  F I   DEED    ++  G++++       I L++   KF  +     S+ L  FV +   GK+KP + +Q +P++ +K PVKV+VGK FDS+  D  K V +EFYAPWCGHCKQL P+++ L + YK    +VIAKMD+TAN+V   R  ++ FPTI + P  D    V FE GDR LE   KFI+ +
Sbjct:   63 GVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV--DYEGSRTQEEIV-AKVREVSQ---------------------PDWTPPPEVTLVLTKENFDE-VVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQE--FLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRY--TRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDF-PEYTFAI--ADEEDYAGEVKDLGLSESGEDVNAAI-LDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN-NKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEH 634          

HSP 2 Score: 92.8189 bits (229), Expect = 8.516e-19
Identity = 46/108 (42.59%), Postives = 65/108 (60.19%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKE 494
            E  LVLT  NF+EV+     +LVEFYAPWCGHC+ LAPE++KAA  L      + +  VD    + L + + + G+PT+KIF K +  P DY G R    IV+  +++
Sbjct:  177 EVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGR--PYDYNGPREKYGIVDYMIEQ 282          

HSP 3 Score: 80.1073 bits (196), Expect = 8.304e-15
Identity = 45/100 (45.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query: 1614 NPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKD-NTDIVIAKMDSTANEVEGVR--IQSFPTIKYFPKDSDEMVDFEGDRTLE 1904
            N V VL   NFD+   DK   V +EFYAPWCGHCKQ AP ++++    KD +  I +AK+D+T+  V   R  +  +PTIK   K   + VD+EG RT E
Sbjct:   62 NGVLVLNDANFDNFVADKD-TVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKK--GQAVDYEGSRTQE 158          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 517.694 bits (1332), Expect = 4.247e-177
Identity = 257/447 (57.49%), Postives = 337/447 (75.39%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            +V+ LT  NFDE V+   E  LVEF+APWCGHCK+LAPEYA AA +LKE+ S IKL K+DATV  +++SKF+++GYPTLK F++GK  +Y GGR  D+II+WL+KKTGP A  L   +  K L ES DVVV+G+FKD  S  AK F  VA   DDV FG++++ AV  E ++  +  IVLFKKFD+GR  F        ++T+I   +L +V EF QETA  IFGG IK H L F+SK+S ++A+L+ +F+ +AK+F G+VLFV INTD E+N R++EFFG+ K + P+ R+I LE+DM KFKPD   I++EN++ F Q+ LDG VKPH+M+++IPEDWDKNPVK+LVGKNF+ VARD +K V VEFYAPWCGHCKQLAP WD+LGE + D+  IVIAKMDST NEVE V+IQSFPTIK+FP  S+++VD+ GDRT+E F KF+++N
Sbjct:   24 NVIVLTKDNFDE-VINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGE-GIVLFKKFDDGRVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETN 468          

HSP 2 Score: 115.931 bits (289), Expect = 5.218e-27
Identity = 56/118 (47.46%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  132 LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            LF   L    A I EEE V+VLT  NF+EVI  N+++LVEFYAPWCGHC+SLAPE+ KAAT LK     +K+G +D   +  +   + ++G+PT+K+F   K  P++Y G R   SI+
Sbjct:    7 LFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK--PQEYNGGRDHDSII 122          

HSP 3 Score: 77.411 bits (189), Expect = 1.310e-14
Identity = 40/93 (43.01%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V +L   NF +V   N K VLVEFYAPWCGHC+ LAP W K          +    MD   +  +   IQ FPTIK F    +   DY G+RT
Sbjct:  365 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRT 457          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 517.694 bits (1332), Expect = 4.247e-177
Identity = 257/447 (57.49%), Postives = 337/447 (75.39%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            +V+ LT  NFDE V+   E  LVEF+APWCGHCK+LAPEYA AA +LKE+ S IKL K+DATV  +++SKF+++GYPTLK F++GK  +Y GGR  D+II+WL+KKTGP A  L   +  K L ES DVVV+G+FKD  S  AK F  VA   DDV FG++++ AV  E ++  +  IVLFKKFD+GR  F        ++T+I   +L +V EF QETA  IFGG IK H L F+SK+S ++A+L+ +F+ +AK+F G+VLFV INTD E+N R++EFFG+ K + P+ R+I LE+DM KFKPD   I++EN++ F Q+ LDG VKPH+M+++IPEDWDKNPVK+LVGKNF+ VARD +K V VEFYAPWCGHCKQLAP WD+LGE + D+  IVIAKMDST NEVE V+IQSFPTIK+FP  S+++VD+ GDRT+E F KF+++N
Sbjct:   24 NVIVLTKDNFDE-VINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGE-GIVLFKKFDDGRVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETN 468          

HSP 2 Score: 115.931 bits (289), Expect = 5.218e-27
Identity = 56/118 (47.46%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  132 LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            LF   L    A I EEE V+VLT  NF+EVI  N+++LVEFYAPWCGHC+SLAPE+ KAAT LK     +K+G +D   +  +   + ++G+PT+K+F   K  P++Y G R   SI+
Sbjct:    7 LFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK--PQEYNGGRDHDSII 122          

HSP 3 Score: 77.411 bits (189), Expect = 1.310e-14
Identity = 40/93 (43.01%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V +L   NF +V   N K VLVEFYAPWCGHC+ LAP W K          +    MD   +  +   IQ FPTIK F    +   DY G+RT
Sbjct:  365 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRT 457          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 465.307 bits (1196), Expect = 1.661e-157
Identity = 233/447 (52.13%), Postives = 306/447 (68.46%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            +V+ LT  NFDE V+   E  LVEF+APWCGHCK+LAPEYA AA +LKE+ S IKL K+DATV  +++SKF+++GYPTLK F++GK  +Y GGR  D+II+WL+KKTGP A  L   +  K L ES DVVV+G+                                   FK ++ D                      D +T+I   +L +V EF QETA  IFGG IK H L F+SK+S ++A+L+ +F+ +AK+F G+VLFV INTD E+N R++EFFG+ K + P+ R+I LE+DM KFKPD   I++EN++ F Q+ LDG VKPH+M+++IPEDWDKNPVK+LVGKNF+ VARD +K V VEFYAPWCGHCKQLAP WD+LGE + D+  IVIAKMDST NEVE V+IQSFPTIK+FP  S+++VD+ GDRT+E F KF+++N
Sbjct:   24 NVIVLTKDNFDE-VINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGY-----------------------------------FKDTTSD----------------------DAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETN 412          

HSP 2 Score: 115.546 bits (288), Expect = 3.887e-27
Identity = 56/118 (47.46%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  132 LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            LF   L    A I EEE V+VLT  NF+EVI  N+++LVEFYAPWCGHC+SLAPE+ KAAT LK     +K+G +D   +  +   + ++G+PT+K+F   K  P++Y G R   SI+
Sbjct:    7 LFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK--PQEYNGGRDHDSII 122          

HSP 3 Score: 77.0258 bits (188), Expect = 1.415e-14
Identity = 40/93 (43.01%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V +L   NF +V   N K VLVEFYAPWCGHC+ LAP W K          +    MD   +  +   IQ FPTIK F    +   DY G+RT
Sbjct:  309 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRT 401          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 465.307 bits (1196), Expect = 1.661e-157
Identity = 233/447 (52.13%), Postives = 306/447 (68.46%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            +V+ LT  NFDE V+   E  LVEF+APWCGHCK+LAPEYA AA +LKE+ S IKL K+DATV  +++SKF+++GYPTLK F++GK  +Y GGR  D+II+WL+KKTGP A  L   +  K L ES DVVV+G+                                   FK ++ D                      D +T+I   +L +V EF QETA  IFGG IK H L F+SK+S ++A+L+ +F+ +AK+F G+VLFV INTD E+N R++EFFG+ K + P+ R+I LE+DM KFKPD   I++EN++ F Q+ LDG VKPH+M+++IPEDWDKNPVK+LVGKNF+ VARD +K V VEFYAPWCGHCKQLAP WD+LGE + D+  IVIAKMDST NEVE V+IQSFPTIK+FP  S+++VD+ GDRT+E F KF+++N
Sbjct:   24 NVIVLTKDNFDE-VINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGY-----------------------------------FKDTTSD----------------------DAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETN 412          

HSP 2 Score: 115.546 bits (288), Expect = 3.887e-27
Identity = 56/118 (47.46%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  132 LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            LF   L    A I EEE V+VLT  NF+EVI  N+++LVEFYAPWCGHC+SLAPE+ KAAT LK     +K+G +D   +  +   + ++G+PT+K+F   K  P++Y G R   SI+
Sbjct:    7 LFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK--PQEYNGGRDHDSII 122          

HSP 3 Score: 77.0258 bits (188), Expect = 1.415e-14
Identity = 40/93 (43.01%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V +L   NF +V   N K VLVEFYAPWCGHC+ LAP W K          +    MD   +  +   IQ FPTIK F    +   DY G+RT
Sbjct:  309 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRT 401          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-1 (Protein disulfide-isomerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17967])

HSP 1 Score: 366.696 bits (940), Expect = 1.355e-118
Identity = 197/451 (43.68%), Postives = 286/451 (63.41%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDI------RTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFID 1925
            +V+ LT+SNF+E +    E  LV+F+APWC HCK+LAP+Y  AA+ LKE+ S IKLAKVDAT    LASKF+++GYPT+ +FK GK   Y GGR    I+ W++KK+GP   T++SVE+ + L     VVV+G+FKD  S AA  +  VADS DD  F V     V     ++ +D + L +   +G +  T    + +I      + ++  Y+L  V EF  E+A +I GG +KK     I K    + E   +F   AKKF  +++FV+++ D E+N R+LEF G+   +TP+ R++ L D + KFKP +     E+   F  S L+GK    +  Q++PEDW+  PVKVLV  NF+ +A D++K VFV+FYAPWCGHCKQL P+WD+L E Y+ N ++VIAK+D+T NE+  V++ SFPT+K +P  S   VD++GDR LE F++F++
Sbjct:   24 NVLVLTESNFEETI-NGNEFVLVKFYAPWCVHCKSLAPKYDEAADLLKEEGSDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTVTTVESVEQLEELKGKTRVVVLGYFKDAKSDAATIYNEVADSVDDAFFAVAGSAEVAAAASLN-EDGVALIRT--DGDDSETSTIAEAEITNTIALKQWLHAYKLSAVTEFTHESAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKKFRAKIVFVLLDVDVEENARILEFLGVDAKNTPANRIVSLADQVEKFKPQEG----EDFEAFTNSYLEGKSAQDLKAQDLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAKLDATLNELADVKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVN 466          

HSP 2 Score: 99.3673 bits (246), Expect = 1.466e-21
Identity = 51/123 (41.46%), Postives = 71/123 (57.72%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            LS+      +A   A + + E VLVLT SNF E I  N++VLV+FYAPWC HC+SLAP++ +AA  LK     +K+  VD  +  +L   + ++G+PTI  F   K  P  Y G R    IV+
Sbjct:    3 LSVSFIFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAADLLKEEGSDIKLAKVDATENQALASKFEVRGYPTILYFKSGK--PTKYTGGRATAQIVD 123          

HSP 3 Score: 73.559 bits (179), Expect = 2.109e-13
Identity = 35/92 (38.04%), Postives = 51/92 (55.43%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGER 458
            V VL  SNFNE+ +++ K V V+FYAPWCGHC+ L P W + A   +    V    +D   +      +  FPT+K++     +P DY G+R
Sbjct:  365 VKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAKLDATLNELADVKVNSFPTLKLWPAGSSTPVDYDGDR 456          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 490.73 bits (1262), Expect = 1.868e-166
Identity = 239/446 (53.59%), Postives = 330/446 (73.99%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            V+  T  NF +++  +E   LVEF+APWCGHCKALAPEYA AA++L EK S IKLAKVDATVE +LA ++ ++GYPTLKFF+ G  ++Y GGR A  II+W+ KKTGPPA  L SV +A+  ++  ++ ++GFFKD  S  AK F  VA++ D  VFGV+S   V  +++ + D+ +VLFK FD+ ++ F G   +++++ F     LP++++FN E+A KIFGGSIK H+L F+S++     +     +  AKK+   +LFV I++DEED+ R+ EFFGM K + P+ R+I+LE+DM K+KP+   +S+E +  F++  LDGK+K H+++QE+PEDWDKNPVKVLV  NF+SVA DKSK+V VEFYAPWCGHCKQLAPI+DQL E YKDN DIVIAKMDSTANE+E ++I SFPTIKYF K+ ++++DF  DRTL+ F KF+D+N
Sbjct:   29 VLVATVDNFKQLIADNE-FVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYE-AKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDAN 472          

HSP 2 Score: 111.694 bits (278), Expect = 1.688e-25
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 3
Query:  111 MKYLSIVLF---CFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            MK+L   LF    +  A   A++  EEGVLV T  NF ++I  N++VLVEFYAPWCGHC++LAPE+ KAA  L   +  +K+  VD      L + Y ++G+PT+K F     SP +Y G R A  I+
Sbjct:    1 MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADII 126          

HSP 3 Score: 75.0998 bits (183), Expect = 9.198e-14
Identity = 41/98 (41.84%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            V VL +SNF  V ++K+K VLVEFYAPWCGHC+ LAP + + A   K    +    MD  ++  +   I  FPTIK F K  +   D+  +RT    V
Sbjct:  369 VKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFV 466          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 490.73 bits (1262), Expect = 1.868e-166
Identity = 239/446 (53.59%), Postives = 330/446 (73.99%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            V+  T  NF +++  +E   LVEF+APWCGHCKALAPEYA AA++L EK S IKLAKVDATVE +LA ++ ++GYPTLKFF+ G  ++Y GGR A  II+W+ KKTGPPA  L SV +A+  ++  ++ ++GFFKD  S  AK F  VA++ D  VFGV+S   V  +++ + D+ +VLFK FD+ ++ F G   +++++ F     LP++++FN E+A KIFGGSIK H+L F+S++     +     +  AKK+   +LFV I++DEED+ R+ EFFGM K + P+ R+I+LE+DM K+KP+   +S+E +  F++  LDGK+K H+++QE+PEDWDKNPVKVLV  NF+SVA DKSK+V VEFYAPWCGHCKQLAPI+DQL E YKDN DIVIAKMDSTANE+E ++I SFPTIKYF K+ ++++DF  DRTL+ F KF+D+N
Sbjct:   29 VLVATVDNFKQLIADNE-FVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYE-AKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDAN 472          

HSP 2 Score: 111.694 bits (278), Expect = 1.688e-25
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 3
Query:  111 MKYLSIVLF---CFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            MK+L   LF    +  A   A++  EEGVLV T  NF ++I  N++VLVEFYAPWCGHC++LAPE+ KAA  L   +  +K+  VD      L + Y ++G+PT+K F     SP +Y G R A  I+
Sbjct:    1 MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADII 126          

HSP 3 Score: 75.0998 bits (183), Expect = 9.198e-14
Identity = 41/98 (41.84%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            V VL +SNF  V ++K+K VLVEFYAPWCGHC+ LAP + + A   K    +    MD  ++  +   I  FPTIK F K  +   D+  +RT    V
Sbjct:  369 VKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFV 466          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: ERp60 (gene:FBgn0033663 transcript:FBtr0088058)

HSP 1 Score: 243.817 bits (621), Expect = 8.366e-72
Identity = 169/459 (36.82%), Postives = 256/459 (55.77%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDAT-VENDLASKFKIQGYPTLKFFKDGKV-MDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXX-XXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFK------KFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAEL-KGQFETSAKKFLGQVLFVIINTDE---EDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEG-VRIQSFPTIKYFPKDS-DEMVDFEGDRTLETFKKFI 1922
            DV+EL D +F    LK  E  LV F+APWCGHCK L PEYA AAE +K+ +  IKLAKVD T    +  SK+ + GYPTLK F+  +V  DY G R A  I  ++  + GP + T+++V E K  +++KD  + G+F D  S  AK F      +++   FG +S+K V D  K    D IVL +      KF+     F G   + D+ TF+ +    +V    Q++  K F   +     S   +K+ K     + +    AK+F+GQ+ F I + D+   E N+   +F G    D P   ++  ++  +K+   D   S ENL  FV+ +L  +++P++ ++ IPE  D  PVKV V KNFD +  +  K   +EFYAPWCGHCK+L+PI+++L E  +D  D+ I KMD+TAN+V     ++ FPT+ + PKD+ ++ V + G R ++ F K+I
Sbjct:   23 DVLELGDDDF-ATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLD--KQGETDKIVLIRAPHLSNKFESSSIKFEGS-SESDLSTFVKENFHGLVGHRTQDSV-KDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDFVG----DKPV--VLARDEKNLKYALKD-EFSVENLQDFVEKLLANELEPYIKSEPIPESNDA-PVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDE-DVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYI 467          

HSP 2 Score: 75.0998 bits (183), Expect = 9.727e-14
Identity = 40/104 (38.46%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYS-SLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            E+ VL L + +F   +++++  LV FYAPWCGHC+ L PE+ KAA  +K     +K+  VD  +        Y + G+PT+KIF + + S +DY G R A  I 
Sbjct:   21 EQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVS-QDYNGPREASGIA 123          

HSP 3 Score: 62.7734 bits (151), Expect = 7.312e-10
Identity = 39/106 (36.79%), Postives = 57/106 (53.77%), Query Frame = 3
Query:  186 VLVLTNSNFNE-VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQP-YGIQGFPTIKIFGK-SKHSPKDYQGERTAGSIVNAALKE 494
            V V    NF++ VI   K  L+EFYAPWCGHC+ L+P +++ A  L+    V  V MD  ++   P + ++GFPT+    K +K+ P  Y G R     +    KE
Sbjct:  366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQD-EDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 470          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: CaBP1 (gene:FBgn0025678 transcript:FBtr0345544)

HSP 1 Score: 238.424 bits (607), Expect = 1.860e-70
Identity = 136/268 (50.75%), Postives = 179/268 (66.79%), Query Frame = 3
Query:  123 SIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK-----VMDYGGGRTADTIISWLEKK 908
            SI+L  F +   +A  +  +GV+ LT SNF+ EV++ +   +VEFYAPWCGHCQSL PE+KK A ALKGVVKVG+V+ D  S+L   +G++GFPTIKIFG +K SP DY G+RTA +I  AAL E+ + V+  L             S G  S SG DV+ELT+ NFD++VL S++ WLVEFFAPWCGHCK LAPE+A AA++LK K   +KL  +DAT     A+++ ++GYPT+KFF  G        +Y GGRTA  I+SW   K
Sbjct:    6 SILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVL------GGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK---VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDK 264          

HSP 2 Score: 68.9366 bits (167), Expect = 6.411e-12
Identity = 34/95 (35.79%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGV--RIQSFPTIKYFPKDSDEMVD---FEGDRT 1898
            L   NFD +  +      VEF+APWCGHCK LAP W +  +  K    + +  +D+TA++ +     ++ +PTIK+FP  S    D   ++G RT
Sbjct:  161 LTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK--VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRT 253          

HSP 3 Score: 63.5438 bits (153), Expect = 3.776e-10
Identity = 37/92 (40.22%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDI--VIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRT 1898
            L   NFD           VEFYAPWCGHC+ L P + +L +  K    +  V A  DST +   GVR   FPTIK F  +     D+ G RT
Sbjct:   30 LTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVR--GFPTIKIFGANKKSPTDYNGQRT 119          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: CaBP1 (gene:FBgn0025678 transcript:FBtr0080837)

HSP 1 Score: 238.424 bits (607), Expect = 1.860e-70
Identity = 136/268 (50.75%), Postives = 179/268 (66.79%), Query Frame = 3
Query:  123 SIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK-----VMDYGGGRTADTIISWLEKK 908
            SI+L  F +   +A  +  +GV+ LT SNF+ EV++ +   +VEFYAPWCGHCQSL PE+KK A ALKGVVKVG+V+ D  S+L   +G++GFPTIKIFG +K SP DY G+RTA +I  AAL E+ + V+  L             S G  S SG DV+ELT+ NFD++VL S++ WLVEFFAPWCGHCK LAPE+A AA++LK K   +KL  +DAT     A+++ ++GYPT+KFF  G        +Y GGRTA  I+SW   K
Sbjct:    6 SILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVL------GGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK---VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDK 264          

HSP 2 Score: 68.9366 bits (167), Expect = 6.411e-12
Identity = 34/95 (35.79%), Postives = 52/95 (54.74%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGV--RIQSFPTIKYFPKDSDEMVD---FEGDRT 1898
            L   NFD +  +      VEF+APWCGHCK LAP W +  +  K    + +  +D+TA++ +     ++ +PTIK+FP  S    D   ++G RT
Sbjct:  161 LTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK--VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRT 253          

HSP 3 Score: 63.5438 bits (153), Expect = 3.776e-10
Identity = 37/92 (40.22%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDI--VIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRT 1898
            L   NFD           VEFYAPWCGHC+ L P + +L +  K    +  V A  DST +   GVR   FPTIK F  +     D+ G RT
Sbjct:   30 LTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVR--GFPTIKIFGANKKSPTDYNGQRT 119          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 501.516 bits (1290), Expect = 2.466e-170
Identity = 246/450 (54.67%), Postives = 338/450 (75.11%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK---VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFIDS 1928
            DV+ L  SNF+E  LK+    LVEF+APWCGHCKALAPEY+ AA  LK + S I+LAKVDAT E++LA +F ++GYPT+KFFK G+     +Y  GR A+ I+SWL+K+TGP A TL  V +A+++I   +V V+GFFKD  S  +KAF   A++ DD+ FG+TS  +VF +F+V+ D S+VLFKKFDEGRN F G    + +  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K ++ + +   QF+ +A+ F G++LF+ I++D +DN R+LEFFG+ K + P  R+I LE++M K+KP+ + I++EN+  F  S ++G +KPH+M+Q+IPEDWDKNPVKVLVGKNF+ VA + +  VFVEFYAPWCGHCKQLAPIWDQLGE +KDN +IV+AKMDSTANE+E V++ SFPT+K+FP  D  +++D+ G+RTL+ F KF++S
Sbjct:   23 DVLVLKKSNFEE-ALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKD-SVVLFKKFDEGRNTFDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPVIRLITLEEEMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLES 470          

HSP 2 Score: 117.857 bits (294), Expect = 2.353e-27
Identity = 59/124 (47.58%), Postives = 79/124 (63.71%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L  ++ C   A   A+I EEE VLVL  SNF E ++ +  VLVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q +G++G+PTIK F G  K +PK+Y   R A  IV+
Sbjct:    2 LKFLIVCALAAMSAAEIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVS 125          

HSP 3 Score: 70.4774 bits (171), Expect = 3.468e-12
Identity = 43/125 (34.40%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  123 SIVLFCFALAQ-------CNADITEE---EGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERT 461
            +I+ FC +  +        + DI E+     V VL   NF EV       V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   +  FPT+K F    +    DY GERT
Sbjct:  336 NIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERT 460          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 501.516 bits (1290), Expect = 2.466e-170
Identity = 246/450 (54.67%), Postives = 338/450 (75.11%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK---VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFIDS 1928
            DV+ L  SNF+E  LK+    LVEF+APWCGHCKALAPEY+ AA  LK + S I+LAKVDAT E++LA +F ++GYPT+KFFK G+     +Y  GR A+ I+SWL+K+TGP A TL  V +A+++I   +V V+GFFKD  S  +KAF   A++ DD+ FG+TS  +VF +F+V+ D S+VLFKKFDEGRN F G    + +  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K ++ + +   QF+ +A+ F G++LF+ I++D +DN R+LEFFG+ K + P  R+I LE++M K+KP+ + I++EN+  F  S ++G +KPH+M+Q+IPEDWDKNPVKVLVGKNF+ VA + +  VFVEFYAPWCGHCKQLAPIWDQLGE +KDN +IV+AKMDSTANE+E V++ SFPT+K+FP  D  +++D+ G+RTL+ F KF++S
Sbjct:   23 DVLVLKKSNFEE-ALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKD-SVVLFKKFDEGRNTFDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPVIRLITLEEEMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLES 470          

HSP 2 Score: 117.857 bits (294), Expect = 2.353e-27
Identity = 59/124 (47.58%), Postives = 79/124 (63.71%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L  ++ C   A   A+I EEE VLVL  SNF E ++ +  VLVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q +G++G+PTIK F G  K +PK+Y   R A  IV+
Sbjct:    2 LKFLIVCALAAMSAAEIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVS 125          

HSP 3 Score: 70.4774 bits (171), Expect = 3.468e-12
Identity = 43/125 (34.40%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  123 SIVLFCFALAQ-------CNADITEE---EGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERT 461
            +I+ FC +  +        + DI E+     V VL   NF EV       V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   +  FPT+K F    +    DY GERT
Sbjct:  336 NIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERT 460          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 416.001 bits (1068), Expect = 1.631e-136
Identity = 219/456 (48.03%), Postives = 305/456 (66.89%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK------DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSD-EMVDFEGDRTLETFKKFIDS 1928
            DV+ L   NFD   L   +  LVEF+APWCGHC++L P YA  A +LK  +S ++LAKVDA  E +LAS+F +  +PTLKFFK+G   +   + G RT   I  WLEK T P A  L  V+ A+AL+E+ +V+VVGFFKD     AK F  V     DV FG+TS   +F +++V +D S+VLFKKFDE R D   P  D+      ++ +FI    + +V+ FN+E A +IF   ++KH+L F++   +    L  +F   A +F  +V+F+ ++   E  + VL++F +++ D P+ R+I  ED +V +  D +TI+ + L  F Q V DG VKP++ +QEIPEDWDKNPVKVLVGKNF+ VA D+SK VFVEFYAPWCGHC+QLAP+WD+LGE YKD  +I+IAKMD+T N+VE + IQ FPTIKYFP  ++ ++VD++G+R LETF KF+D+
Sbjct:   57 DVLILHSVNFDR-ALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKTD-SLVLFKKFDERRADM--PLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDSQNALVEEFREVASEFKEKVIFITVDVTAEKVNHVLKYFSISEDDVPTIRLINTED-VVTYAMDGSTINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDN 507          

HSP 2 Score: 88.5817 bits (218), Expect = 8.426e-18
Identity = 42/107 (39.25%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGK-SKHSPKDYQGERTAGSI 473
            +ITE++ VL+L + NF+  + +NKY+LVEFYAPWCGHC+SL P + + A  LK     V++  VD  +   L   + +  FPT+K F + ++ +   + G+RT   I
Sbjct:   51 EITEDKDVLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGI 157          

HSP 3 Score: 77.7962 bits (190), Expect = 2.176e-14
Identity = 42/93 (45.16%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGER 458
            V VL   NFNEV  +++K V VEFYAPWCGHCQ LAP W +     K    +    MD   +  +   IQGFPTIK F   ++    DY G R
Sbjct:  404 VKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNR 496          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 416.387 bits (1069), Expect = 1.660e-136
Identity = 219/456 (48.03%), Postives = 305/456 (66.89%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK------DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSD-EMVDFEGDRTLETFKKFIDS 1928
            DV+ L   NFD   L   +  LVEF+APWCGHC++L P YA  A +LK  +S ++LAKVDA  E +LAS+F +  +PTLKFFK+G   +   + G RT   I  WLEK T P A  L  V+ A+AL+E+ +V+VVGFFKD     AK F  V     DV FG+TS   +F +++V +D S+VLFKKFDE R D   P  D+      ++ +FI    + +V+ FN+E A +IF   ++KH+L F++   +    L  +F   A +F  +V+F+ ++   E  + VL++F +++ D P+ R+I  ED +V +  D +TI+ + L  F Q V DG VKP++ +QEIPEDWDKNPVKVLVGKNF+ VA D+SK VFVEFYAPWCGHC+QLAP+WD+LGE YKD  +I+IAKMD+T N+VE + IQ FPTIKYFP  ++ ++VD++G+R LETF KF+D+
Sbjct:   57 DVLILHSVNFDR-ALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKTD-SLVLFKKFDERRADM--PLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDSQNALVEEFREVASEFKEKVIFITVDVTAEKVNHVLKYFSISEDDVPTIRLINTED-VVTYAMDGSTINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDN 507          

HSP 2 Score: 88.9669 bits (219), Expect = 6.946e-18
Identity = 42/107 (39.25%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGK-SKHSPKDYQGERTAGSI 473
            +ITE++ VL+L + NF+  + +NKY+LVEFYAPWCGHC+SL P + + A  LK     V++  VD  +   L   + +  FPT+K F + ++ +   + G+RT   I
Sbjct:   51 EITEDKDVLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGI 157          

HSP 3 Score: 78.1814 bits (191), Expect = 1.515e-14
Identity = 42/93 (45.16%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGER 458
            V VL   NFNEV  +++K V VEFYAPWCGHCQ LAP W +     K    +    MD   +  +   IQGFPTIK F   ++    DY G R
Sbjct:  404 VKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNR 496          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 319.701 bits (818), Expect = 2.344e-98
Identity = 218/609 (35.80%), Postives = 326/609 (53.53%), Query Frame = 3
Query:  168 ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALI-ESKDVVVVGFF-KDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLF-KKFDEGRNDFTGPFVDKD------IRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETS-----AKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEV--EGVRIQSFPTIKYFPKDSDEM-VDFE-GDRTLETFKKFIDSN 1931
            + EE GVLVLT++NF+  IE    VLVEFYAPWCGHC+  APE++K A  LK     + V  VD  K S LG  + + G+PTIKI  K +  P DY G+R+  +IV    + + E+ +                            + LT  NFD+ V+ + +  LVEF+APWCGHCK LAPEY  AA++L  +   I LAKVDAT E+DLA++F + GYPTLK F+ GK  DY G R    I+ ++  + GPP+  ++++++ + L+ +  D V+VG F  D+ +A     E+    ++D  F  T    V    K S    ++L  +KF       +     KD      ++ F  K+ LP+V    Q    K +  + +  V+ +          +  QF  S     AK F  +  F I   DEED    L+  G++++       I  E    K+  +     S+ L  FV +   GK+KP + +Q +P++ +K PVKV+VGK FD +  D  K V +EFYAPWCGHCK+L P +  LG+ YK+  ++VIAKMD+TAN+V  +  +++ FPTI + P ++ +  + FE G R +E F KF++ +
Sbjct:   55 VKEENGVLVLTDANFDTFIEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKGE--PLDYDGDRSEHAIV----ERVKEVAQPDWKPPPEA------------------TLVLTKDNFDD-VVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKGKAFDYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLRDGDDAVIVGVFSSDEDAAYEIYQEACNSLREDYKFMHTFNNDVTKFLKASPGQVVMLQPEKFRSKYESASHSLTIKDSTPASEVQDFFKKHILPLVGHRKQSNDAKRY--TKRPLVVVYYGVDFSFDYRVATQFWRSKVLEVAKDF-PEYTFAI--ADEEDYADELKSLGLSESGEEVNVGIVGEGGK-KYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKSQPLPKN-NKGPVKVVVGKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVEKH 631          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 483.026 bits (1242), Expect = 4.476e-163
Identity = 242/451 (53.66%), Postives = 324/451 (71.84%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDSN 1931
            DV+ L   NFDE  LK     LVEF+APWCGHCKALAPEY  AA  LK +   I+L KVDAT E+DLA +F ++GYPT+KFFK+G      +Y  GR A  I++WL+K+TGP A+TL       AL++S +V V+GFFKD AS  AK F   A++ DD+ FG+TS +A F ++++  D  IVLFKKFDEGRN + G    +++ +FI   +LP+VIEF ++TA  IFGG IK H+L F+ K +  Y E    F+ +A  F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+ A +S+E +  F  S L+GKVKPH+M+Q++ +DWDKNPVK+LVGKNF+ V  ++ K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ +I+IAKMDSTANE+E V+I SFPT+K+FP    + V D+ G+RTLE F KF++S 
Sbjct:   22 DVLVLKKDNFDE-ALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD-GIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESG 470          

HSP 2 Score: 117.857 bits (294), Expect = 3.110e-27
Identity = 57/122 (46.72%), Postives = 79/122 (64.75%), Query Frame = 3
Query:  126 IVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            ++  C  L    A+I EE  VLVL   NF+E +++  ++LVEFYAPWCGHC++LAPE++KAA  LK     +++G VD  + S L Q +G++G+PTIK F    K SPK+Y   R A  IVN
Sbjct:    3 LLFGCSLLIVARANIPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVN 124          

HSP 3 Score: 73.1738 bits (178), Expect = 7.139e-13
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERT 461
            ++Q  +D  ++  V +L   NF EV+  + K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   I  FPT+K F  G  K+   DY GERT
Sbjct:  353 MSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNV-ADYNGERT 459          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 483.797 bits (1244), Expect = 4.535e-163
Identity = 242/451 (53.66%), Postives = 324/451 (71.84%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDSN 1931
            DV+ L   NFDE  LK     LVEF+APWCGHCKALAPEY  AA  LK +   I+L KVDAT E+DLA +F ++GYPT+KFFK+G      +Y  GR A  I++WL+K+TGP A+TL       AL++S +V V+GFFKD AS  AK F   A++ DD+ FG+TS +A F ++++  D  IVLFKKFDEGRN + G    +++ +FI   +LP+VIEF ++TA  IFGG IK H+L F+ K +  Y E    F+ +A  F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+ A +S+E +  F  S L+GKVKPH+M+Q++ +DWDKNPVK+LVGKNF+ V  ++ K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ +I+IAKMDSTANE+E V+I SFPT+K+FP    + V D+ G+RTLE F KF++S 
Sbjct:   42 DVLVLKKDNFDE-ALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD-GIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESG 490          

HSP 2 Score: 120.168 bits (300), Expect = 6.870e-28
Identity = 61/134 (45.52%), Postives = 85/134 (63.43%), Query Frame = 3
Query:   96 VLF*KMKYLSIVLF--CFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            VL+ ++  +  VL   C  L    A+I EE  VLVL   NF+E +++  ++LVEFYAPWCGHC++LAPE++KAA  LK     +++G VD  + S L Q +G++G+PTIK F    K SPK+Y   R A  IVN
Sbjct:   11 VLYTRLIMMRAVLLFGCSLLIVARANIPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVN 144          

HSP 3 Score: 73.1738 bits (178), Expect = 7.731e-13
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERT 461
            ++Q  +D  ++  V +L   NF EV+  + K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   I  FPT+K F  G  K+   DY GERT
Sbjct:  373 MSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNV-ADYNGERT 479          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 483.026 bits (1242), Expect = 4.629e-163
Identity = 242/451 (53.66%), Postives = 324/451 (71.84%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDSN 1931
            DV+ L   NFDE  LK     LVEF+APWCGHCKALAPEY  AA  LK +   I+L KVDAT E+DLA +F ++GYPT+KFFK+G      +Y  GR A  I++WL+K+TGP A+TL       AL++S +V V+GFFKD AS  AK F   A++ DD+ FG+TS +A F ++++  D  IVLFKKFDEGRN + G    +++ +FI   +LP+VIEF ++TA  IFGG IK H+L F+ K +  Y E    F+ +A  F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+ A +S+E +  F  S L+GKVKPH+M+Q++ +DWDKNPVK+LVGKNF+ V  ++ K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ +I+IAKMDSTANE+E V+I SFPT+K+FP    + V D+ G+RTLE F KF++S 
Sbjct:   15 DVLVLKKDNFDE-ALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD-GIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESG 463          

HSP 2 Score: 114.775 bits (286), Expect = 3.111e-26
Identity = 55/110 (50.00%), Postives = 75/110 (68.18%), Query Frame = 3
Query:  162 ADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            A+I EE  VLVL   NF+E +++  ++LVEFYAPWCGHC++LAPE++KAA  LK     +++G VD  + S L Q +G++G+PTIK F    K SPK+Y   R A  IVN
Sbjct:    8 ANIPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVN 117          

HSP 3 Score: 73.559 bits (179), Expect = 6.243e-13
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERT 461
            ++Q  +D  ++  V +L   NF EV+  + K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   I  FPT+K F  G  K+   DY GERT
Sbjct:  346 MSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNV-ADYNGERT 452          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 468.774 bits (1205), Expect = 6.366e-158
Identity = 229/426 (53.76%), Postives = 310/426 (72.77%), Query Frame = 3
Query:  666 FAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDSN 1931
            +APWCGHCKALAPEY  AA  LK +   I+L KVDAT E+DLA +F ++GYPT+KFFK+G      +Y  GR A  I++WL+K+TGP A+TL       AL++S +V V+GFFKD AS  AK F   A++ DD+ FG+TS +A F ++++  D  IVLFKKFDEGRN + G    +++ +FI   +LP+VIEF ++TA  IFGG IK H+L F+ K +  Y E    F+ +A  F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+ A +S+E +  F  S L+GKVKPH+M+Q++ +DWDKNPVK+LVGKNF+ V  ++ K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ +I+IAKMDSTANE+E V+I SFPT+K+FP    + V D+ G+RTLE F KF++S 
Sbjct:   18 YAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD-GIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESG 442          

HSP 2 Score: 85.5001 bits (210), Expect = 8.393e-17
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  240 VLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
             + + YAPWCGHC++LAPE++KAA  LK     +++G VD  + S L Q +G++G+PTIK F    K SPK+Y   R A  IVN
Sbjct:   13 AMAKGYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVN 96          

HSP 3 Score: 83.1889 bits (204), Expect = 4.723e-16
Identity = 51/121 (42.15%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEK--KTGPPAATLKSVEEA 950
            L   NF+E+V   E+   VEF+APWCGHCK LAP +    EK K+  +II +AK+D+T  N++ +  KI  +PTLKFF  G    V DY G RT +    +LE   + G     L+ +E+A
Sbjct:  341 LVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENII-IAKMDSTA-NEIEA-VKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDA 458          

HSP 4 Score: 72.7886 bits (177), Expect = 8.358e-13
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERT 461
            ++Q  +D  ++  V +L   NF EV+  + K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   I  FPT+K F  G  K+   DY GERT
Sbjct:  325 MSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNV-ADYNGERT 431          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 467.618 bits (1202), Expect = 1.403e-157
Identity = 229/425 (53.88%), Postives = 309/425 (72.71%), Query Frame = 3
Query:  669 APWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDSN 1931
            APWCGHCKALAPEY  AA  LK +   I+L KVDAT E+DLA +F ++GYPT+KFFK+G      +Y  GR A  I++WL+K+TGP A+TL       AL++S +V V+GFFKD AS  AK F   A++ DD+ FG+TS +A F ++++  D  IVLFKKFDEGRN + G    +++ +FI   +LP+VIEF ++TA  IFGG IK H+L F+ K +  Y E    F+ +A  F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+ A +S+E +  F  S L+GKVKPH+M+Q++ +DWDKNPVK+LVGKNF+ V  ++ K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ +I+IAKMDSTANE+E V+I SFPT+K+FP    + V D+ G+RTLE F KF++S 
Sbjct:   13 APWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD-GIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESG 436          

HSP 2 Score: 83.1889 bits (204), Expect = 4.667e-16
Identity = 51/121 (42.15%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEK--KTGPPAATLKSVEEA 950
            L   NF+E+V   E+   VEF+APWCGHCK LAP +    EK K+  +II +AK+D+T  N++ +  KI  +PTLKFF  G    V DY G RT +    +LE   + G     L+ +E+A
Sbjct:  335 LVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENII-IAKMDSTA-NEIEA-VKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADEDLEDLEDA 452          

HSP 3 Score: 82.4185 bits (202), Expect = 7.268e-16
Identity = 39/78 (50.00%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  258 APWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            APWCGHC++LAPE++KAA  LK     +++G VD  + S L Q +G++G+PTIK F    K SPK+Y   R A  IVN
Sbjct:   13 APWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVN 90          

HSP 4 Score: 72.7886 bits (177), Expect = 8.629e-13
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERT 461
            ++Q  +D  ++  V +L   NF EV+  + K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   I  FPT+K F  G  K+   DY GERT
Sbjct:  319 MSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNV-ADYNGERT 425          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: P4hb (prolyl 4-hydroxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:97464])

HSP 1 Score: 491.115 bits (1263), Expect = 2.880e-166
Identity = 244/450 (54.22%), Postives = 332/450 (73.78%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDS 1928
            +V+ L  SNF+E  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFFK+G      +Y  GR AD I++WL+K+TGP A TL     A++L++S +V V+GFFKD  S +AK F   A++ DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    + +  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+ +A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+PEDWDK PVKVLVG NF+ VA D+ K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +I+IAKMDSTANEVE V++ SFPT+K+FP  +D  ++D+ G+RTL+ FKKF++S
Sbjct:   27 NVLVLKKSNFEE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFSKYQLDKD-GVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 474          

HSP 2 Score: 103.99 bits (258), Expect = 9.158e-23
Identity = 55/108 (50.93%), Postives = 71/108 (65.74%), Query Frame = 3
Query:  168 ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            + EE+ VLVL  SNF E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y   R A  IVN
Sbjct:   22 LEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVN 129          

HSP 3 Score: 75.8702 bits (185), Expect = 8.048e-14
Identity = 40/94 (42.55%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERT 461
            V VL  +NF EV  ++ K V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  371 VKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERT 464          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 378.252 bits (970), Expect = 4.326e-122
Identity = 193/447 (43.18%), Postives = 287/447 (64.21%), Query Frame = 3
Query:  627 MVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK-------DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDA-TISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSD-EMVDFEGDRTLETFKKFIDSN 1931
            + L+     +VEF+APWCGHCK LAPEY+ AA  L  +++++ LAKVD   E +L  +F++ GYPTLKFF++G   +   Y G +TA+ I  WL ++ GP A  L+  E  +AL+   D+VV+GFF+D        F ++A    D+ FG T Q  +F++F ++ D ++VLFKKFDEGR DF    VDK       D+  F+  + + +V EFN +T+ KIF   I  H+L F+++   ++ EL   F  +A  F GQVLFV+++    DN  VL +FG+   + P+ R+I +E    K+ P     I++ ++  F Q+VL G++K ++++QEIP DWD+ PVK LV KNF+ VA D++K VFV+FYAPWC HCK++AP W+ L E YKD  DIVIA++D+TANE+E   +  +PT+K+FP   D +++D++  R LETF KF+DS 
Sbjct:   57 LALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFFQDLQGKDMATFLALAKDALDMTFGFTDQPQLFEKFGLTKD-TVVLFKKFDEGRADFP---VDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDV-AADNSHVLNYFGLKAEEAPTLRLINVETTK-KYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSG 497          

HSP 2 Score: 81.2629 bits (199), Expect = 1.978e-15
Identity = 40/108 (37.04%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIV 476
            ++ +E+G+LVL +   +  ++++  ++VEFYAPWCGHC+ LAPE+ KAA  L     VV +  VD      L + + + G+PT+K F   ++ +P++Y G +TA  I 
Sbjct:   40 EVPKEDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIA 147          

HSP 3 Score: 78.5666 bits (192), Expect = 1.343e-14
Identity = 43/106 (40.57%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLE 902
            V  L   NF+++     +   V+F+APWC HCK +AP + + AEK K++  I+ +A++DAT  N+L + F + GYPTLKFF  G   KV+DY   R  +T   +L+
Sbjct:  393 VKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIV-IAELDATA-NELEA-FSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLD 495          

HSP 4 Score: 61.2326 bits (147), Expect = 3.155e-9
Identity = 27/78 (34.62%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 416
            V  L + NF +V  ++ K V V+FYAPWC HC+ +AP W+  A   K    +   ++D  ++  + + + G+PT+K F
Sbjct:  393 VKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFF 470          

HSP 5 Score: 57.3806 bits (137), Expect = 5.515e-8
Identity = 27/71 (38.03%), Postives = 42/71 (59.15%), Query Frame = 3
Query: 1650 SVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIV-IAKMDSTANE--VEGVRIQSFPTIKYF 1853
            S+A  +  A+ VEFYAPWCGHCK+LAP + +        + +V +AK+D  A     +   +  +PT+K+F
Sbjct:   56 SLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFF 126          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 373.244 bits (957), Expect = 2.790e-120
Identity = 193/447 (43.18%), Postives = 286/447 (63.98%), Query Frame = 3
Query:  627 MVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK-------DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDA-TISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSD-EMVDFEGDRTLETFKKFIDSN 1931
            + L+     +VEF+APWCGHCK LAPEY+ AA  L  +++++ LAKVD   E +L  +F++ GYPTLKFF++G   +   Y G +TA+ I  WL ++ GP A  L+  E  +AL+   D+VV+GFF+ +  A   A    A    D+ FG T Q  +F++F ++ D ++VLFKKFDEGR DF    VDK       D+  F+  + + +V EFN +T+ KIF   I  H+L F+++   ++ EL   F  +A  F GQVLFV+++    DN  VL +FG+   + P+ R+I +E    K+ P     I++ ++  F Q+VL G++K ++++QEIP DWD+ PVK LV KNF+ VA D++K VFV+FYAPWC HCK++AP W+ L E YKD  DIVIA++D+TANE+E   +  +PT+K+FP   D +++D++  R LETF KF+DS 
Sbjct:   57 LALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFFQGKDMATFLALAKDAL---DMTFGFTDQPQLFEKFGLTKD-TVVLFKKFDEGRADFP---VDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDV-AADNSHVLNYFGLKAEEAPTLRLINVETTK-KYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSG 494          

HSP 2 Score: 80.8777 bits (198), Expect = 2.029e-15
Identity = 40/108 (37.04%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIV 476
            ++ +E+G+LVL +   +  ++++  ++VEFYAPWCGHC+ LAPE+ KAA  L     VV +  VD      L + + + G+PT+K F   ++ +P++Y G +TA  I 
Sbjct:   40 EVPKEDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIA 147          

HSP 3 Score: 78.5666 bits (192), Expect = 1.403e-14
Identity = 43/106 (40.57%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLE 902
            V  L   NF+++     +   V+F+APWC HCK +AP + + AEK K++  I+ +A++DAT  N+L + F + GYPTLKFF  G   KV+DY   R  +T   +L+
Sbjct:  390 VKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIV-IAELDATA-NELEA-FSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLD 492          

HSP 4 Score: 61.2326 bits (147), Expect = 3.394e-9
Identity = 27/78 (34.62%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 416
            V  L + NF +V  ++ K V V+FYAPWC HC+ +AP W+  A   K    +   ++D  ++  + + + G+PT+K F
Sbjct:  390 VKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFF 467          

HSP 5 Score: 57.3806 bits (137), Expect = 5.539e-8
Identity = 27/71 (38.03%), Postives = 42/71 (59.15%), Query Frame = 3
Query: 1650 SVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIV-IAKMDSTANE--VEGVRIQSFPTIKYF 1853
            S+A  +  A+ VEFYAPWCGHCK+LAP + +        + +V +AK+D  A     +   +  +PT+K+F
Sbjct:   56 SLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFF 126          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia4 (protein disulfide isomerase associated 4 [Source:MGI Symbol;Acc:MGI:104864])

HSP 1 Score: 309.686 bits (792), Expect = 1.446e-94
Identity = 211/609 (34.65%), Postives = 320/609 (52.55%), Query Frame = 3
Query:  183 GVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAA---TLKSVEEAKALIESKDVVVVGFFK-DQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVL----FKKFDEGR---NDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVL--------FVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEV--EGVRIQSFPTIKYFPK-DSDEMVDFE-GDRTLETFKKFIDSN 1931
            GV VL + NF+  +     VL+EFYAPWCGHC+  APE++K A+ LK     + V  +D    S L   + + G+PTIKI  K +    DY G RT   IV A ++E+ +   +                           + LT  NFD+ V+ + +  LVEF+APWCGHCK LAPEY  AA++L +++  I LAKVDAT + DLA +F + GYPTLK F+ G+  DY G R    I+ ++ +++GPP+    TLK V+E   L +  DVV++G F+ D   A  +  ++  + ++D  F  T    +    KVS    ++     F+   E R    D  G      I+ ++ K+ LP+V         K +  S +  V+ + S       +    +  + + +  +VL        +     DEED    ++  G++++       I L++   KF  +     S+ L  FV +   GK+KP + +Q +P++ +K PVKV+VGK FD++  D  K V +EFYAPWCGHCKQL PI+  LG+ YK   D+VIAKMD+TAN++  +  +++ FPTI + P  D    + FE G+R LE   KFID +
Sbjct:   59 GVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAV--DYDGSRTQEEIV-AKVREVSQPDWTPPPEV---------------------TLSLTKDNFDD-VVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQE--FLKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPEKFQSKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRY--SKRPLVVVYYS------VDFSFDYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAI-LDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN-NKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEH 630          

HSP 2 Score: 89.7373 bits (221), Expect = 5.367e-18
Identity = 44/108 (40.74%), Postives = 65/108 (60.19%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKE 494
            E  L LT  NF++V+     +LVEFYAPWCGHC+ LAPE++KAA  L      + +  VD  + + L + + + G+PT+KIF K +  P DY G R    IV+  +++
Sbjct:  173 EVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGR--PFDYNGPREKYGIVDYMIEQ 278          

HSP 3 Score: 79.7221 bits (195), Expect = 6.619e-15
Identity = 44/100 (44.00%), Postives = 61/100 (61.00%), Query Frame = 3
Query: 1614 NPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDN-TDIVIAKMDSTANEVEGVR--IQSFPTIKYFPKDSDEMVDFEGDRTLE 1904
            N V VL   NFD+   DK   V +EFYAPWCGHCKQ AP ++++  T KDN   I +AK+D+T+  +   +  +  +PTIK   K   + VD++G RT E
Sbjct:   58 NGVWVLNDGNFDNFVADKD-TVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKK--GQAVDYDGSRTQE 154          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia6 (protein disulfide isomerase associated 6 [Source:MGI Symbol;Acc:MGI:1919103])

HSP 1 Score: 266.929 bits (681), Expect = 9.420e-81
Identity = 152/309 (49.19%), Postives = 194/309 (62.78%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQC------NADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKN-SIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKV-MDYGGGRTADTIISW---LEKKTGPPAATLKSVEE--AKALIESKDVVVVGFF 995
            M+ + +      L  C      +   +  + V+ LT SNFN EVI+ +   LVEFYAPWCGHCQ L PEWKKAATALK VVKVGAV+ DK+ SLG  YG+QGFPTIKIFG +K+ P+DYQG RT  +IV+AAL  L +LV+ RL            K   G S S  DVVELTD  FD+ VL SE+ W+VEF+APWCGHCK L PE+A+AA ++KE+    +KLA VDAT+   LAS++ I+G+PT+K F+ G+  +DY GGRT   I+S    L     PP   L+ + E  AK   E   + VV   
Sbjct:    1 MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRL--GGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVL 307          

HSP 2 Score: 72.0182 bits (175), Expect = 1.020e-12
Identity = 42/100 (42.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query: 1611 KNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNT--DIVIAKMDSTANEVEGVR--IQSFPTIKYFPKDSDEMVDFEGDRT 1898
            K  V  L    FD    D      VEFYAPWCGHCK L P W       K+ T   + +A +D+T N+V   R  I+ FPTIK F K  +  VD++G RT
Sbjct:  164 KKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTIKIFQK-GESPVDYDGGRT 262          

HSP 3 Score: 66.2402 bits (160), Expect = 7.112e-11
Identity = 32/94 (34.04%), Postives = 44/94 (46.81%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETF 1910
            L   NF+           VEFYAPWCGHC++L P W +     KD   +     D   +      +Q FPTIK F  + ++  D++G RT E  
Sbjct:   35 LTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAI 128          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q17770|PDI2_CAEEL (Protein disulfide-isomerase 2 OS=Caenorhabditis elegans OX=6239 GN=pdi-2 PE=1 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 5.402e-176
Identity = 257/447 (57.49%), Postives = 337/447 (75.39%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            +V+ LT  NFDE V+   E  LVEF+APWCGHCK+LAPEYA AA +LKE+ S IKL K+DATV  +++SKF+++GYPTLK F++GK  +Y GGR  D+II+WL+KKTGP A  L   +  K L ES DVVV+G+FKD  S  AK F  VA   DDV FG++++ AV  E ++  +  IVLFKKFD+GR  F        ++T+I   +L +V EF QETA  IFGG IK H L F+SK+S ++A+L+ +F+ +AK+F G+VLFV INTD E+N R++EFFG+ K + P+ R+I LE+DM KFKPD   I++EN++ F Q+ LDG VKPH+M+++IPEDWDKNPVK+LVGKNF+ VARD +K V VEFYAPWCGHCKQLAP WD+LGE + D+  IVIAKMDST NEVE V+IQSFPTIK+FP  S+++VD+ GDRT+E F KF+++N
Sbjct:   24 NVIVLTKDNFDE-VINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGE-GIVLFKKFDDGRVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETN 468          

HSP 2 Score: 115.931 bits (289), Expect = 6.638e-26
Identity = 56/118 (47.46%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  132 LFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            LF   L    A I EEE V+VLT  NF+EVI  N+++LVEFYAPWCGHC+SLAPE+ KAAT LK     +K+G +D   +  +   + ++G+PT+K+F   K  P++Y G R   SI+
Sbjct:    7 LFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK--PQEYNGGRDHDSII 122          

HSP 3 Score: 77.411 bits (189), Expect = 1.667e-13
Identity = 40/93 (43.01%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKN-KYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V +L   NF +V   N K VLVEFYAPWCGHC+ LAP W K          +    MD   +  +   IQ FPTIK F    +   DY G+RT
Sbjct:  365 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRT 457          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P07237|PDIA1_HUMAN (Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3)

HSP 1 Score: 506.908 bits (1304), Expect = 1.644e-171
Identity = 247/449 (55.01%), Postives = 333/449 (74.16%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDS 1928
            V+ L  SNF E  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFF++G      +Y  GR AD I++WL+K+TGP A TL     A++L+ES +V V+GFFKD  S +AK F   A++ DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    +++  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+T+A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+PEDWDK PVKVLVGKNF+ VA D+ K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +IVIAKMDSTANEVE V++ SFPT+K+FP  +D  ++D+ G+RTL+ FKKF++S
Sbjct:   26 VLVLRKSNFAE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD-GVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 472          

HSP 2 Score: 112.079 bits (279), Expect = 1.566e-24
Identity = 55/106 (51.89%), Postives = 70/106 (66.04%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            EE+ VLVL  SNF E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y   R A  IVN
Sbjct:   22 EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN 127          

HSP 3 Score: 73.559 bits (179), Expect = 3.424e-12
Identity = 39/94 (41.49%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERT 461
            V VL   NF +V  ++ K V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  369 VKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERT 462          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P05307|PDIA1_BOVIN (Protein disulfide-isomerase OS=Bos taurus OX=9913 GN=P4HB PE=1 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 9.016e-171
Identity = 247/450 (54.89%), Postives = 331/450 (73.56%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDSN 1931
            V+ L   NFDE  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFFK+G      +Y  GR AD I++WL+K+TGP A+TL     A+AL+ES +V V+GFFKD  S +AK F   A+  DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    + +  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+ +A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+P+DWDK PVKVLVGKNF+ VA D+ K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +IVIAKMDSTANEVE V++ SFPT+K+FP  +D  ++D+ G+RTL+ FKKF++S 
Sbjct:   28 VLVLHKGNFDE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAASTLSDGAAAEALVESSEVAVIGFFKDMESDSAKQFFLAAEVIDDIPFGITSNSDVFSKYQLDKD-GVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLSNFKKAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESG 475          

HSP 2 Score: 110.923 bits (276), Expect = 3.817e-24
Identity = 54/106 (50.94%), Postives = 70/106 (66.04%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            EE+ VLVL   NF+E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y   R A  IVN
Sbjct:   24 EEDHVLVLHKGNFDEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVN 129          

HSP 3 Score: 75.0998 bits (183), Expect = 1.116e-12
Identity = 42/107 (39.25%), Postives = 57/107 (53.27%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERT 461
            ++Q   D  +++ V VL   NF EV  ++ K V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  358 MSQELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERT 464          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q2HWU2|PDIA1_MACFU (Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 1.375e-170
Identity = 246/449 (54.79%), Postives = 333/449 (74.16%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDS 1928
            V+ L  SNF E  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFF++G      +Y  GR AD I++WL+K+TGP A TL     A++L+ES +V V+GFFKD  S +AK F   A++ DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    +++  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+T+A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+PEDWDK PVKVLVGKNF+ VA D++K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +IVIAKMDSTANEVE +++ SFPT+K+FP   D  ++D+ G+RTL+ FKKF++S
Sbjct:   28 VLVLRKSNFAE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD-GVVLFKKFDEGRNNFEGEVTKENLLDFIKYNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAIKVHSFPTLKFFPASVDRTVIDYNGERTLDGFKKFLES 474          

HSP 2 Score: 111.694 bits (278), Expect = 1.907e-24
Identity = 55/106 (51.89%), Postives = 70/106 (66.04%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            EE+ VLVL  SNF E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y   R A  IVN
Sbjct:   24 EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN 129          

HSP 3 Score: 77.0258 bits (188), Expect = 2.375e-13
Identity = 41/94 (43.62%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERT 461
            V VL   NF EV  ++NK V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  371 VKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAIKVHSFPTLKFFPASVDRTVIDYNGERT 464          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q5R5B6|PDIA1_PONAB (Protein disulfide-isomerase OS=Pongo abelii OX=9601 GN=P4HB PE=2 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 2.254e-170
Identity = 246/449 (54.79%), Postives = 332/449 (73.94%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDE-MVDFEGDRTLETFKKFIDS 1928
            V+ L  SNF E  L + +  LVEF+APWCGHCKALAPEYA AA KLK + S I+LAKVDAT E+DLA ++ ++GYPT+KFF++G      +Y  GR AD I++WL+K+TGP A  L     A++L+ES +V VVGFFKD  S +AK F   A++ DD+ FG+TS   VF ++++  D  +VLFKKFDEGRN+F G    +++  FI   QLP+VIEF ++TA KIFGG IK H+L F+ K    Y      F+T+A+ F G++LF+ I++D  DN R+LEFFG+ K + P+ R+I LE++M K+KP+   +++E +  F    L+GK+KPH+M+QE+P+DWDK PVKVLVGKNF+ VA D+ K VFVEFYAPWCGHCKQLAPIWD+LGETYKD+ +IVIAKMDSTANEVE V++ SFPT+K+FP  +D  ++D+ G+RTL+ FKKF++S
Sbjct:   26 VLVLRKSNFAE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATILPDGAAAESLVESSEVAVVGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD-GVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 472          

HSP 2 Score: 117.087 bits (292), Expect = 3.668e-26
Identity = 61/126 (48.41%), Postives = 77/126 (61.11%), Query Frame = 3
Query:  120 LSIVLFCFALAQ--CNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSIVN 479
            L   L C A+A   C     EE+ VLVL  SNF E +  +KY+LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD  + S L Q YG++G+PTIK F      SPK+Y   R A  IVN
Sbjct:    2 LRRALLCLAVAGLVCADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN 127          

HSP 3 Score: 73.559 bits (179), Expect = 3.394e-12
Identity = 41/107 (38.32%), Postives = 57/107 (53.27%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERT 461
            ++Q   D  +++ V VL   NF +V  ++ K V VEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F  S   +  DY GERT
Sbjct:  356 MSQELPDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERT 462          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1S3K0S4 (Protein disulfide-isomerase OS=Lingula unguis OX=7574 GN=LOC106177788 PE=3 SV=1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 274/447 (61.30%), Postives = 346/447 (77.40%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            DV+ L + NFD  V++S +  LVEF+APWCGHCKALAPEYA AA+ LKE+ S IKL K+DATVE  +A KF+I+GYPTLKFF+DGK ++Y GGRT+  I++WL+KKTGPPA  L  VEE K  I +++V VVGFFKDQ S  AKAF   A S DDVVFG+TS  AVF + KV  D+ +VLFKKFDEGRN+F G    + I+TFI   QLP+V+EF QE+A KIFGG IK H+L FI+KK+  + +   +F  +A  F G+VLF+ I+TD++DN R+LEFFG+   D P+ R+I L DDMVK+KP D  +  + +  FVQ  LDGK+KPH+M++E+PEDWDKNPVKVLVG NF  VA+DK+K VFVEFYAPWCGHCKQLAPIWD+LGE +KDN D+V+AKMDST NE+E ++IQSFPT+KYFPKDSDE+VD+ G+RTLE   KF++S 
Sbjct:   53 DVLVLGNDNFDS-VIESTKFILVEFYAPWCGHCKALAPEYAKAAKALKEEGSDIKLGKLDATVETSVAEKFEIRGYPTLKFFRDGKPVEYQGGRTSTEIVNWLKKKTGPPAKALSGVEETKEFIGAQEVAVVGFFKDQESEGAKAFLETAASMDDVVFGITSDDAVFTDLKVEKDN-VVLFKKFDEGRNNFEGELKAEAIKTFIQGNQLPLVVEFTQESAQKIFGGEIKNHILMFINKKAGDFGQKLEEFREAASGFKGKVLFIWIDTDQDDNVRILEFFGLTTADVPAIRLISLGDDMVKYKPADRNMDRDTVKTFVQDFLDGKLKPHLMSEEVPEDWDKNPVKVLVGSNFAEVAKDKTKGVFVEFYAPWCGHCKQLAPIWDKLGEHFKDNADVVVAKMDSTKNELEDIKIQSFPTLKYFPKDSDEVVDYSGERTLEALTKFLESG 497          

HSP 2 Score: 125.176 bits (313), Expect = 3.082e-26
Identity = 62/126 (49.21%), Postives = 83/126 (65.87%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            MK LS++          AD+ EEE VLVL N NF+ VIE  K++LVEFYAPWCGHC++LAPE+ KAA ALK     +K+G +D    +S+ + + I+G+PT+K F   K  P +YQG RT+  IVN
Sbjct:   29 MKVLSVICLAILALTNAADVKEEEDVLVLGNDNFDSVIESTKFILVEFYAPWCGHCKALAPEYAKAAKALKEEGSDIKLGKLDATVETSVAEKFEIRGYPTLKFFRDGK--PVEYQGGRTSTEIVN 152          

HSP 3 Score: 83.1889 bits (204), Expect = 8.105e-13
Identity = 45/93 (48.39%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V VL  SNF EV  +K K V VEFYAPWCGHC+ LAP W K     K    V    MD   +  +   IQ FPT+K F K      DY GERT
Sbjct:  394 VKVLVGSNFAEVAKDKTKGVFVEFYAPWCGHCKQLAPIWDKLGEHFKDNADVVVAKMDSTKNELEDIKIQSFPTLKYFPKDSDEVVDYSGERT 486          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1S3K1I5 (Protein disulfide-isomerase OS=Lingula unguis OX=7574 GN=LOC106177788 PE=3 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 274/447 (61.30%), Postives = 346/447 (77.40%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            DV+ L + NFD  V++S +  LVEF+APWCGHCKALAPEYA AA+ LKE+ S IKL K+DATVE  +A KF+I+GYPTLKFF+DGK ++Y GGRT+  I++WL+KKTGPPA  L  VEE K  I +++V VVGFFKDQ S  AKAF   A S DDVVFG+TS  AVF + KV  D+ +VLFKKFDEGRN+F G    + I+TFI   QLP+V+EF QE+A KIFGG IK H+L FI+KK+  + +   +F  +A  F G+VLF+ I+TD++DN R+LEFFG+   D P+ R+I L DDMVK+KP D  +  + +  FVQ  LDGK+KPH+M++E+PEDWDKNPVKVLVG NF  VA+DK+K VFVEFYAPWCGHCKQLAPIWD+LGE +KDN D+V+AKMDST NE+E ++IQSFPT+KYFPKDSDE+VD+ G+RTLE   KF++S 
Sbjct:   53 DVLVLGNDNFDS-VIESTKFILVEFYAPWCGHCKALAPEYAKAAKALKEEGSDIKLGKLDATVETSVAEKFEIRGYPTLKFFRDGKPVEYQGGRTSTEIVNWLKKKTGPPAKALSGVEETKEFIGAQEVAVVGFFKDQESEGAKAFLETAASMDDVVFGITSDDAVFTDLKVEKDN-VVLFKKFDEGRNNFEGELKAEAIKTFIQGNQLPLVVEFTQESAQKIFGGEIKNHILMFINKKAGDFGQKLEEFREAASGFKGKVLFIWIDTDQDDNVRILEFFGLTTADVPAIRLISLGDDMVKYKPADRNMDRDTVKTFVQDFLDGKLKPHLMSEEVPEDWDKNPVKVLVGSNFAEVAKDKTKGVFVEFYAPWCGHCKQLAPIWDKLGEHFKDNADVVVAKMDSTKNELEDIKIQSFPTLKYFPKDSDEVVDYSGERTLEALTKFLESG 497          

HSP 2 Score: 125.176 bits (313), Expect = 3.409e-26
Identity = 62/126 (49.21%), Postives = 83/126 (65.87%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            MK LS++          AD+ EEE VLVL N NF+ VIE  K++LVEFYAPWCGHC++LAPE+ KAA ALK     +K+G +D    +S+ + + I+G+PT+K F   K  P +YQG RT+  IVN
Sbjct:   29 MKVLSVICLAILALTNAADVKEEEDVLVLGNDNFDSVIESTKFILVEFYAPWCGHCKALAPEYAKAAKALKEEGSDIKLGKLDATVETSVAEKFEIRGYPTLKFFRDGK--PVEYQGGRTSTEIVN 152          

HSP 3 Score: 83.1889 bits (204), Expect = 8.646e-13
Identity = 45/93 (48.39%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V VL  SNF EV  +K K V VEFYAPWCGHC+ LAP W K     K    V    MD   +  +   IQ FPT+K F K      DY GERT
Sbjct:  394 VKVLVGSNFAEVAKDKTKGVFVEFYAPWCGHCKQLAPIWDKLGEHFKDNADVVVAKMDSTKNELEDIKIQSFPTLKYFPKDSDEVVDYSGERT 486          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1S3K0F5 (Protein disulfide-isomerase OS=Lingula unguis OX=7574 GN=LOC106177788 PE=3 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 274/447 (61.30%), Postives = 346/447 (77.40%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            DV+ L + NFD  V++S +  LVEF+APWCGHCKALAPEYA AA+ LKE+ S IKL K+DATVE  +A KF+I+GYPTLKFF+DGK ++Y GGRT+  I++WL+KKTGPPA  L  VEE K  I +++V VVGFFKDQ S  AKAF   A S DDVVFG+TS  AVF + KV  D+ +VLFKKFDEGRN+F G    + I+TFI   QLP+V+EF QE+A KIFGG IK H+L FI+KK+  + +   +F  +A  F G+VLF+ I+TD++DN R+LEFFG+   D P+ R+I L DDMVK+KP D  +  + +  FVQ  LDGK+KPH+M++E+PEDWDKNPVKVLVG NF  VA+DK+K VFVEFYAPWCGHCKQLAPIWD+LGE +KDN D+V+AKMDST NE+E ++IQSFPT+KYFPKDSDE+VD+ G+RTLE   KF++S 
Sbjct:   53 DVLVLGNDNFDS-VIESTKFILVEFYAPWCGHCKALAPEYAKAAKALKEEGSDIKLGKLDATVETSVAEKFEIRGYPTLKFFRDGKPVEYQGGRTSTEIVNWLKKKTGPPAKALSGVEETKEFIGAQEVAVVGFFKDQESEGAKAFLETAASMDDVVFGITSDDAVFTDLKVEKDN-VVLFKKFDEGRNNFEGELKAEAIKTFIQGNQLPLVVEFTQESAQKIFGGEIKNHILMFINKKAGDFGQKLEEFREAASGFKGKVLFIWIDTDQDDNVRILEFFGLTTADVPAIRLISLGDDMVKYKPADRNMDRDTVKTFVQDFLDGKLKPHLMSEEVPEDWDKNPVKVLVGSNFAEVAKDKTKGVFVEFYAPWCGHCKQLAPIWDKLGEHFKDNADVVVAKMDSTKNELEDIKIQSFPTLKYFPKDSDEVVDYSGERTLEALTKFLESG 497          

HSP 2 Score: 125.561 bits (314), Expect = 3.012e-26
Identity = 62/126 (49.21%), Postives = 83/126 (65.87%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            MK LS++          AD+ EEE VLVL N NF+ VIE  K++LVEFYAPWCGHC++LAPE+ KAA ALK     +K+G +D    +S+ + + I+G+PT+K F   K  P +YQG RT+  IVN
Sbjct:   29 MKVLSVICLAILALTNAADVKEEEDVLVLGNDNFDSVIESTKFILVEFYAPWCGHCKALAPEYAKAAKALKEEGSDIKLGKLDATVETSVAEKFEIRGYPTLKFFRDGK--PVEYQGGRTSTEIVN 152          

HSP 3 Score: 83.5741 bits (205), Expect = 7.118e-13
Identity = 45/93 (48.39%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V VL  SNF EV  +K K V VEFYAPWCGHC+ LAP W K     K    V    MD   +  +   IQ FPT+K F K      DY GERT
Sbjct:  394 VKVLVGSNFAEVAKDKTKGVFVEFYAPWCGHCKQLAPIWDKLGEHFKDNADVVVAKMDSTKNELEDIKIQSFPTLKYFPKDSDEVVDYSGERT 486          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A3M7PW31 (Protein disulfide-isomerase OS=Brachionus plicatilis OX=10195 GN=BpHYR1_029450 PE=3 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 262/447 (58.61%), Postives = 338/447 (75.62%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            DV+ LT  NF+E V+ S +  LVEF+APWCGHCKALAPEYA AA KLK ++S I+LAKVDATV+++L  +FKI+GYPTLKFF DG  ++Y GGRT+D II W +KK+GP + T+ SV+E K L    +V+V+G FKD +S  A  + +VA   D   F +TS++AVFDE  V S + +VL KKFDEGRNDF G F  ++I+ FI   QLP+V EFNQETA KIFGG IK H L F SKK++       +F+ +AK F G+V+FV+I++D ++N+RV+EFFG+ K D P+ R+I L  DM KFKP+ + I++  L  FV+  LDGK+KPH++TQ++PEDWD  PVKVLVGKNFD VARDKSK V VEFYAPWCGHCKQLAPI+DQLGE +KD+ + VIAKMDST NE+E ++IQSFPTIK FPKDSD ++DF G+R LE   KF++S+
Sbjct:   25 DVLVLTSDNFEE-VVGSNKFLLVEFYAPWCGHCKALAPEYAKAAGKLKSESSEIRLAKVDATVQSELGERFKIRGYPTLKFFVDGTPLEYTGGRTSDEIIQWCKKKSGPASVTVASVDELKNLQAENEVLVLGLFKDASSEQATVYNNVAKLVDSAAFAITSEQAVFDELNVKSSEGLVLLKKFDEGRNDFEGTFDAEEIKRFIHANQLPLVTEFNQETAQKIFGGDIKVHNLLFASKKADNMEATMNEFKAAAKDFRGKVIFVLIDSDVDENERVMEFFGLKKEDAPTVRLISLGQDMTKFKPESSEITASVLTQFVRDFLDGKLKPHLLTQDVPEDWDAQPVKVLVGKNFDQVARDKSKTVLVEFYAPWCGHCKQLAPIYDQLGEKFKDSAEFVIAKMDSTVNELEDIKIQSFPTIKLFPKDSDAVIDFTGERNLEAMTKFVESH 470          

HSP 2 Score: 110.153 bits (274), Expect = 1.553e-21
Identity = 52/109 (47.71%), Postives = 74/109 (67.89%), Query Frame = 3
Query:  162 ADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            +++ EEE VLVLT+ NF EV+  NK++LVEFYAPWCGHC++LAPE+ KAA  LK     +++  VD    S LG+ + I+G+PT+K F     +P +Y G RT+  I+ 
Sbjct:   18 SEVQEEEDVLVLTSDNFEEVVGSNKFLLVEFYAPWCGHCKALAPEYAKAAGKLKSESSEIRLAKVDATVQSELGERFKIRGYPTLKFFVDG--TPLEYTGGRTSDEIIQ 124          

HSP 3 Score: 77.411 bits (189), Expect = 5.125e-11
Identity = 40/93 (43.01%), Postives = 53/93 (56.99%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V VL   NF++V  +K+K VLVEFYAPWCGHC+ LAP + +     K   +     MD   +  +   IQ FPTIK+F K   +  D+ GER 
Sbjct:  367 VKVLVGKNFDQVARDKSKTVLVEFYAPWCGHCKQLAPIYDQLGEKFKDSAEFVIAKMDSTVNELEDIKIQSFPTIKLFPKDSDAVIDFTGERN 459          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8HRX2 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011389g1 PE=3 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 5.531e-180
Identity = 264/447 (59.06%), Postives = 344/447 (76.96%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXK-DDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSE-KYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 1928
            V+ LT+ NFD   L++ +  LVEF+APWCGHCKALAPEYA AA++LKEKNS IKLAKVDATVE  LA K+ +QGYPT+KFFK+   ++Y GGRTADTIISWLEKK GPP   L SV+ A+  I  K++ V+GFFKD  S +AK++E  A SK +D+  G+     +  EFKV  D +++LFKK D  R  +TGPF   ++  F+   +LP++ EF QETAG IFGG +KKH+L F+ K  E +++ +  Q +  A++F G+ LF+ ++   EDN+R+LEFFG+ K D P+ R I L++DMVK+KP+   I+++NL  FVQSVLDGK+KPH+M+QE+P DWDK PVKVLVGKNF+ VARDK+K V VEFYAPWCGHCKQLAPIWD+LGE YK++ +IVIAKMDSTANEVE V++QSFPTIK+FP +SDE++D+EGDRTLE FKKF++S
Sbjct:   28 VLVLTEKNFDS-ALQANKYILVEFYAPWCGHCKALAPEYAKAAQQLKEKNSEIKLAKVDATVEGKLAEKYGVQGYPTIKFFKEQTPIEYSGGRTADTIISWLEKKLGPPTQRLDSVDAAQKFINDKEITVIGFFKDTTSDSAKSYEDAAFSKLEDIPCGMADSADIMAEFKVDQD-TVMLFKKTDGARIPYTGPFTADEVAKFVKNNKLPLINEFTQETAGDIFGGDVKKHLLVFLKKSDEAQFSNIMDQLKAPAEQFKGKALFIYVDIGVEDNERILEFFGLKKEDCPAVRFIALDEDMVKYKPEFTDITADNLAQFVQSVLDGKLKPHLMSQEVPADWDKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGHCKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEIIDYEGDRTLEGFKKFLES 472          

HSP 2 Score: 125.176 bits (313), Expect = 1.895e-26
Identity = 64/129 (49.61%), Postives = 84/129 (65.12%), Query Frame = 3
Query:  132 LFCFALAQCNA----DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKEL 497
            L  F+L  C A     ITEEEGVLVLT  NF+  ++ NKY+LVEFYAPWCGHC++LAPE+ KAA  LK     +K+  VD      L + YG+QG+PTIK F   + +P +Y G RTA +I++   K+L
Sbjct:    6 LALFSLVACVAFADEAITEEEGVLVLTEKNFDSALQANKYILVEFYAPWCGHCKALAPEYAKAAQQLKEKNSEIKLAKVDATVEGKLAEKYGVQGYPTIKFF--KEQTPIEYSGGRTADTIISWLEKKL 132          

HSP 3 Score: 85.5001 bits (210), Expect = 1.365e-13
Identity = 44/97 (45.36%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  174 EEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            ++E V VL   NFNEV  +K K VLVEFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +Q FPTIK F  +     DY+G+RT
Sbjct:  366 DKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGHCKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEIIDYEGDRT 462          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:103023413])

HSP 1 Score: 504.982 bits (1299), Expect = 9.997e-172
Identity = 249/451 (55.21%), Postives = 335/451 (74.28%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK---VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFIDSN 1931
            DV+ L  SNF+E  LK+    LVEF+APWCGHCKALAPEYA AA  LK + S I+L KVDAT E DLA +F ++GYPT+KFFK G+     +Y  GR AD I++WL+K+TGP AA L  V +A++LI   +V V+GFFKD  S  AKAF   A++ DD+ FG++S  AVF +F+V+ +DS+VLFKKFDEGRN F G    + + +FI   QLP+VIEF ++TA KIFGG IK H+L F+ K S+ + +    F  +A+ F G++LF+ I++D +DN R+LEFFG+ K + P+ R+I LED+M K+KP+ + I++EN+  F  +  +GK+KPH+M+Q+IPEDWDK PVK LVGKNF+ V  D +K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ D+VIAKMDSTANE+E V++ SFPT+K+FP  +  +++D+ G+RTL+ F KF++S 
Sbjct:   23 DVLVLNKSNFEE-ALKAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSDIRLGKVDATEEADLAQEFGVRGYPTIKFFKGGEKSSPKEYSAGRQADDIVNWLKKRTGPAAAALTEVTQAESLIADNEVAVIGFFKDVESDGAKAFIKAAEAVDDIPFGISSDDAVFSKFEVT-EDSVVLFKKFDEGRNTFDGELSKEGLLSFIKANQLPLVIEFTEQTAPKIFGGEIKSHILLFVPKASKDFQDKMDNFRKAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPALRLITLEDEMTKYKPEASEITAENIITFCTAFTEGKLKPHLMSQDIPEDWDKTPVKTLVGKNFEEVVFDPTKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDSKDVVIAKMDSTANEIEAVKVHSFPTLKFFPAGEEHKIIDYSGERTLDGFTKFLESG 471          

HSP 2 Score: 124.02 bits (310), Expect = 2.149e-29
Identity = 60/124 (48.39%), Postives = 81/124 (65.32%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L +VL C       A+++EEE VLVL  SNF E ++ +  +LVEFYAPWCGHC++LAPE+ KAA  LK     +++G VD  + + L Q +G++G+PTIK F G  K SPK+Y   R A  IVN
Sbjct:    2 LKLVLLCALAVFATAELSEEEDVLVLNKSNFEEALKAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSDIRLGKVDATEEADLAQEFGVRGYPTIKFFKGGEKSSPKEYSAGRQADDIVN 125          

HSP 3 Score: 76.2554 bits (186), Expect = 5.592e-14
Identity = 46/125 (36.80%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  123 SIVLFCFALAQ-------CNADITEE---EGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERT 461
            +I+ FC A  +        + DI E+     V  L   NF EV+ +  K V VEFYAPWCGHC+ LAP W +     K    V    MD  ++  +   +  FPT+K F    +H   DY GERT
Sbjct:  336 NIITFCTAFTEGKLKPHLMSQDIPEDWDKTPVKTLVGKNFEEVVFDPTKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDSKDVVIAKMDSTANEIEAVKVHSFPTLKFFPAGEEHKIIDYSGERT 460          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 429.483 bits (1103), Expect = 1.484e-141
Identity = 226/454 (49.78%), Postives = 313/454 (68.94%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK---VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPF---VDKD-IRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSD-EMVDFEGDRTLETFKKFIDS 1928
            DV+ L   NFD   L   +  LVEF+APWC HC+ L P Y+  A +LK ++S I+LAKVDAT E +LA +F I G+PTLKFFK+G+     D+ G RT   I  WL+++  PPA  LK+ ++A+ L+++ DVVVVGFF D     AK F SVA     + FG+TS   +F ++ V+ D S+VLFKKFD+ R D + P    +DKD + TFI    L ++I F++E A KIF   +  H+L FI+   E +  L   +  +A +F G+VLF+ I+ +EE +  V+++FG++ +DTP  R I   D + K+  ++ TI+ + L  F Q VLDGK+KPH+M+QEIPEDW+KNPVKVLVGKNF+ +A D+SK VFVEFYAPWCGHCK+LAP+W++LGE YKD+ DI+IA MDSTANEVEGV +Q FPT+K+FP  ++ ++VD+ G R LETF KF+D+
Sbjct:   54 DVLVLHSVNFDR-ALSESKYLLVEFYAPWCSHCRMLEPVYSQVARQLKNESSPIRLAKVDATEEKELAEEFGIDGFPTLKFFKEGRRQNATDFTGKRTEKGIKLWLQRQVEPPATVLKNTKDAQELLDAHDVVVVGFFDDLNGEEAKVFYSVAVDMVSLNFGITSSPELFKKYNVNKD-SVVLFKKFDDKRADISLPEDGKLDKDNLVTFIQNNSLELIITFSEENADKIFSSKVHNHILLFINTTIESHNALLDDYRAAAVEFKGKVLFIKIDVNEEVS-HVMKYFGISASDTPVLRFINT-DTVKKYAMEEETINKDTLKTFCQGVLDGKIKPHLMSQEIPEDWNKNPVKVLVGKNFEHIAFDESKNVFVEFYAPWCGHCKELAPVWEKLGEKYKDHEDIIIANMDSTANEVEGVTVQGFPTLKFFPAGTERKIVDYNGKRDLETFSKFLDN 503          

HSP 2 Score: 86.2705 bits (212), Expect = 3.668e-17
Identity = 40/100 (40.00%), Postives = 61/100 (61.00%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKS-KHSPKDYQGERTAGSI 473
            VLVL + NF+  + ++KY+LVEFYAPWC HC+ L P + + A  LK     +++  VD  +   L + +GI GFPT+K F +  + +  D+ G+RT   I
Sbjct:   55 VLVLHSVNFDRALSESKYLLVEFYAPWCSHCRMLEPVYSQVARQLKNESSPIRLAKVDATEEKELAEEFGIDGFPTLKFFKEGRRQNATDFTGKRTEKGI 154          

HSP 3 Score: 73.9442 bits (180), Expect = 2.821e-13
Identity = 37/93 (39.78%), Postives = 53/93 (56.99%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGER 458
            V VL   NF  +  +++K V VEFYAPWCGHC+ LAP W+K     K    +   +MD  ++  +   +QGFPT+K F   ++    DY G+R
Sbjct:  400 VKVLVGKNFEHIAFDESKNVFVEFYAPWCGHCKELAPVWEKLGEKYKDHEDIIIANMDSTANEVEGVTVQGFPTLKFFPAGTERKIVDYNGKR 492          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:103026638])

HSP 1 Score: 326.25 bits (835), Expect = 6.420e-101
Identity = 212/613 (34.58%), Postives = 333/613 (54.32%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALI-ESKDVVVVGFF-KDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLF-KKFDEGRNDFTGPFVDKD------IRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIIN--------TDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEV--EGVRIQSFPTIKYFPKDSDEM-VDFE-GDRTLETFKKFIDSN 1931
            ++ EE GVLVLT++NF+  +E    VLVEFYAPWCGHC+  APE++K A  LK     + V  VD  K ++LG  + + G+PTIKI  K +  P +Y G+R+  +IV    + + E+ +                            + LT  NFD+ V+ + +  LVEF+APWCGHCK LAPEY  AA++L  +   I LAKVDATVENDLAS+F + GYPTLK F+ GKV DY G R    I+ ++ ++ GPP+  ++++++ + L+ +  D ++VG F  ++ +      E+    +DD  F  T    +    K S    ++L  +KF       +  F  KD      ++ F  K+ LP+V    Q    K +  + +  V+ +         +    +  + + +  +VL V ++         DEED    L+  G++++      +  L +   K+  +     +E L  FV +   GK+KP + +Q +P+  +K PVKV+VGK FD +  DK K V +EFYAPWCGHCK+L P +  L + YK+  ++VIAKMD+TAN+V  +  +++ FPTI + P ++ +  + FE G+R +E F KFI+ +
Sbjct:   56 EVKEENGVLVLTDANFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQVLKESDPPIPVAKVDATKATALGSRFEVSGYPTIKILKKGE--PVEYDGDRSEKAIV----ERVKEVAQPDWKPPPEA------------------TLVLTKDNFDD-VVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPILLAKVDATVENDLASRFDVTGYPTLKMFRKGKVFDYNGPREKIGIVDYMSEQAGPPSKQVQALKQIQELLKDGDDALIVGVFSSEEDAVYEIYQEACNTLRDDYKFRHTFSSEIVKFLKASPGQVVMLQPEKFRSKHEPSSYSFTIKDSTSASELQDFFKKHTLPLVGHRKQSNDAKRY--TKRPLVVVYYG------VDFSFDYRVATQFWRSKVLEVAMDFPEYTFAIADEEDYADELKSLGLSESGE-EVNVAILGEGGKKYAMEPEEFDTEVLREFVVAFKKGKLKPIIKSQPVPK--NKGPVKVIVGKTFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGERNVEGFSKFIEEH 632          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 268.47 bits (685), Expect = 1.359e-80
Identity = 151/451 (33.48%), Postives = 256/451 (56.76%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRN-DFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFIDS 1928
            DV+ LT+SNF+   LK     LV F+AP  G       E+A AA +LKE NS +KL  +D + + DLA    +   P+++ +  G   +       +++ +IISWL+++ GP A  +K + + +      D+V++G FKD    A K F  VA    D+ FGVT  + VF ++   +++S++L +K     + + T   V  D+  FI  +++P+V E+N +T+ KI    ++ H++ F+ K  + + +    F+++AK+F G+VLFV+I++ E  N R++E+F + K D P  RM+ L D      P D  +  +    F++S L GK K  + ++ +P+ WDK PVK LVG NF+ VA +  K V + FY+PW    + L P+W+ L E + D+ D+V+A++D TAN+V    +  +P IK FP   ++ +V + G+  LE   +F+++
Sbjct:   34 DVLVLTESNFNR-ALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYLSGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKYG-RTENSVLLLRKSKMAEHFEMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLIDSGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSFQYQLPSD-LMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVSYSGEAKLEPIVEFVNA 481          

HSP 2 Score: 63.1586 bits (152), Expect = 6.584e-10
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 3
Query:  132 LFCFALAQCNAD-ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L C  L++ N + I E++ VLVLT SNFN  ++ +  +LV FYAP  G       E+ +AA+ LK     VK+G +D+ K   L +   +   P+++++    K++P      +++ SI++
Sbjct:   16 LMCGTLSKKNDEPIQEDKDVLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYLSGDKYNPVYCPVLKSSASIIS 136          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 268.47 bits (685), Expect = 1.449e-80
Identity = 151/451 (33.48%), Postives = 256/451 (56.76%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRN-DFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFIDS 1928
            DV+ LT+SNF+   LK     LV F+AP  G       E+A AA +LKE NS +KL  +D + + DLA    +   P+++ +  G   +       +++ +IISWL+++ GP A  +K + + +      D+V++G FKD    A K F  VA    D+ FGVT  + VF ++   +++S++L +K     + + T   V  D+  FI  +++P+V E+N +T+ KI    ++ H++ F+ K  + + +    F+++AK+F G+VLFV+I++ E  N R++E+F + K D P  RM+ L D      P D  +  +    F++S L GK K  + ++ +P+ WDK PVK LVG NF+ VA +  K V + FY+PW    + L P+W+ L E + D+ D+V+A++D TAN+V    +  +P IK FP   ++ +V + G+  LE   +F+++
Sbjct:   31 DVLVLTESNFNR-ALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYLSGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKYG-RTENSVLLLRKSKMAEHFEMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLIDSGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSFQYQLPSD-LMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVSYSGEAKLEPIVEFVNA 478          

HSP 2 Score: 62.3882 bits (150), Expect = 1.229e-9
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 3
Query:  132 LFCFALAQCNAD-ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L C  L++ N + I E++ VLVLT SNFN  ++ +  +LV FYAP  G       E+ +AA+ LK     VK+G +D+ K   L +   +   P+++++    K++P      +++ SI++
Sbjct:   13 LMCGTLSKKNDEPIQEDKDVLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVPSVRLYLSGDKYNPVYCPVLKSSASIIS 133          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002052.1 (pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 gene:ENSPMAG00000001848.1 transcript:ENSPMAT00000002052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 310.842 bits (795), Expect = 1.187e-98
Identity = 168/402 (41.79%), Postives = 240/402 (59.70%), Query Frame = 3
Query:  678 CGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPI-----VIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAK-TDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFP 1856
            C  C  L P+ A   E L+E+ + ++L  +D      LA++F +  YP    F  G   K   Y   R A+ +  W  ++ GPPA T+ +  EA+A ++S  +V++GFFKD  S   K F  +AD+ D+V FGVTS + VF ++ VS+D SIVLFKKFDEG+  FT   +D + R  I  +   +     +     +T   +F G +  H+L F +  SE + EL  QF+ +A  F G++LFV++N+   +ND VL+ F +      P+ R++++  DMVK  P  +  ++ N+  F Q  LD   KP   +QEIP+DW+K PVKVLVGKNFD    D++K VFVEFYA WC HCK+LAP+W+QLG  YKD+ +IVIAKMD+  NEV  V I  +P IKYFP
Sbjct:    1 CEQCSELPPKLARTVELLRERGAPVRLGSLDGETHATLATEFDVSHYPDFLLFDPGSRAKPRHYHAQREAEALAKWATRRAGPPAVTVATTAEAQAFVDSDSLVLLGFFKDTESRDLKTFLEIADTYDEVPFGVTSSEEVFAKYGVSTD-SIVLFKKFDEGQKSFTP--IDLNFRHGIKSHTAVVHGCECLCGCTVQTFPLLFSGLVNVHILLFANASSEGFPELFEQFKAAAPPFRGKILFVLLNSAVPENDNVLDLFELTDGARLPAIRLVKVNKDMVKHVPSFSDFTTANITSFCQDYLDEHNKPFSKSQEIPKDWNKRPVKVLVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQLGVQYKDHDNIVIAKMDAEKNEVAAVHIPGYPKIKYFP 399          

HSP 2 Score: 61.2326 bits (147), Expect = 4.133e-10
Identity = 32/81 (39.51%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG 845
            L   NFDE V    +   VEF+A WC HCK LAP +     + K+ ++I+ +AK+DA  E +  +   I GYP +K+F  G
Sbjct:  324 LVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQLGVQYKDHDNIV-IAKMDA--EKNEVAAVHIPGYPKIKYFPAG 401          

HSP 3 Score: 57.3806 bits (137), Expect = 6.949e-9
Identity = 31/78 (39.74%), Postives = 40/78 (51.28%), Query Frame = 3
Query:  186 VLVLTNSNFNE-VIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 416
            V VL   NF+E V ++ K V VEFYA WC HC+ LAP W++     K    +    MD   +      I G+P IK F
Sbjct:  321 VKVLVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQLGVQYKDHDNIVIAKMDAEKNEVAAVHIPGYPKIKYF 398          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 303.523 bits (776), Expect = 4.054e-93
Identity = 207/612 (33.82%), Postives = 321/612 (52.45%), Query Frame = 3
Query:  168 ITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIES-KDVVVVGFFKD-QXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVL----FKKFDEGRN---DFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVL--------FVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEV--EGVRIQSFPTIKYFPKDS-DEMVDF-EGDRTLETFKKFIDSN 1931
            + EE GVL+L + NF+  +     VL+EFYAPWCGHC+  A E++K A  L      + V  VD      L + + + G+PTIKI  K +    DY G+RT  +I+ A +KE+                     +S         V+ LT+SNFDE+V    +  LVEF+APWCGHCK LAPEY  AA++L +    I LAKVDATVE++L  +F + GYPTLK F+ GK  DY G R    I+S + ++ GP +  LKS+++    +++  DVV++G FK+ Q  A     E+  + +++  F  T ++ + +  K      +VL    F+   E +    D      D D++ F++K+ +P+V +       K +  S +  V+ F         +    + T+ + +  +VL        F      E+D  + L   G+A++       I L+    K+        ++ L  FV S   GK+K  + +Q +P+  +K PVKV+VG+ F+ +  D SK V +EFYAPWCGHCK L PI+  LG+ YK +  +VIAKMD+T N++  +  + + FPTI + P  + D  + F +G R LE+  KFI+ +
Sbjct:   52 VKEENGVLILKDLNFDFFVAGKDTVLLEFYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDATVAVHLAERFSVSGYPTIKILKKGQAV--DYDGDRTQDAII-AKVKEV---------------------ASPDWKPPPEAVLTLTESNFDEIV-NDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFRKGKAYDYNGPREQYGIVSHMIEQAGPASQELKSMKQLNGFVQNGDDVVILGVFKNEQDVALQLFQETGNNVREEFKFYHTFEENIKNHLKAVDGQVVVLHPERFQSKYEPKQFTFDIQADSTDSDLKAFVEKHSVPLVGQRKPSNEAKRY-ASRRPLVVVFYG------VDFSFDYRTATQFWRSKVLEVAKDFPKFTFAIASEDDYSKELSDLGLAESGEEVNAAI-LDASGKKYAMAPEEFDADVLRDFVISFEKGKLKAVVKSQPLPKS-NKGPVKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTIYFSPSGAKDRPIKFADGSRDLESLSKFIEKH 629          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 245.358 bits (625), Expect = 7.896e-73
Identity = 166/460 (36.09%), Postives = 253/460 (55.00%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVM-DYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXX-XXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFK------KFDEGRNDFT-GPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAEL-KGQFETSAKKFL--GQVLFVIINTDEEDNDRVLEFFGMAKT--DTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEG-VRIQSFPTIKYFPKDS-DEMVDFEGDRTLETFKKFI 1922
            DV++LTD++F   V    +  LVEFFAPWCGHCK LAPEY  AA KLK   + + LAKVD T   +  +KF + GYPTLK F+DG++  DY G RTAD I+ +L+K+ GP +  LK+VE+ +  +   D  +VGFFKD +S A     +  +  +D+  F  ++ +AV D  K  ++++IV+F+      KF+E +  +    +    I+ FI    L I      +      G  +          K+ K +   + +    AKKF+  G  L   I  + +D  + L  +G+     D P   + +   D    + ++ T   ++L  F+Q   DGK+K H+ ++ IPED D  PVKV+V + FD +  D+SK V +EFYAPWCGHCK L P + +L +  K++ +I+IAKMD+TAN+V     ++ FPTI + P  S D    +EG R +  F  ++
Sbjct:   26 DVLDLTDADFASKV-AGHDMVLVEFFAPWCGHCKRLAPEYEKAATKLK---NTVALAKVDCTANTETCNKFGVSGYPTLKIFRDGELSSDYDGPRTADGIVGFLKKQAGPSSVELKTVEDLEKFVGDNDPSIVGFFKDASSDAQTEFMKVASSQRDNYRFAHSNVQAVLD--KQGAEEAIVVFRPLRLASKFEETQVTYAEDSYSSAKIKAFIQDNILGICPHLTDDNKDLFKGKDLLVAYYDVDYTKNPKGSNYWRNRVMKVAKKFIEEGHTLSYAI-ANHKDFGQQLSDYGLEHVSGDVPVVAIKKSNGDKYILR-EEFTRDGKSLENFLQDYFDGKLKKHLKSEPIPEDND-GPVKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKLKNDPNILIAKMDATANDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYL 476          

HSP 2 Score: 95.9005 bits (237), Expect = 6.200e-21
Identity = 46/97 (47.42%), Postives = 62/97 (63.92%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            VL LT+++F   +  +  VLVEF+APWCGHC+ LAPE++KAAT LK  V +  VD    +     +G+ G+PT+KIF   + S  DY G RTA  IV
Sbjct:   27 VLDLTDADFASKVAGHDMVLVEFFAPWCGHCKRLAPEYEKAATKLKNTVALAKVDCTANTETCNKFGVSGYPTLKIFRDGELS-SDYDGPRTADGIV 122          

HSP 3 Score: 68.9366 bits (167), Expect = 1.873e-12
Identity = 39/106 (36.79%), Postives = 62/106 (58.49%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS-LGQPYGIQGFPTIKIFGK-SKHSPKDYQGERTAGSIVNAALKE 494
            V V+    F+E++ +++K VL+EFYAPWCGHC++L P++ + A  LK    +    MD  ++ +   Y ++GFPTI      SK SPK Y+G R     ++   +E
Sbjct:  374 VKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKLKNDPNILIAKMDATANDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYLKRE 479          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia6 (protein disulfide isomerase family A, member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-879])

HSP 1 Score: 230.335 bits (586), Expect = 5.566e-68
Identity = 124/268 (46.27%), Postives = 174/268 (64.93%), Query Frame = 3
Query:  108 KMKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXX-XXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLK-EKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG--KVMDYGGGRTADTIISW 896
            ++K    ++    +A   A  +  + V+ LT SNFN EV++ N   LVEFYAPWCGHCQ L PEWKKAATALKG+VK+GAVD D++  LG  Y ++GFPTIKIFG +K+ P+D+ G RT   IV+ AL  L  LV+ RLGG  G  S  +  ++  G+       V  +    +++     E W+VEFFAPWCGHCK L PE+A+AA ++K + N  +KLA VDATV  +L+++F I+G+PT+K F+ G  +  +Y GGRT   I+++
Sbjct:    1 EVKVFGALVLGVLVAGAQALYSPSDDVIELTASNFNREVVQSNDLWLVEFYAPWCGHCQRLIPEWKKAATALKGIVKLGAVDADEHKGLGSTYNVRGFPTIKIFGINKNKPEDFNGGRTTQGIVDGALGALRSLVKDRLGGKGGSDSGKQNINTFSGNGFCKRKPVSFSIITTNKITFTPSETWIVEFFAPWCGHCKKLEPEWAAAATEVKAQTNGRVKLAAVDATVNQELSNRFGIRGFPTIKVFRKGEDEPQEYQGGRTKSDIVAY 268          

HSP 2 Score: 94.3597 bits (233), Expect = 1.273e-20
Identity = 45/87 (51.72%), Postives = 57/87 (65.52%), Query Frame = 3
Query:  243 LVEFYAPWCGHCQSLAPEWKKAATALK----GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALK 491
            +VEF+APWCGHC+ L PEW  AAT +K    G VK+ AVD      L   +GI+GFPTIK+F K +  P++YQG RT   IV  AL+
Sbjct:  185 IVEFFAPWCGHCKKLEPEWAAAATEVKAQTNGRVKLAAVDATVNQELSNRFGIRGFPTIKVFRKGEDEPQEYQGGRTKSDIVAYALE 271          

HSP 3 Score: 69.3218 bits (168), Expect = 1.361e-12
Identity = 35/81 (43.21%), Postives = 48/81 (59.26%), Query Frame = 3
Query: 1668 SKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTD--IVIAKMDSTANEVEGVR--IQSFPTIKYFPKDSDEMVDFEGDRT 1898
            S+   VEF+APWCGHCK+L P W       K  T+  + +A +D+T N+    R  I+ FPTIK F K  DE  +++G RT
Sbjct:  181 SETWIVEFFAPWCGHCKKLEPEWAAAATEVKAQTNGRVKLAAVDATVNQELSNRFGIRGFPTIKVFRKGEDEPQEYQGGRT 261          

HSP 4 Score: 62.7734 bits (151), Expect = 1.369e-10
Identity = 30/92 (32.61%), Postives = 42/92 (45.65%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLE 1904
            L   NF+      +    VEFYAPWCGHC++L P W +     K    +     D          ++ FPTIK F  + ++  DF G RT +
Sbjct:   30 LTASNFNREVVQSNDLWLVEFYAPWCGHCQRLIPEWKKAATALKGIVKLGAVDADEHKGLGSTYNVRGFPTIKIFGINKNKPEDFNGGRTTQ 121          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 185.652 bits (470), Expect = 1.317e-54
Identity = 96/194 (49.48%), Postives = 128/194 (65.98%), Query Frame = 3
Query:  669 APWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQ 1241
            APWCGHCKAL PE+A AA  LK + S I+L KVDAT E +LA ++ ++GYPT+KFFKDG      +Y  GR AD I++WL+K+TGP A TL         IES +VVVVGFFKD  +  AK F   AD  DD+ FG+ S    F +++VS  + ++LFKKFDEGRN + G    + +R F+   +LP++IEF +
Sbjct:    1 APWCGHCKALGPEFAKAAGTLKAEGSAIRLGKVDATEETELAKEYGVRGYPTIKFFKDGDAKNAKEYAAGRQADDIVNWLKKRTGPSATTLDDAAATAKFIESAEVVVVGFFKDVEAEDAKVFLKAADGIDDIAFGLASSDDAFTQYEVSK-EGVILFKKFDEGRNVYEGELSKEGLRKFVKSNELPLLIEFTE 193          

HSP 2 Score: 74.7146 bits (182), Expect = 1.123e-15
Identity = 36/79 (45.57%), Postives = 52/79 (65.82%), Query Frame = 3
Query:  258 APWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIF--GKSKHSPKDYQGERTAGSIVN 479
            APWCGHC++L PE+ KAA  LK     +++G VD  + + L + YG++G+PTIK F  G +K++ K+Y   R A  IVN
Sbjct:    1 APWCGHCKALGPEFAKAAGTLKAEGSAIRLGKVDATEETELAKEYGVRGYPTIKFFKDGDAKNA-KEYAAGRQADDIVN 78          

HSP 3 Score: 48.521 bits (114), Expect = 1.212e-6
Identity = 26/62 (41.94%), Postives = 38/62 (61.29%), Query Frame = 3
Query: 1695 APWCGHCKQLAPIWDQLGETYK-DNTDIVIAKMDSTANEVEGVR---IQSFPTIKYFPKDSD 1868
            APWCGHCK L P + +   T K + + I + K+D+T  E E  +   ++ +PTIK+F KD D
Sbjct:    1 APWCGHCKALGPEFAKAAGTLKAEGSAIRLGKVDAT-EETELAKEYGVRGYPTIKFF-KDGD 60          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 201.445 bits (511), Expect = 7.623e-57
Identity = 159/464 (34.27%), Postives = 239/464 (51.51%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKV---MDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEG--RNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHV-LSFI-SKKSEKYAELKGQFETSAKKFLGQVLFVIINTD----EEDNDRVLEFFGMAK----TDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNT-DIVIAKMDSTANEVEGVRIQSFPTIKYFP--KDSDEMVDFEGDRTLETFKKFIDSN 1931
            VV+L   +F+E + +S +  L EFFAPWCGHCK +APEY  AAE L EKN  I LA++D T   DL  +  I G+P+LK FK+  V   +DY G RTA+ I+ ++ K++ P  A +  +    A       V+V   K  A   A  +       +D  F V+++ A  D+FK+S    I L    DE    N       D D+    +K+     + +  E  G +F   ++  + L ++     E+  E K  F   AKK  G + FV I+         N  + E F +      T+   + + QL ++      D   + S+ +   V+  L G   P + +QEI E+ D + V  LVGKN D +  D  K V V +YAPWCGHCK+LAP + +L +TY + T D++IAK+D T N+V GV I+ +PTI  +P  K S+ +V ++G R+L++   FI  N
Sbjct:   34 VVKLATDSFNEYI-QSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN--ITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDF-VSAENAD-DDFKLS----IYLPSAMDEPVVYNGKKADIADADV---FEKWLQVEALPYFGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGRHAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGDASPIVKSQEIFENQDSS-VFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVV-YQGSRSLDSLFDFIKEN 483          

HSP 2 Score: 92.4337 bits (228), Expect = 4.839e-20
Identity = 47/118 (39.83%), Postives = 72/118 (61.02%), Query Frame = 3
Query:  147 LAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAA-TALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK-HSPKDYQGERTAGSIVNAALKE 494
             AQ  A   E+  V+ L   +FNE I+ +  VL EF+APWCGHC+++APE+ KAA T ++  + +  +D  +   L   + I GFP++KIF  S  ++  DY+G RTA +IV   +K+
Sbjct:   21 FAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQ 138          

HSP 3 Score: 61.6178 bits (148), Expect = 2.453e-10
Identity = 35/104 (33.65%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  171 TEEEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAA-TALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSI 473
             ++  V  L   N +E++ +  K VLV +YAPWCGHC+ LAP +++ A T       V    +D   +  +   I+G+PTI ++ G  K     YQG R+  S+
Sbjct:  373 NQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSL 476          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 112.849 bits (281), Expect = 1.128e-26
Identity = 118/466 (25.32%), Postives = 212/466 (45.49%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKS-EKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDM---VKFKPDDATISSE-----NLNLFVQSVLD---GKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLG------ETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPK-DSDEMVDFEGDRTLETFKKFI 1922
            D++ LT+  F   + +S    LVEFFAPWC H + L P    AA  LKE N  + + ++D    + +  +  I  YPTLK FK+G++ D   Y G +  D I  ++ +        L S +E +  +E+  + VV               ++  ++D V   +   +       + +    +LF   D   +   G  V   +  ++    LP   +   +   K    ++      + S++  E Y +L  Q     K+  GQ+ F+ +N+    +   + F  M +   P F +  + +++   +   P++     E     + ++ VQ V D   G  KP + ++EIP++   N  K+ VGK  D +  D  K V V++YA WC H K+ API++++       E+ +D   I+IA++DS AN++    +  +PTI  +P  ++ + + F   R LE   +FI
Sbjct:   34 DLLVLTEKKFKSFI-ESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHN--VPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDGQVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEVALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILF---DGNVDSLVGNSVA--LTQWLKVVILPYFTDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQL---GKENRGQINFIALNSTMFPHH--VRFLNM-REQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTAKPIVKSEEIPKEQKSNVYKI-VGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIANVLASDESVRDK--ILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFEFI 482          

HSP 2 Score: 73.1738 bits (178), Expect = 6.505e-14
Identity = 43/107 (40.19%), Postives = 58/107 (54.21%), Query Frame = 3
Query:  123 SIVLFC----FALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK-GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSK 428
            +IV FC    F LA+ +A  T    +LVLT   F   IE +  VLVEF+APWC H Q L P  ++AA+ LK   V V  +D +  S +     I  +PT+KIF   +
Sbjct:   10 AIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGR 116          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: MPD1 (Member of the protein disulfide isomerase (PDI) family; interacts with and inhibits the chaperone activity of Cne1p; MPD1 overexpression in a pdi1 null mutant suppresses defects in Pdi1p functions such as carboxypeptidase Y maturation [Source:SGD;Acc:S000005814])

HSP 1 Score: 86.2705 bits (212), Expect = 9.315e-19
Identity = 47/125 (37.60%), Postives = 67/125 (53.60%), Query Frame = 3
Query:  195 LTNSNFNEVIEKNKYV-LVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAV--DMDKYSSLGQPYGIQGFPTIKIFGKSK----------------HSPKDYQGERTAGSIVNAALKELDELVR 512
            LT  +F++ I    Y  LVEFYAPWCGHC+ L+  ++KAA  L GVV+V AV  D++K  +L   Y + GFPT+ +F   K                H+ + Y G RT   IV+ +L  +   V+
Sbjct:   34 LTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVK 158          

HSP 2 Score: 69.3218 bits (168), Expect = 3.260e-13
Identity = 31/88 (35.23%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVEND--LASKFKIQGYPTLKFFKDGKV 851
            + ELT  +FD+ +  +    LVEF+APWCGHCK L+  +  AA++L   + ++++A V+  +  +  L +K+ + G+PTL  F+  K+
Sbjct:   31 ISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRL---DGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKI 115          

HSP 3 Score: 51.9878 bits (123), Expect = 1.799e-7
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query: 1605 WDKNP-VKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYF 1853
            +D +P +  L  K+FD    + +    VEFYAPWCGHCK+L+  + +  +       +     D   N+    +  +  FPT+  F
Sbjct:   25 YDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVF 110          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: TRX2 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx1p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases under DNA replication stress; TRX2 has a paralog, TRX1, that arose from the whole genome duplication [Source:SGD;Acc:S000003441])

HSP 1 Score: 54.6842 bits (130), Expect = 1.070e-9
Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  612 SNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK 848
            S +D  +   ++  +V+FFA WCG CK +AP      EK  E+ S     K+D    +D+A K ++   PTL F+K GK
Sbjct:    9 SEYDSALASGDKLVVVDFFATWCGPCKMIAPMI----EKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGK 83          

HSP 2 Score: 47.7506 bits (112), Expect = 2.798e-7
Identity = 21/73 (28.77%), Postives = 37/73 (50.68%), Query Frame = 3
Query: 1635 GKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYF 1853
               +DS      K V V+F+A WCG CK +AP+ ++  E Y D     +  +D  ++  +   + S PT+ ++
Sbjct:    8 ASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKL-DVDEVSDVAQKAEVSSMPTLIFY 79          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 49.6766 bits (117), Expect = 5.984e-8
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  606 TDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK 848
            T S FD  + + ++  +V+F+A WCG CK +AP      EK  E+       K+D     D+A K ++   PTL  FK+GK
Sbjct:    7 TASEFDSAIAQ-DKLVVVDFYATWCGPCKMIAPMI----EKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGK 82          

HSP 2 Score: 47.3654 bits (111), Expect = 3.519e-7
Identity = 25/81 (30.86%), Postives = 41/81 (50.62%), Query Frame = 3
Query:  198 TNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPK 440
            T S F+  I ++K V+V+FYA WCG C+ +AP  +K +           +D+D+   + Q   +   PT+ +F   K   K
Sbjct:    7 TASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQ-ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAK 86          

HSP 3 Score: 45.0542 bits (105), Expect = 2.417e-6
Identity = 25/71 (35.21%), Postives = 38/71 (53.52%), Query Frame = 3
Query: 1644 FDS-VARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYF 1853
            FDS +A+DK   V V+FYA WCG CK +AP+ ++  E Y    D     +D   +  +   + + PT+  F
Sbjct:   11 FDSAIAQDK--LVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLF 78          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO36830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH5])

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 273/447 (61.07%), Postives = 333/447 (74.50%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQL-EDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 1928
            DV+ LT+ NFDE V  ++   LVEF+APWCGHCKALAPEYA AA +LK + S IKLAKVDAT E  L  KF++QGYPT+KFFKDGK  +Y GGRTA  I+SWL KKTGPPA  L + +  K  I +K+V VVGFF D+ S AAKAF S AD  DDV FG+ S KA+  E KV  D  IVLFKKFDEGRND+ G +  + I+ F+   QLP+V EF+ ETA KIFGG +K H+L F +K S+ +      F   AK F G+VLFV +NT+ EDN R++EFFG+  ++ P+ R+I L +DDM K+KP  A I+SEN+  FVQ+ LD K+KPH+++ EIPEDWD  PVKVL GKNFD VAR+K K VFVEFYAPWCGHCKQLAPIWDQLGE YKD+ DIV+AKMDSTANEVEGV++ SFPTIKYFPK+  E VD+ G RTL+ F KF++S
Sbjct:   25 DVLVLTEKNFDEAVAANKH-VLVEFYAPWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPPAKDLATADAMKDFI-TKEVAVVGFFTDKESDAAKAFLSAADGIDDVEFGIVSDKAIASEHKVEGD-KIVLFKKFDEGRNDYDGEYDFEKIQQFVKANQLPLVTEFSDETAPKIFGGDVKHHILLFTNKTSDGFKATHEAFTGGAKDFKGKVLFVYVNTEVEDNQRIVEFFGIQSSELPTIRLINLADDDMTKYKPTAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHADIVVAKMDSTANEVEGVKVHSFPTIKYFPKEG-EAVDYNGGRTLDDFVKFLES 467          

HSP 2 Score: 114.775 bits (286), Expect = 6.392e-27
Identity = 57/108 (52.78%), Postives = 73/108 (67.59%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            +I EEE VLVLT  NF+E +  NK+VLVEFYAPWCGHC++LAPE+ KAA  L   K  +K+  VD    + LG+ + +QG+PTIK F   K  P +Y G RTA  IV+
Sbjct:   19 EIKEEEDVLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGK--PSEYAGGRTAPEIVS 124          

HSP 3 Score: 74.7146 bits (182), Expect = 5.475e-14
Identity = 41/98 (41.84%), Postives = 51/98 (52.04%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIE-KNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            V VL   NF+EV   K+K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   +  FPTIK F K   +  DY G RT    V
Sbjct:  366 VKVLCGKNFDEVARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHADIVVAKMDSTANEVEGVKVHSFPTIKYFPKEGEAV-DYNGGRTLDDFV 462          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 316.62 bits (810), Expect = 9.821e-98
Identity = 214/622 (34.41%), Postives = 319/622 (51.29%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKD-VVVVGFFK-DQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFIS-----KKSEKYA-----------------ELKGQFETS----AKKFLGQVLFVIINTDEEDNDRVLEFFGMAKT-DTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGV-RIQSFPTIKYFP--KDSDEMVDFEGDRTLETFKKFID 1925
            ++ EE+ VLVL + NF+ VIE+N  +LVEFYAPWCGHC+SLAPE+ KAA  +K     V    +D    S + Q + + G+PT+KIF K   +P +Y+G R    IV    K+ D   +                            + LT  NF E V+  E   LVEFFAPWCGHCK LAPEY  AA++L++ +  I LA VDAT+E++LA K+++QGYPTLK F+ GK  +Y G R    I S++  + GP +  L S++  +  ++ KD V ++GFF  +         E+  D +DD  F  T   A    F +    SIVLF+                    F+ KY+    +   ++ +     G  K   +  +       K +KYA                  +  QF  S      K    + F I N  EE++++ L+ FG+A++ +  +      E    +  PD+   S ++L  FV+    G +KP + +Q +P+  +K PV V+VGK FD +  D  K V +EFYAPWCGHCK L P + +LG+ ++++ +IVIAK+D+TAN+V     ++ FPTI YF   KD    + F+G R L+   KF++
Sbjct:   56 EVKEEDDVLVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIFRKG--TPYEYEGPREESGIVEYMKKQSDPNWKPPPVA----------------------ALTLTKENFTE-VVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQVGPSSRILSSLKAVQDFMKEKDDVTIMGFFDGEDDKMLESYLEANNDVRDDYPFAHTFDAAAKKHFGIKKS-SIVLFQP-----------------ERFLSKYEPKHFVYEGKDLSPAALQGFYKDKRVPLVGLYTSYDKDKKYAARPLCIVYYGVDFGFDNRVATQFWRSKVIEVAKDHRDITFAIAN--EEESEQELKDFGLAESGEEVNVGCFDKEGRKFRMDPDEEEFSEDSLREFVEEFKAGNLKPIIKSQPVPKS-NKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTI-YFATSKDKKNPIKFDGGRELKDLIKFVE 630          

HSP 2 Score: 77.411 bits (189), Expect = 1.165e-14
Identity = 40/101 (39.60%), Postives = 64/101 (63.37%), Query Frame = 3
Query:  618 FDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFF--KDGK-VMDYGGGRTADTIISWLEKKT 911
            FDE+V   ++  L+EF+APWCGHCKAL P +    +  +   +I+ +AK+DAT  ND+ S + ++G+PT+ F   KD K  + + GGR    +I ++E+K 
Sbjct:  535 FDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIV-IAKIDATA-NDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKA 633          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO37155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGL1])

HSP 1 Score: 258.455 bits (659), Expect = 2.320e-78
Identity = 140/243 (57.61%), Postives = 175/243 (72.02%), Query Frame = 3
Query:  186 VLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG-----KVMDYGGGRTADTIISW 896
            V+ LT +NFN  VI  +   +VEFYAPWCGHC++LAPEW KAATALKGVVKVGAVDMD + S+G PY I+GFPTIKIFG +K+SP+DY G+RTA  IV+AA++   E V  R+    G SSS      GGS G+  DVVELTD+NF++ VL S++ WLVEFFAPWCGHC+ LAPE+A AA +LK K   +K+  +DATV    AS++++QGYPT+K F  G      V DY GGRTA  II +
Sbjct:   14 VVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALKGVVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIVDAAMRAAQEAVSQRM-SGGGRSSSGGGGRRGGSGGNKEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATELKGK---VKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQY 252          

HSP 2 Score: 118.242 bits (295), Expect = 2.703e-28
Identity = 59/108 (54.63%), Postives = 74/108 (68.52%), Query Frame = 3
Query:  177 EEGVLVLTNSNFN-EVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFG---KSKHSPKDYQGERTAGSIVNAAL 488
            +E V+ LT++NF  EV+      LVEF+APWCGHCQ LAPEW KAAT LKG VKVGA+D   ++     Y +QG+PTIK+F    K+ HS +DYQG RTA  I+  AL
Sbjct:  147 KEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATELKGKVKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYAL 254          

HSP 3 Score: 101.679 bits (252), Expect = 7.716e-23
Identity = 48/102 (47.06%), Postives = 64/102 (62.75%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK--VMDYGGGRTADTII 890
            DVVELT +NF+  V+  +  W+VEF+APWCGHCKALAPE+  AA  LK    ++K+  VD  V   +   + I+G+PT+K F   K    DY G RTA  I+
Sbjct:   13 DVVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALK---GVVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIV 111          

HSP 4 Score: 67.781 bits (164), Expect = 7.321e-12
Identity = 33/92 (35.87%), Postives = 44/92 (47.83%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLE 1904
            L   NF++   +      VEFYAPWCGHCK LAP W +     K    +    MD   +      I+ FPTIK F  + +   D+ G RT +
Sbjct:   17 LTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALKGVVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQ 108          

HSP 5 Score: 67.0106 bits (162), Expect = 1.308e-11
Identity = 36/102 (35.29%), Postives = 54/102 (52.94%), Query Frame = 3
Query: 1608 DKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYFP---KDSDEMVDFEGDRT 1898
            +K  V  L   NF+    +      VEF+APWCGHC++LAP W +     K    + +  +D+T + V   R  +Q +PTIK F    K+S  + D++G RT
Sbjct:  146 NKEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATELKGK--VKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRT 245          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO31634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD7])

HSP 1 Score: 226.868 bits (577), Expect = 5.573e-66
Identity = 158/455 (34.73%), Postives = 233/455 (51.21%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDAT-VENDLASKFKIQGYPTLKFFKDGKVM-DYGGGRTADTIISWLEKKTGPPAATLKSVEE-AKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFK------KFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEV-EGVRIQSFPTIKYFPKDSDEMVD-FEGDRTLETFKKFI 1922
            DV++L DSNF   V   ++  LVEFFAPWCGHCK LAPEY +AAE LK+ +  + LAKVD T    D  SK+ + GYPTLK F++G++  DY G R +  II +++K+ GP +  +KSV+   K L +++  VVVGF             +  + +D   F   S   V +++     + IV+F+      K +     +TG   D  I+ FI+      V +   +   + F   +         KK+ K ++          KF              D +RVL   G+     PS  +     D    K      S ++   F++    G +KPH+ ++ +PE  D  PVKV+VG+NF  +  D +K V +EFYAPWCGHCK L P +++LGE  +D  DIVIAKMD+TAN+      +Q FPTI + P ++ E  + +EG R +  F  FI
Sbjct:   19 DVLDLGDSNFKSGVA-GKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPSSVEIKSVDHLEKKLDDAESNVVVGFLDGDDDLKNAFMRTANEMRDSFSFAHASVTDVLEKYNYK--NQIVVFRPKHLHTKLEPSFIAYTGSPDDFYIKKFINAKAHGRVGQRTPDNEEQ-FPKPLCVVFFDVDWKKNAKGSKYWRNRVLKVTKFFDDKAMNFAIASFSDYERVLSDIGVTDKANPSAVVYNDAGDKFLMK---EKFSVDSFKQFLEDYFAGSLKPHIKSEPLPESND-GPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFI 465          

HSP 2 Score: 82.0333 bits (201), Expect = 2.667e-16
Identity = 49/134 (36.57%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK------GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKE 494
            M Y +  +  F  +  ++D      VL L +SNF   +     +LVEF+APWCGHC+ LAPE++ AA ALK       + KV   +  K +     YG+ G+PT+KIF   + S KDY G R +  I+    K+
Sbjct:    1 MLYSTAFVLLFVGSTLSSD------VLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTC--SKYGVSGYPTLKIFRNGEMS-KDYDGPRDSSGIIRYMKKQ 125          

HSP 3 Score: 77.7962 bits (190), Expect = 5.608e-15
Identity = 40/105 (38.10%), Postives = 61/105 (58.10%), Query Frame = 3
Query:  615 NFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMD---YGGGRTADTIISWLEKKTGPP 920
            NF E+V    +  L+EF+APWCGHCK+L P+Y    EKL++   I+ +AK+DAT  ND    F +QG+PT+ +       +   Y GGR     + ++++K   P
Sbjct:  370 NFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIV-IAKMDATA-NDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIKRKATKP 472          

HSP 4 Score: 73.559 bits (179), Expect = 1.166e-13
Identity = 38/101 (37.62%), Postives = 58/101 (57.43%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQP-YGIQGFPTIK-IFGKSKHSPKDYQGERTAGSIVN 479
            V V+   NF E++ +  K VL+EFYAPWCGHC+SL P++ +    L+ V  +    MD  ++   P + +QGFPTI      +K +P+ Y+G R     V+
Sbjct:  363 VKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVD 463          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 173.711 bits (439), Expect = 6.023e-48
Identity = 111/301 (36.88%), Postives = 155/301 (51.50%), Query Frame = 3
Query:  129 VLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL--KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDEL--VRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLK-EKNSIIKLAKVDATVENDLASKFKIQGYPTLKFF----KDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQ 1004
            VLF   L    + +T+ + V+ LT  NF+EV+   K+ LVEFYAPWCGHC+ LAP +++   A      V +  VD D    LG  + ++GFPTIK F K   +P++Y G R     +N  +K ++E   VR R+                        V +L +SNFD++V   +   LVEFFAPWCGHCK LAP Y    E  K E N +I  AKVDA   + L  K+ + GYPTLKFF    KDG+  +Y  GR   + + ++ +K G        + E    I + D   V F K++
Sbjct:    6 VLFKLFLLFSISSLTQGK-VIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRD----INDFIKFIEEKTGVRGRVPVIPSA------------------VADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVI--AKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGE--EYSSGRDEQSFVDFMNEKCGTKRTPGGGLNEQAGRINAFDGFAVEFMKNK 279          

HSP 2 Score: 104.76 bits (260), Expect = 3.086e-24
Identity = 50/101 (49.50%), Postives = 66/101 (65.35%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFID 1925
            L   NFD V  +  K   VEFYAPWCGHCKQLAP ++QLGE Y  ++D++IAK+D+  +   G R  ++ FPTIKYFPK S    ++ G R +  F KFI+
Sbjct:   27 LTKDNFDEVV-NGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIE 126          

HSP 3 Score: 88.1965 bits (217), Expect = 1.032e-18
Identity = 36/97 (37.11%), Postives = 64/97 (65.98%), Query Frame = 3
Query: 1641 NFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFID 1925
            NFD + ++    V VEF+APWCGHCK LAP+++++GE +K+  + VIAK+D+ A+   G +  +  +PT+K+F K + +  ++   R  ++F  F++
Sbjct:  149 NFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFMN 245          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:101155742])

HSP 1 Score: 501.516 bits (1290), Expect = 2.247e-170
Identity = 247/451 (54.77%), Postives = 331/451 (73.39%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSD-EMVDFEGDRTLETFKKFIDSN 1931
            DV+ L  SNFDE  L++    LVEF+APWCGHCKALAPEYA AA  LK + S I+L KVDAT E +LA +F ++GYPT+KFFK G      +Y  GR AD +++WL+K+TGP   +L  V +A++LI   +V V+GFFKD  S  AKA+E  A++ DDV F +TS  AV+ +F+VS D  +VLFKKFDEGRN F G      +  F+   QLP+VIEF ++TA KIFGG IK H+L F+ K +  + E   QF+ +A  F GQ+LF+ I++D +DN R+LEFFG+ K + P+ R+I LED+M K+KP+   I++E++  F    ++GK+KPH+M+Q+IPEDWDKNPVKVLVGKNF+ VA D  K VF+EFYAPWCGHCKQLAPIWD+LGE YKD++DIV+AKMDSTANE+E V++ SFPT+K+FP   + +++D+ G+RTLE F KF++S 
Sbjct:   23 DVLVLKKSNFDE-ALQAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSQIRLGKVDATEETELAQEFGVRGYPTIKFFKGGDKESPKEYSAGRQADDMVNWLKKRTGPAVTSLTEVTDAESLIADNEVAVIGFFKDANSDDAKAYEKAAEAMDDVPFAITSSDAVYSKFEVSKD-GVVLFKKFDEGRNTFDGELTKDGLLAFVKANQLPLVIEFTEQTAPKIFGGDIKSHILMFLPKAASDFQEKMEQFKKAAAGFKGQILFIFIDSDVDDNQRILEFFGLKKEECPAIRLITLEDEMTKYKPESKDITAESIVAFCTQFVEGKLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFDPKKNVFIEFYAPWCGHCKQLAPIWDKLGEKYKDSSDIVVAKMDSTANEIESVKVHSFPTLKFFPAGEERQVIDYNGERTLEGFTKFLESG 471          

HSP 2 Score: 122.479 bits (306), Expect = 6.626e-29
Identity = 58/124 (46.77%), Postives = 80/124 (64.52%), Query Frame = 3
Query:  120 LSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKG---VVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIVN 479
            L  ++ C       A+I EEE VLVL  SNF+E ++ +  +LVEFYAPWCGHC++LAPE+ KAA  LK     +++G VD  + + L Q +G++G+PTIK F G  K SPK+Y   R A  +VN
Sbjct:    2 LKFLMLCTLAVASRAEIAEEEDVLVLKKSNFDEALQAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSQIRLGKVDATEETELAQEFGVRGYPTIKFFKGGDKESPKEYSAGRQADDMVN 125          

HSP 3 Score: 74.3294 bits (181), Expect = 1.950e-13
Identity = 46/125 (36.80%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  123 SIVLFCFALAQ-------CNADITEE---EGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERT 461
            SIV FC    +        + DI E+     V VL   NF EV  +  K V +EFYAPWCGHC+ LAP W K     K    +    MD  ++  +   +  FPT+K F    +    DY GERT
Sbjct:  336 SIVAFCTQFVEGKLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFDPKKNVFIEFYAPWCGHCKQLAPIWDKLGEKYKDSSDIVVAKMDSTANEIESVKVHSFPTLKFFPAGEERQVIDYNGERT 460          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 379.022 bits (972), Expect = 3.292e-122
Identity = 209/453 (46.14%), Postives = 293/453 (64.68%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK----DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFK-PDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 1928
            ++ L  +NFD   L      +VEF+APWCG+C+   P YA AA  LKE+ S ++LAKVDA  E +LA +F +  +PT+K F +G   + ++Y G RT   I+ WL++++GP AA L S + A   I + +V VVGFF +  S AA  F+ VA    DV F VT+   VF E++V+++  +VLFKKFD+GR DF     DK    ++  FI +  L +++ FNQET+ KIF   ++ H L FI+   E    L  + +T A++F G+VL+++I+     +  VL +FG+ + D+P+ RMI + D   KFK   + TI S  L    Q V+D   +P++ ++EIPEDWDK PVKVLV KNF++VA D +K VFVEFYAPWCGHCK+LAPIW+QLGE Y D+ DI+IAKMD+TANEVE V I  FPT+KYFP    E+  + G+R LET  KF+D+
Sbjct:   67 IMVLHINNFDR-ALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTAN-KVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTAVS-HVLNYFGVLEKDSPTVRMINM-DTQKKFKIASEMTIDS--LRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEV--YTGNRDLETLSKFLDN 511          

HSP 2 Score: 86.2705 bits (212), Expect = 4.414e-17
Identity = 38/108 (35.19%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIV 476
            +I EE+G++VL  +NF+  + + ++++VEFYAPWCG+C+   P + +AA  LK     +++  VD  +   L + + +  FPT+K+F    +  P +Y G+RT   IV
Sbjct:   60 EIEEEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIV 167          

HSP 3 Score: 63.929 bits (154), Expect = 3.563e-10
Identity = 32/78 (41.03%), Postives = 42/78 (53.85%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 416
            V VL   NF  V ++  K V VEFYAPWCGHC+ LAP W++          +    MD  ++  +   I GFPT+K F
Sbjct:  411 VKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYF 488          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 377.867 bits (969), Expect = 2.781e-121
Identity = 204/452 (45.13%), Postives = 289/452 (63.94%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK----DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 1928
            ++ L  +NFD   L      +VEF+APWCG+C+   P YA AA  LKE+ S ++LAKVDA  E +LA +F +  +PT+K F +G   + ++Y G RT   I+ WL++++GP AA L S + A   I + +V VVGFF +  S AA  F+ VA    DV F VT+   VF E++V+++  +VLFKKFD+GR DF     DK    ++  FI +  L +++ FNQET+ KIF   ++ H L FI+   E    L  + +T A++F G+VL+++I+     +  VL +FG+ + D+P+ RMI + D   KFK +               V+D   +P++ ++EIPEDWDK PVKVLV KNF++VA D +K VFVEFYAPWCGHCK+LAPIW+QLGE Y D+ DI+IAKMD+TANEVE V I  FPT+KYFP    E++ + G+R LET  KF+D+
Sbjct:   71 IMVLHINNFDR-ALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTAN-KVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTAVS-HVLNYFGVLEKDSPTVRMINM-DTQKKFKIE---------------VVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDN 503          

HSP 2 Score: 86.6557 bits (213), Expect = 2.916e-17
Identity = 38/108 (35.19%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIV 476
            +I EE+G++VL  +NF+  + + ++++VEFYAPWCG+C+   P + +AA  LK     +++  VD  +   L + + +  FPT+K+F    +  P +Y G+RT   IV
Sbjct:   64 EIEEEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIV 171          

HSP 3 Score: 67.3958 bits (163), Expect = 3.903e-11
Identity = 35/92 (38.04%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGER 458
            V VL   NF  V ++  K V VEFYAPWCGHC+ LAP W++          +    MD  ++  +   I GFPT+K F         Y G R
Sbjct:  401 VKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNR 492          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 346.28 bits (887), Expect = 6.336e-111
Identity = 190/408 (46.57%), Postives = 268/408 (65.69%), Query Frame = 3
Query:  729 LKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDK----DIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFK-PDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 1928
            LKE+ S ++LAKVDA  E +LA +F +  +PT+K F +G   + ++Y G RT   I+ WL++++GP AA L S + A   I + +V VVGFF +  S AA  F+ VA    DV F VT+   VF E++V+++  +VLFKKFD+GR DF     DK    ++  FI +  L +++ FNQET+ KIF   ++ H L FI+   E    L  + +T A++F G+VL+++I+     +  VL +FG+ + D+P+ RMI + D   KFK   + TI S  L    Q V+D   +P++ ++EIPEDWDK PVKVLV KNF++VA D +K VFVEFYAPWCGHCK+LAPIW+QLGE Y D+ DI+IAKMD+TANEVE V I  FPT+KYFP    E++ + G+R LET  KF+D+
Sbjct:    2 LKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTAN-KVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTAVS-HVLNYFGVLEKDSPTVRMINM-DTQKKFKIASEMTIDS--LRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDN 404          

HSP 2 Score: 73.9442 bits (180), Expect = 1.986e-13
Identity = 41/102 (40.20%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  603 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG--KVMDYGGGRTADTIISWLE 902
            L   NF+ + +   +   VEF+APWCGHCK LAP +    E   + + II +AK+DAT  N++ S   I G+PTLK+F  G  +V+ Y G R  +T+  +L+
Sbjct:  305 LVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDII-IAKMDATA-NEVES-VAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLD 403          

HSP 3 Score: 67.781 bits (164), Expect = 1.908e-11
Identity = 35/92 (38.04%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGER 458
            V VL   NF  V ++  K V VEFYAPWCGHC+ LAP W++          +    MD  ++  +   I GFPT+K F         Y G R
Sbjct:  302 VKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNR 393          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 341.273 bits (874), Expect = 1.350e-107
Identity = 194/448 (43.30%), Postives = 276/448 (61.61%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG---KVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 1928
            ++ L  +NFD   L      +VEF+APWCG+C+   P YA AA  LKE+ S ++LAKVDA  E +LA +F +  +PT+K F +G   + ++Y G RT   I+ WL++++GP AA L S + A   I + +V VVGFF +  S AA  F+ VA    DV F VT+   VF E++V+++  +VLFKK                +R    K    ++    Q  A KIF   ++ H L FI+   E    L  + +T A++F G+VL+++I+     +  VL +FG+ + D+P+ RMI + D   KFK     I+SE   + + S+     +P++ ++EIPEDWDK PVKVLV KNF++VA D +K VFVEFYAPWCGHCK+LAPIW+QLGE Y D+ DI+IAKMD+TANEVE V I  FPT+KYFP    E++ + G+R LET  KF+D+
Sbjct:   71 IMVLHINNFDR-ALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTAN-KVVLFKK----------------VRL---KPSSGLLSTERQCNADKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTAVS-HVLNYFGVLEKDSPTVRMINM-DTQKKFK-----IASE---MTIDSLRQLSQEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDN 487          

HSP 2 Score: 86.6557 bits (213), Expect = 3.469e-17
Identity = 38/108 (35.19%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  165 DITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF-GKSKHSPKDYQGERTAGSIV 476
            +I EE+G++VL  +NF+  + + ++++VEFYAPWCG+C+   P + +AA  LK     +++  VD  +   L + + +  FPT+K+F    +  P +Y G+RT   IV
Sbjct:   64 EIEEEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIV 171          

HSP 3 Score: 66.6254 bits (161), Expect = 5.336e-11
Identity = 35/92 (38.04%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  186 VLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGER 458
            V VL   NF  V ++  K V VEFYAPWCGHC+ LAP W++          +    MD  ++  +   I GFPT+K F         Y G R
Sbjct:  385 VKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNR 476          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 433/446 (97.09%), Postives = 441/446 (98.88%), Query Frame = 3
Query:  594 VVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 1931
            V+ LT+SNF+E++ K++   LVEF+APWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQASAAAKAFESVADSKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN
Sbjct:   26 VLVLTNSNFNEVIEKNKYV-LVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQASAAAKAFESVADSKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDSN 470          

HSP 2 Score: 169.859 bits (429), Expect = 4.695e-45
Identity = 83/126 (65.87%), Postives = 96/126 (76.19%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALK---GVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVN 479
            MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHC++LAPE+  AA  LK    ++K+  VD    + L   + IQG+PT+K F   K    DY G RTA +I++
Sbjct:    1 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK--VMDYGGGRTADTIIS 124          

HSP 3 Score: 79.337 bits (194), Expect = 4.022e-15
Identity = 40/93 (43.01%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  186 VLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            V VL   NF+ V  +K+K V VEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   IQ FPTIK F K      D++G+RT
Sbjct:  367 VKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRT 459          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000017020.1 (SMESG000017020.1)

HSP 1 Score: 330.487 bits (846), Expect = 2.644e-105
Identity = 198/295 (67.12%), Postives = 221/295 (74.92%), Query Frame = 3
Query:  144 ALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLXXXXXXXXXXXXXXXXXXXXXXXDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFF----KDGKVMDYGGGRTADTIISWLEKKT--GPPAATLKSV---EEAKALIESKDVVVVGFFKD 1001
            AL   N D+ E      LT SNF+++   +    VEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQG+RTAGSIVNAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCK L P +  AA +L+ K   +KL  +DATV    AS++ +QGYPT+KFF    K G   DY GGR++  I+ W   K     PA  +K +   E  K+  E   + VV    +
Sbjct:   18 ALYSSNDDVVE------LTPSNFDDMKNSDSLWFVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGDRTAGSIVNAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK---VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKSACEDHQLCVVAVLPN 303          

HSP 2 Score: 75.0998 bits (183), Expect = 7.156e-14
Identity = 37/90 (41.11%), Postives = 48/90 (53.33%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRT 1898
            L   NFD + ++     FVEFYAPWCGHC+ LAP W +     K    +    MD  ++  +   IQ FPTIK F K      D++GDRT
Sbjct:   29 LTPSNFDDM-KNSDSLWFVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGDRT 117          

HSP 3 Score: 71.2478 bits (173), Expect = 1.049e-12
Identity = 34/94 (36.17%), Postives = 50/94 (53.19%), Query Frame = 3
Query: 1629 LVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYFPKD--SDEMVDFEGDRT 1898
            L   NFD +     +   VEF+APWCGHCK L P WDQ     +    + +  +D+T +     R  +Q +PTIK+FP    S +  D++G R+
Sbjct:  165 LTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGK--VKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRS 256          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000069732.1 (SMESG000069732.1)

HSP 1 Score: 259.225 bits (661), Expect = 9.869e-78
Identity = 150/446 (33.63%), Postives = 246/446 (55.16%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXXXXXXXXXKDDVVFGVTSQKAVFDEFKVSSDDS-IVLFKKFDEGRNDF-TGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFI 1922
            DV  + +  F+E++    +P L+ F+APWC   + L P + +AA+ L +  S IKL KVD TVE DLA+KFKI+ YPT+  FK+ + + Y       TI++WL  K      ++ S +    + +  DV+ V             F   A+  DDV F  T +K +F     ++D +  +L +K D     F  G    +D+  F+   ++P V+ ++ +  GK+F  S     + F+    +K+ E   + E +A     ++ FV+ +  +     +++ F +  ++ P   +   +   + F P    I+ + ++ F+  V +GK+   + +Q IPE+W+  PVK+LVGKNF+ VA +K K VFVEFYAPWC +CKQL PIW++L +   D  D++IAK+D T N+++   I+SFPT+K F KDS+E+VD+ G RT E  K+F+
Sbjct:   26 DVFVVNNETFEELI-NDHKPILINFYAPWCKFSQKLLPHFENAAKNLLQMESRIKLGKVDVTVETDLANKFKIKSYPTIILFKEDRQIPYSKAHHHLTILNWLISKVDKLIISVNSTDSLDEVRQKTDVLFVI----NNDIMGDTFVGAAELIDDVQFA-TMEKHLFHSLFSNTDQTKAILIRKIDNNLIPFGKGEINQEDVIKFVRSNEIPSVVRYSFDIGGKVFQNS--HRFMHFMVFMDDKFEEAHKELEEAAINH-PEITFVMTDVTDNTTSSLIKHFNVDLSNLPHLVLSDAKHKRL-FLPGFNEINGKRIDQFLMDVKNGKIGQFLKSQNIPENWNSEPVKILVGKNFEEVALNKQKTVFVEFYAPWCNYCKQLEPIWERLAKELLDVPDLIIAKLDKTENDIKNFEIKSFPTLKLFLKDSNEVVDYSGPRTRERLKEFL 461          

HSP 2 Score: 78.1814 bits (191), Expect = 9.143e-15
Identity = 45/139 (32.37%), Postives = 71/139 (51.08%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITE-EEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATAL---KGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIVNAALKELDELVRS 515
            MK+    L  F L     D  E E  V V+ N  F E+I  +K +L+ FYAPWC   Q L P ++ AA  L   +  +K+G VD+   + L   + I+ +PTI +F + +  P  Y       +I+N  + ++D+L+ S
Sbjct:    1 MKFFCRFLLIFFLPAAIFDELEIENDVFVVNNETFEELINDHKPILINFYAPWCKFSQKLLPHFENAAKNLLQMESRIKLGKVDVTVETDLANKFKIKSYPTIILFKEDRQIP--YSKAHHHLTILNWLISKVDKLIIS 137          

HSP 3 Score: 78.1814 bits (191), Expect = 9.143e-15
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  180 EGVLVLTNSNFNEV-IEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERT 461
            E V +L   NF EV + K K V VEFYAPWC +C+ L P W++ A  L  V  +    +DK  +  + + I+ FPT+K+F K  +   DY G RT
Sbjct:  359 EPVKILVGKNFEEVALNKQKTVFVEFYAPWCNYCKQLEPIWERLAKELLDVPDLIIAKLDKTENDIKNFEIKSFPTLKLFLKDSNEVVDYSGPRT 453          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 240.35 bits (612), Expect = 1.127e-70
Identity = 166/465 (35.70%), Postives = 250/465 (53.76%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK-VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXX-XXXXXXXKDDVVFGVTSQKAVFDEF---KVSSDDSIVLF------KKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAE----LKGQFETSAKKFL--GQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEG-VRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDS 1928
            DV+E  DS+F++ V K     LVEF+APWCGHCK LAPEY  AA  LK+++  I +AKVD T E     K  + GYPTLK FK+G+   DY G R+AD II ++  K+GP +  LK+ E       S D VVVGFF  ++S   KA         +D  F  T     FDE    K++  ++IV+F       KF++ +  + G   +  +RT++++  + +       T   +   + +  +++  +   EK  +     + +    AKKF+  G+ +   I+  +E N  + E+ G+   D     +   ++   KFK   A  S ENL  F+   L+ KV  ++ ++ IPE  D+ PVKV+V KNFD +  D +K V +EFYAPWCGHCK LAP +++L +     +DIVIAKMD+TAN+V     +  FPTI + PK+S      +   R ++   K+I S
Sbjct:    4 DVLEFKDSSFEQSV-KEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHT-----FDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQMRTWVEENIMGLA---GHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMM-ADFSMENLEKFINDFLEEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 456          

HSP 2 Score: 89.3521 bits (220), Expect = 2.089e-18
Identity = 42/100 (42.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  186 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            VL   +S+F + ++++  +LVEFYAPWCGHC+ LAPE++ AATALK     + +  VD    +   + +G+ G+PT+K+F K+     DY GER+A  I+
Sbjct:    5 VLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGII 103          

HSP 3 Score: 84.7297 bits (208), Expect = 6.215e-17
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS-LGQPYGIQGFPTIKIFGK-SKHSPKDYQGERTA-------GSIVNAALKELDELVRSR 518
            +E V V+   NF+E++ +  K VL+EFYAPWCGHC+SLAP++++ A  L     +    MD  ++ +  PY + GFPTI    K SKHSPK Y   R          S  ++ LK  D   R R
Sbjct:  349 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDR 472          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 239.965 bits (611), Expect = 1.817e-70
Identity = 166/465 (35.70%), Postives = 250/465 (53.76%), Query Frame = 3
Query:  591 DVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK-VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQXXXXXXX-XXXXXXXKDDVVFGVTSQKAVFDEF---KVSSDDSIVLFK------KFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAE----LKGQFETSAKKFL--GQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEG-VRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDS 1928
            DV+E  DS+F++ V K     LVEF+APWCGHCK LAPEY  AA  LK+++  I +AKVD T E     K  + GYPTLK FK+G+   DY G R+AD II ++  K+GP +  LK+ E       S D VVVGFF  ++S   KA         +D  F  T     FDE    K++  ++IV+F       KF++ +  + G   +  +RT++++  + +       T   +   + +  +++  +   EK  +     + +    AKKF+  G+ +   I+  +E N  + E+ G+   D     +   ++   KFK   A  S ENL  F+   L+ KV  ++ ++ IPE  D+ PVKV+V KNFD +  D +K V +EFYAPWCGHCK LAP +++L +     +DIVIAKMD+TAN+V     +  FPTI + PK+S      +   R ++   K+I S
Sbjct:   18 DVLEFKDSSFEQSV-KEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHT-----FDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQMRTWVEENIMGLA---GHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMM-ADFSMENLEKFINDFLEEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 470          

HSP 2 Score: 89.7373 bits (221), Expect = 1.700e-18
Identity = 47/125 (37.60%), Postives = 72/125 (57.60%), Query Frame = 3
Query:  111 MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGERTAGSIV 476
            M  L  + F   LA  +        VL   +S+F + ++++  +LVEFYAPWCGHC+ LAPE++ AATALK     + +  VD    +   + +G+ G+PT+K+F K+     DY GER+A  I+
Sbjct:    1 MNILISLFFLLPLAMAS-------DVLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGII 117          

HSP 3 Score: 84.7297 bits (208), Expect = 7.138e-17
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 3
Query:  177 EEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSS-LGQPYGIQGFPTIKIFGK-SKHSPKDYQGERTA-------GSIVNAALKELDELVRSR 518
            +E V V+   NF+E++ +  K VL+EFYAPWCGHC+SLAP++++ A  L     +    MD  ++ +  PY + GFPTI    K SKHSPK Y   R          S  ++ LK  D   R R
Sbjct:  363 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDR 486          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4HB3.423e-17255.01prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
P4HB1.580e-14849.22prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
PDIA24.305e-12742.51protein disulfide isomerase family A member 2 [Sou... [more]
PDIA22.014e-12642.73protein disulfide isomerase family A member 2 [Sou... [more]
PDIA49.168e-9936.80protein disulfide isomerase family A member 4 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdi-24.247e-17757.49Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-24.247e-17757.49Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-21.661e-15752.13Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-21.661e-15752.13Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-11.355e-11843.68Protein disulfide-isomerase 1 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdi1.868e-16653.59gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi1.868e-16653.59gene:FBgn0286818 transcript:FBtr0075648[more]
ERp608.366e-7236.82gene:FBgn0033663 transcript:FBtr0088058[more]
CaBP11.860e-7050.75gene:FBgn0025678 transcript:FBtr0345544[more]
CaBP11.860e-7050.75gene:FBgn0025678 transcript:FBtr0080837[more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb2.466e-17054.67prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
p4hb2.466e-17054.67prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
pdia21.631e-13648.03protein disulfide isomerase family A, member 2 [So... [more]
pdia21.660e-13648.03protein disulfide isomerase family A, member 2 [So... [more]
pdia42.344e-9835.80protein disulfide isomerase family A, member 4 [So... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb4.476e-16353.66prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb4.535e-16353.66prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb4.629e-16353.66prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb6.366e-15853.76prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb1.403e-15753.88prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4hb2.880e-16654.22prolyl 4-hydroxylase, beta polypeptide [Source:MGI... [more]
Pdia24.326e-12243.18protein disulfide isomerase associated 2 [Source:M... [more]
Pdia22.790e-12043.18protein disulfide isomerase associated 2 [Source:M... [more]
Pdia41.446e-9434.65protein disulfide isomerase associated 4 [Source:M... [more]
Pdia69.420e-8149.19protein disulfide isomerase associated 6 [Source:M... [more]
back to top
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17770|PDI2_CAEEL5.402e-17657.49Protein disulfide-isomerase 2 OS=Caenorhabditis el... [more]
sp|P07237|PDIA1_HUMAN1.644e-17155.01Protein disulfide-isomerase OS=Homo sapiens OX=960... [more]
sp|P05307|PDIA1_BOVIN9.016e-17154.89Protein disulfide-isomerase OS=Bos taurus OX=9913 ... [more]
sp|Q2HWU2|PDIA1_MACFU1.375e-17054.79Protein disulfide-isomerase OS=Macaca fuscata fusc... [more]
sp|Q5R5B6|PDIA1_PONAB2.254e-17054.79Protein disulfide-isomerase OS=Pongo abelii OX=960... [more]
back to top
BLAST of Protein disulfide-isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K0S43.082e-2661.30Protein disulfide-isomerase OS=Lingula unguis OX=7... [more]
A0A1S3K1I53.409e-2661.30Protein disulfide-isomerase OS=Lingula unguis OX=7... [more]
A0A1S3K0F53.012e-2661.30Protein disulfide-isomerase OS=Lingula unguis OX=7... [more]
A0A3M7PW311.553e-2158.61Protein disulfide-isomerase OS=Brachionus plicatil... [more]
A0A1I8HRX25.531e-18059.06Protein disulfide-isomerase OS=Macrostomum lignano... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb9.997e-17255.21prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia21.484e-14149.78protein disulfide isomerase family A, member 2 [So... [more]
pdia46.420e-10134.58protein disulfide isomerase family A member 4 [Sou... [more]
zgc:1364721.359e-8033.48protein disulfide-isomerase-like [Source:NCBI gene... [more]
zgc:1364721.449e-8033.48protein disulfide-isomerase-like [Source:NCBI gene... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002052.11.187e-9841.79pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 g... [more]
pdia44.054e-9333.82protein disulfide isomerase family A, member 4 [So... [more]
pdia37.896e-7336.09protein disulfide isomerase family A, member 3 [So... [more]
pdia65.566e-6846.27protein disulfide isomerase family A, member 6 [So... [more]
p4hb1.317e-5449.48prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDI17.623e-5734.27Protein disulfide isomerase; multifunctional oxido... [more]
EUG11.128e-2625.32Protein disulfide isomerase of the endoplasmic ret... [more]
MPD19.315e-1937.60Member of the protein disulfide isomerase (PDI) fa... [more]
TRX21.070e-936.71Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
TRX15.984e-835.80Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368306.392e-2761.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329309.821e-9834.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371552.320e-7857.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316345.573e-6634.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473406.023e-4836.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb2.247e-17054.77prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia23.292e-12246.14protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia22.781e-12145.13protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia26.336e-11146.57protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia21.350e-10743.30protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023147.14.695e-4597.09SMESG000023147.1[more]
SMESG000017020.12.644e-10567.12SMESG000017020.1[more]
SMESG000069732.19.869e-7833.63SMESG000069732.1[more]
SMESG000041085.11.127e-7035.70SMESG000041085.1[more]
SMESG000041085.11.817e-7035.70SMESG000041085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017430 ID=SMED30017430|Name=Protein disulfide-isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2357bp
TCCATTTGTTTAACCATTCTAATTTACATGCACATTACTACACGTAGTAT
ATCCATACGTATATACATTTATAAAATACTTCCATTGTGAATTTAGTTCT
ATTTTAGAAAATGAAATATCTGTCGATAGTTTTATTTTGTTTTGCCTTAG
CGCAATGTAATGCTGACATTACTGAAGAAGAAGGTGTTTTAGTATTGACA
AACAGTAATTTTAATGAAGTGATTGAGAAGAACAAATATGTATTAGTTGA
ATTCTATGCTCCATGGTGTGGTCATTGCCAATCTTTGGCTCCAGAATGGA
AGAAAGCTGCAACTGCGTTGAAAGGTGTTGTTAAAGTTGGAGCAGTTGAT
ATGGATAAATATTCCTCACTCGGTCAACCATATGGTATACAAGGATTTCC
AACTATCAAAATTTTCGGCAAAAGTAAACACTCACCCAAAGATTATCAAG
GCGAAAGGACTGCTGGTTCGATTGTAAACGCGGCTTTAAAGGAATTAGAC
GAGTTAGTTCGGTCTAGATTGGGTGGCGCAAGTGGGGGTTCTTCTTCACA
CGAACGAAAATCGAGTGGTGGCAGTAGCGGCAGTGGAGGAGACGTTGTTG
AATTGACAGACAGCAATTTCGATGAGATGGTTTTGAAGAGTGAGGAACCT
TGGCTCGTAGAGTTCTTTGCTCCGTGGTGTGGCCACTGCAAAGCTTTAGC
TCCAGAATATGCTTCAGCAGCTGAGAAATTGAAAGAAAAAAACTCAATCA
TTAAGTTGGCAAAAGTAGATGCTACAGTTGAGAATGATTTAGCTAGCAAA
TTTAAAATTCAAGGTTATCCAACTTTGAAGTTTTTCAAGGATGGAAAAGT
CATGGATTACGGAGGAGGACGAACTGCTGATACCATTATTTCTTGGTTAG
AAAAGAAAACCGGACCACCTGCAGCTACATTGAAATCAGTCGAAGAAGCT
AAAGCTTTAATTGAATCAAAAGACGTTGTAGTTGTTGGTTTCTTTAAAGA
TCAAGCTTCAGCTGCTGCTAAAGCATTTGAATCAGTTGCCGATTCCAAAG
ACGATGTTGTATTTGGTGTCACATCTCAAAAAGCTGTCTTTGATGAATTT
AAAGTTTCAAGTGACGATAGCATTGTTTTGTTTAAGAAATTTGATGAAGG
CCGAAATGATTTTACTGGTCCTTTTGTTGATAAGGACATCCGAACCTTTA
TTGATAAATACCAATTGCCAATTGTTATTGAATTCAATCAAGAAACTGCC
GGCAAAATATTTGGCGGTTCAATTAAAAAGCATGTTTTGAGCTTCATAAG
CAAAAAATCTGAAAAATACGCTGAATTGAAAGGACAATTTGAAACATCTG
CAAAGAAATTTTTGGGACAAGTTCTATTTGTTATTATCAATACAGATGAA
GAAGACAATGATCGTGTTTTGGAATTTTTCGGAATGGCTAAGACTGATAC
TCCGAGCTTCAGAATGATCCAACTGGAAGATGATATGGTCAAATTCAAAC
CTGATGATGCTACTATTTCATCTGAAAATCTTAATCTCTTTGTACAAAGT
GTTCTTGATGGAAAGGTCAAACCCCATATGATGACTCAAGAAATACCCGA
AGATTGGGATAAGAATCCAGTTAAGGTTTTAGTTGGAAAGAATTTCGATT
CAGTTGCTAGAGATAAATCTAAGGCTGTTTTCGTTGAATTTTATGCTCCA
TGGTGTGGGCATTGCAAACAACTCGCTCCAATCTGGGACCAACTCGGTGA
AACATACAAAGACAATACCGATATTGTCATTGCGAAAATGGATTCCACAG
CCAATGAAGTGGAAGGCGTTAGAATCCAGAGTTTCCCAACGATTAAATAT
TTCCCTAAAGATTCCGATGAAATGGTTGATTTTGAAGGGGATCGTACTTT
GGAGACGTTCAAGAAATTTATTGATAGCAACGGAAAGGAAGGTGGCAAAA
AGAAGGCTGCAGAAAAGGAAGAAGATGAAGAGAAAGAAGTTGAAGAAGAG
GATGACGAAAAGAAACCAAAAGAAGAATTGTAAATGAAAGATGTTGCTGT
CGTGTAATAGAGCTTTCAAATTGTTAAAGCATTATTTTTCACAATCAGCA
CTATTTATTCGTATTTGCAATCAGTTTTAATCAGTGTTGTGACTGTATTT
TGTATTCATATTTTTATTTATAAATCCGAGGTGATGTTAGTAATAAATAT
TGTTACAATTGTTTTCCATCAGTGTCTTCCTTCAATTATTTATTTGCAAT
TATAATCTACATAAATGTTGATCTGTATGCTGTCTGCCTTTTACCCAATT
AAATGTTATTTCACATTTGTCATTTAGTAAATGTTCCATTTGATGAAAAA
TGCGTTC
back to top

protein sequence of SMED30017430-orf-1

>SMED30017430-orf-1 ID=SMED30017430-orf-1|Name=SMED30017430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=641bp
MKYLSIVLFCFALAQCNADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYA
PWCGHCQSLAPEWKKAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIK
IFGKSKHSPKDYQGERTAGSIVNAALKELDELVRSRLGGASGGSSSHERK
SSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKALAPEY
ASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDY
GGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQAS
AAAKAFESVADSKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRND
FTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKS
EKYAELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSF
RMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWD
KNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYK
DNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETF
KKFIDSNGKEGGKKKAAEKEEDEEKEVEEEDDEKKPKEEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000019muscle progenitor cell
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
PLANA:0007552nu neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
IPR017937Thioredoxin_CS
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
GO:0006457protein folding
GO:0018401peptidyl-proline hydroxylation to 4-hydroxy-L-proline
GO:0030968endoplasmic reticulum unfolded protein response
GO:0043412macromolecule modification
GO:0055114oxidation-reduction process
GO:0080058protein deglutathionylation
GO:1902175regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0003810protein-glutamine gamma-glutamyltransferase activity
GO:0016853isomerase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
GO:0016222procollagen-proline 4-dioxygenase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 117..145
e-value: 8.5E-7
score: 28.9
coord: 1..79
e-value: 5.7E-25
score: 87.3
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 1..86
score: 12.826
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 1..92
e-value: 1.6E-29
score: 104.8
coord: 96..145
e-value: 3.4E-11
score: 45.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 109..145
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 1..83
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 92..117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 94..117
NoneNo IPR availablePANTHERPTHR45815FAMILY NOT NAMEDcoord: 1..94
coord: 112..145
NoneNo IPR availableCDDcd03001PDI_a_P5coord: 1..81
e-value: 1.12052E-53
score: 162.841