Tubulin beta chain

Overview
NameTubulin beta chain
Smed IDSMED30017429
Length (bp)745
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017429

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30017429SMESG000000234.1 SMESG000000199.1 PL06022B2C01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30017429SMESG000000234.1 SMESG000000199.1 PL06022B2C01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30017429SMESG000000234.1 SMESG000000199.1 PL06022B2C01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30017429SMESG000000234.1 SMESG000000199.1 PL08009A1H09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30017429SMESG000000234.1 SMESG000000199.1 PL08009A1H09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30017429SMESG000000234.1 SMESG000000199.1 PL08009A1H09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 385.956 bits (990), Expect = 6.864e-135
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   30 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 278          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 385.956 bits (990), Expect = 6.864e-135
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   30 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 278          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 385.956 bits (990), Expect = 6.864e-135
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   30 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 278          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 385.956 bits (990), Expect = 6.864e-135
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   30 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 278          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 385.956 bits (990), Expect = 6.864e-135
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   30 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 278          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 384.415 bits (986), Expect = 1.030e-133
Identity = 183/249 (73.49%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKEAE CDCLQGFQ+ HS+GGG G GMGTLL+ +I++EYPDRI +TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y++++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDNVLDVVRKEAESCDCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSMTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 380.563 bits (976), Expect = 4.581e-132
Identity = 181/249 (72.69%), Postives = 217/249 (87.15%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKEAEGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  +FSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PL+++G Q Y+ ++V  L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSMREV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 380.563 bits (976), Expect = 4.581e-132
Identity = 181/249 (72.69%), Postives = 217/249 (87.15%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKEAEGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  +FSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PL+++G Q Y+ ++V  L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSMREV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 380.563 bits (976), Expect = 4.581e-132
Identity = 181/249 (72.69%), Postives = 217/249 (87.15%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKEAEGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  +FSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PL+++G Q Y+ ++V  L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSMREV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 380.563 bits (976), Expect = 4.581e-132
Identity = 181/249 (72.69%), Postives = 217/249 (87.15%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKEAEGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  +FSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PL+++G Q Y+ ++V  L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSMREV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 386.726 bits (992), Expect = 1.874e-134
Identity = 187/249 (75.10%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKE+EGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  NIQNKNS +FVEWIPNN K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCK 350          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 384.8 bits (987), Expect = 1.197e-133
Identity = 186/249 (74.70%), Postives = 218/249 (87.55%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  T+SV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  NIQNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086537)

HSP 1 Score: 383.645 bits (984), Expect = 3.713e-133
Identity = 186/249 (74.70%), Postives = 218/249 (87.55%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  T+SV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  NIQNKNS YFVEWIPNN+K
Sbjct:  111 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVK 359          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0072270)

HSP 1 Score: 379.793 bits (974), Expect = 1.232e-131
Identity = 183/249 (73.49%), Postives = 217/249 (87.15%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKE E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  T+SV PSPKVSD VVEPYNA LSIH +++ +DET  IDNEAL+DIC  TLK++ PSYGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ   +QNKNS YFVEWIPNN+K
Sbjct:  108 AKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVK 356          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 379.793 bits (974), Expect = 1.389e-131
Identity = 183/249 (73.49%), Postives = 217/249 (87.15%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKE E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  T+SV PSPKVSD VVEPYNA LSIH +++ +DET  IDNEAL+DIC  TLK++ PSYGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ   +QNKNS YFVEWIPNN+K
Sbjct:  107 AKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVK 355          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb2b (tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-722])

HSP 1 Score: 389.808 bits (1000), Expect = 1.591e-135
Identity = 188/249 (75.50%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  PSYGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y++++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPSYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:153426 (zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220])

HSP 1 Score: 389.037 bits (998), Expect = 2.746e-135
Identity = 187/249 (75.10%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+++SVP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLSVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb4b (tubulin, beta 4B class IVb [Source:ZFIN;Acc:ZDB-GENE-030131-8625])

HSP 1 Score: 387.497 bits (994), Expect = 1.251e-134
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 387.497 bits (994), Expect = 1.351e-134
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 387.497 bits (994), Expect = 1.351e-134
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 388.652 bits (997), Expect = 1.785e-135
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   65 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 313          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 389.037 bits (998), Expect = 4.460e-135
Identity = 188/249 (75.50%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+DSKNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 388.652 bits (997), Expect = 5.140e-135
Identity = 187/249 (75.10%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SVMD++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y++++VP L QQM+DSKNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVMDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 387.497 bits (994), Expect = 1.904e-134
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 385.185 bits (988), Expect = 1.230e-133
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2a (tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:MGI:107861])

HSP 1 Score: 387.882 bits (995), Expect = 9.421e-135
Identity = 187/249 (75.10%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+DSKNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 387.882 bits (995), Expect = 1.017e-134
Identity = 187/249 (75.10%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+DSKNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 387.111 bits (993), Expect = 1.957e-134
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 385.185 bits (988), Expect = 9.317e-134
Identity = 185/249 (74.30%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4a (tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:MGI:107848])

HSP 1 Score: 380.948 bits (977), Expect = 5.759e-132
Identity = 182/249 (73.09%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++E+PDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  ++Q+KNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P41386|TBB_HALDI (Tubulin beta chain (Fragment) OS=Haliotis discus OX=36094 PE=2 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 1.902e-135
Identity = 187/249 (75.10%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   28 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 276          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q9NFZ6|TBB2_ECHMU (Tubulin beta-2 chain OS=Echinococcus multilocularis OX=6211 GN=TUB-2 PE=3 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 6.308e-135
Identity = 187/249 (75.10%), Postives = 221/249 (88.76%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI +T+SV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK++ P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ +SVP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVIRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMVTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLSNPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q9YHC3|TBB1_GADMO (Tubulin beta-1 chain OS=Gadus morhua OX=8049 PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.879e-134
Identity = 188/249 (75.50%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  PSYGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y++++VP L QQM+D KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPSYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDGKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P36221|TBB1_NOTNE (Tubulin beta-1 chain OS=Notothenia neglecta OX=202063 GN=tubb1 PE=1 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 3.903e-134
Identity = 188/249 (75.50%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAEGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFF+PGF PLTSRG Q Y++++VP L QQM+DSKNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGGQQYRSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNAQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P11833|TBB_PARLI (Tubulin beta chain OS=Paracentrotus lividus OX=7656 PE=2 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 5.473e-134
Identity = 187/249 (75.10%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. TrEMBL
Match: E0V911 (Tubulin beta chain OS=Pediculus humanus subsp. corporis OX=121224 GN=8233345 PE=3 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.725e-134
Identity = 190/248 (76.61%), Postives = 219/248 (88.31%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SVMD++RKEAEGCDCLQGFQL HS+GGG G G+GTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LSIH +++ +DET  IDNEAL+DIC  TLKI P+YGDLNHL+S+TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  NIQNKNS YFVEWIPNN+K
Sbjct:   88 AKGHYTEGAELVDSVMDVVRKEAEGCDCLQGFQLTHSLGGGTGSGLGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVEHTDETYCIDNEALYDICYRTLKITPTYGDLNHLVSSTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGCQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVK 335          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A4U5UTV9 (Tubulin beta chain OS=Collichthys lucidus OX=240159 GN=D9C73_013147 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 3.630e-134
Identity = 189/249 (75.90%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  PSYGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y++++VP L QQM+DSKNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   30 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPSYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 278          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A2R5L8H5 (Tubulin beta chain (Fragment) OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 3.702e-134
Identity = 190/249 (76.31%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAEGCDCLQGFQLAHS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ +SVP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSMREV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   83 AKGHYTEGAELVDSVLDVVRKEAEGCDCLQGFQLAHSLGGGTGSGMGTLLISKIREEYPDRIMTTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVK 331          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A0C9SCB7 (Tubulin beta chain (Fragment) OS=Amblyomma americanum OX=6943 PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 4.674e-134
Identity = 188/249 (75.50%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAEGCDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ +SVP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSMREV++Q  N+QNKNS YFVEWIPNN+K
Sbjct:   31 AKGHYTEGAELVDSVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMREVDDQMLNVQNKNSSYFVEWIPNNVK 279          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A0P5ECB1 (Tubulin beta chain OS=Daphnia magna OX=35525 PE=3 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.292e-133
Identity = 187/249 (75.10%), Postives = 220/249 (88.35%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKI-APSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQLAHS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+ +P+YGDLNHL+S TM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLT+RG+Q Y+ +SVP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   22 AKGHYTEGAELVDSVLDVVRKEAENCDCLQGFQLAHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTSPTYGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 270          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 385.571 bits (989), Expect = 3.430e-135
Identity = 184/249 (73.90%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   21 AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 269          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 387.111 bits (993), Expect = 1.249e-134
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 387.882 bits (995), Expect = 1.337e-133
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ +SVP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  ++QNKNS YFVEWIPNN+K
Sbjct:  179 AKGHYTEGAELVDSVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLSVQNKNSSYFVEWIPNNVK 427          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 362.459 bits (929), Expect = 7.472e-125
Identity = 175/249 (70.28%), Postives = 209/249 (83.94%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+E V+D +R EAE CDCLQGFQ  HS+GGG G GMGTL++ +I++EYPDRI  +FS+ PSPKVSD VVEPYNA LSIH +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+S TM GVTT  RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLT+RG+Q Y+ ++VP L QQM+D++NMM ACDPR G+YLT +GIFRGRMS +EV+EQ   IQ KNS YFV+WIP+N+K
Sbjct:   76 AKGHYTEGAELVEQVVDRVRNEAESCDCLQGFQFVHSLGGGTGSGMGTLIINKIREEYPDRIMNSFSIMPSPKVSDTVVEPYNATLSIHQLIENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDARNMMTACDPRRGRYLTVAGIFRGRMSTKEVDEQMLAIQQKNSNYFVDWIPHNVK 324          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000025205.2 (tubulin alpha-8 chain-like [Source:NCBI gene;Acc:103041851])

HSP 1 Score: 208.764 bits (530), Expect = 8.170e-65
Identity = 103/249 (41.37%), Postives = 158/249 (63.45%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            A+GHYT G E+++SV+D +RK A+ C  LQGF + HS GGG G G  +LL++R+  +Y  +  + FSVYP+P+VS  VVEPYN++L+ H  L+ SD + ++DNEA+FD+C+  L I  PSY +LN LI+  +  +T   RF G LN DL +   N+VP+PR+HF +  + P+ S     ++ +SV  +    ++  N M  CDPR+GKY+ C  ++RG +  ++V     +I+ + S  FV+W P   K
Sbjct:  103 ARGHYTIGKEIVDSVLDRMRKMADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIFDLCKRNLDIERPSYNNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNSCFEPTNQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIASIKTRRSIQFVDWCPTGFK 351          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 368.237 bits (944), Expect = 6.983e-129
Identity = 182/252 (72.22%), Postives = 216/252 (85.71%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVY---PSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EY   I + ++V    PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+DSKNMMAACDPR+G+YLT + IFRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   84 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYI--IQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 333          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 201.445 bits (511), Expect = 1.212e-63
Identity = 98/247 (39.68%), Postives = 153/247 (61.94%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNN 739
            A+GHYT G E+++ V+D +RK A+ C  LQGF + HS GGG G G  +LL++R+  +Y  +  + F++YP+P+VS  VVEPYN++L+ H  L+ SD   ++DNEA++DIC+  L I  P+Y +LN LI   +  +T   RF G LN DL +   N+VP+PR+HF +  + P+ S     ++ +SV  +    ++  N M  CDPR+GKY+ C  ++RG +  ++V      I+ K +  FV+W P  
Sbjct:  104 ARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.652 bits (470), Expect = 1.486e-57
Identity = 94/246 (38.21%), Postives = 147/246 (59.76%), Query Frame = 2
Query:    5 KGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNN 739
            +G    G ++   V+   R ++E C  LQGF L HS GGG G G  +LL++R+  +Y  +  + F +YP+P+VS  VVEPYNA+L+ H  L+ SD + ++DNEA++DIC+  L I  PSY +LN LI+  +  +T   RF G LN DL +   N+VP+PR+HF +  + P+ S     ++ +SV  +    ++  N M  CDPRNGKY+ C  ++RG +  ++V      I+++ +  FV+W P  
Sbjct:  110 RGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTG 355          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.550e-36
Identity = 86/266 (32.33%), Postives = 143/266 (53.76%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDIC-------------QNTLKIAPSYG----------DLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQN-KNSRYFVEW 727
            A G+   GA+  E +++ LR  AE CD LQ F L HS+GGG G G+GT +L+ ++DE+PD      ++YPS +  DVV  PYN+VL++  + + +D  + I+N+AL DI              ++   ++ S+G           +N++++  M  +T+  RF G LN DL ++ +N+VPFPRLH+ +    PL +  +       +  +    +  +N +   DPR   YL C+ + RG + + +V     NI+  K S +FV+W
Sbjct:  114 AVGNKVYGAQFREKILERLRVTAEHCDSLQCFFLIHSMGGGTGSGLGTFVLRLLEDEFPDVHRFVMALYPSAE-DDVVTSPYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKPFDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRR---NIERLKPSLHFVDW 375          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 128.257 bits (321), Expect = 6.980e-35
Identity = 77/254 (30.31%), Postives = 136/254 (53.54%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSP-KVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTS-RGNQPYKNISVPSLVQQMYDSKNMMAACD---PRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            A GH ++G ++ E + DI+ +EA+G D L+   L   +       +     +     +P ++  T+SV+P+  ++SDVVV+PYN++L++  +   +D  VV+DN AL  I  + L I  PS+  +N L+S  M   TT  R+PG +N DL  L  +++P PRLHF M G+ PLT+ +     +  +V  +++++   KN+M +       N  Y+    I +G +   +V +    I+ +    F+ W P +I+
Sbjct:  105 ASGH-SQGEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATNWNELCKYFCR-----FPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQ 352          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 352.058 bits (902), Expect = 1.912e-121
Identity = 166/249 (66.67%), Postives = 213/249 (85.54%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKI-APSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SVMD++R+EAEGCD LQGFQ+ HS+GGG G GMGTLL+ +I++E+PDR+  TFSV PSPK SD VVEPYNA LS+H +++ SDET  IDNEAL+DICQ TLK+  PSYGDLN+L+S+ M GVTT  R+PGQLN+DLRKLAVN+VPFPRLHFFM G+ PLT+ G+Q +++++VP L QQM+D+KNMMAA DPRNG+YLT +  FRG++S++EVE++   +Q+KNS YFVEWIPNN++
Sbjct:  102 AKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQ 350          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 197.593 bits (501), Expect = 2.656e-61
Identity = 104/249 (41.77%), Postives = 158/249 (63.45%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            A+GHYT G E+L  V+D +RK A+ CD LQGF   HS+GGG G G+G+LLL+ +  EY  +  + F+VYP+P+VS  VVEPYN VL+ H  L+ +D T ++DNEA++D+C+  L I  PS+ +LN+LI+  +  VT   RF G LN DL +   N+VP+PR+HF +  + P+ S+    +++ SV  +    ++  N M  CDPR+GKY+    ++RG +  R+V+     ++NK +   V+W P   K
Sbjct:  105 ARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFK 353          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 193.741 bits (491), Expect = 6.435e-60
Identity = 101/249 (40.56%), Postives = 156/249 (62.65%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            A+GHYT G E+++ V + +RK A+ CD LQGF   HS+GGG G G+G+LLL+ +  EY  +  + F+VYP+P++S  VVEPYN VL+ H  L+ +D T ++DNEA++DIC+  L I+ PS+ +LN LI+  +  VT   RF G LN DL +   N+VP+PR+HF +  + P+ S+    +++ SV  +    ++  N M  CDP  GKY+    ++RG +  R+V+     ++NK +   V+W P   K
Sbjct:  105 ARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFK 353          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 108.227 bits (269), Expect = 1.043e-27
Identity = 73/236 (30.93%), Postives = 121/236 (51.27%), Query Frame = 2
Query:   14 YTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNH---LISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTS---RGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNK 703
            Y  G    + +++ + KE +  D  +GFQL HS+ GG G G+G+ LL+ + D YP +I  T+SV+P+ + S+VVV+ YN +L++  +++ SD TVV DN +L +I     +  P+  DL H   LIS  +  VT   RFP  + + +  +   ++P P LHF  P F P TS     +  +K  S   ++  + D  N + +    N  Y        G +  R++      +Q +
Sbjct:  109 YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFR-NPNI-DLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQR 341          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO36734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY4])

HSP 1 Score: 388.652 bits (997), Expect = 6.694e-137
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   12 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 260          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 386.726 bits (992), Expect = 8.969e-135
Identity = 186/249 (74.70%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 385.185 bits (988), Expect = 2.759e-134
Identity = 184/249 (73.90%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDC+QGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFS+ PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELMDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 383.259 bits (983), Expect = 1.419e-133
Identity = 181/249 (72.69%), Postives = 216/249 (86.75%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKEAE CDC+QGFQL HS+GGG G GM TLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRL FFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDP +G+YLT + +FRGRMSM+E++EQ  N+QNKNS YFVEWIPNN+K
Sbjct:   98 AKGHYTEGAELVDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLPFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPLHGRYLTVAAMFRGRMSMKELDEQMLNVQNKNSSYFVEWIPNNVK 346          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO49518 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG3])

HSP 1 Score: 346.665 bits (888), Expect = 4.544e-119
Identity = 166/249 (66.67%), Postives = 203/249 (81.53%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHY+EGAEL++++ D+LRKEAE CDC+QG QL  ++GGG G G+GTL+L +I++EYPDRI   FSV PSPKVS+ VVEPYNA LS+H +++  DE  + DNEAL+DIC  TLK+A P+Y DLN L+S  M G+T   RFPGQLN DLRKLAVNMVPFPRLHFFMPGF PL SR NQ Y+N+SV  L QQM+D++NMM ACDPR+G+YLT + IFRG+MSMREV+EQ  N QNKNS +FVEWIPNN+K
Sbjct:  104 AKGHYSEGAELIDNIFDVLRKEAENCDCMQGVQLIQALGGGTGSGLGTLILSKIREEYPDRILSAFSVVPSPKVSETVVEPYNATLSVHQLVEVVDEDFMFDNEALYDICCRTLKLAKPNYADLNQLVSMAMCGLTASLRFPGQLNGDLRKLAVNMVPFPRLHFFMPGFAPLASRANQQYQNVSVEELTQQMFDARNMMTACDPRHGRYLTVAAIFRGKMSMREVDEQMLNTQNKNSPFFVEWIPNNVK 352          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 387.497 bits (994), Expect = 1.367e-134
Identity = 187/249 (75.10%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+++V+D++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ +SVP L QQM+D+KNMMAACDPR+G+YLT + IFRGRMSMREV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDAVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 383.645 bits (984), Expect = 3.004e-133
Identity = 184/249 (73.90%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+D++RKE+E CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQ++D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNN+K
Sbjct:  102 AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 360.918 bits (925), Expect = 8.087e-124
Identity = 174/249 (69.88%), Postives = 209/249 (83.94%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL+E V+D +R E+EGCDCLQGFQL HS+GGG G GMGTL++ +IK+E+PDRI  TFS+ PSPKVSD VVEPYNA LS+H +L+ +D T  IDNEAL+DIC  TLK+  P+YGDLNHL+  TM GVTT  RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLT+RG+Q Y+ ++VP L QQM+D++NMM ACDPR G+YLT +GIFRG+MS +EV+EQ   IQ KNS YFV+WIP+N+K
Sbjct:  102 AKGHYTEGAELVEQVVDRVRHESEGCDCLQGFQLVHSLGGGTGSGMGTLIINKIKEEFPDRIMNTFSIMPSPKVSDTVVEPYNATLSVHQLLENADATFCIDNEALYDICFRTLKLTTPTYGDLNHLVCMTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDARNMMTACDPRRGRYLTVAGIFRGKMSTKEVDEQMLAIQQKNSTYFVDWIPHNVK 350          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000034480.1 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 209.149 bits (531), Expect = 1.633e-65
Identity = 104/249 (41.77%), Postives = 155/249 (62.25%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            A+GHYT G EL++ V+D +RK A+ C  LQGF + HS GGG G G  +LL++R+  +Y  +  + FS+YP+P+VS  VVEPYN++L+ H  L+ SD   ++DNEA++DIC+  L I  PSY +LN LIS  +  +T   RF G LN DL +   N+VP+PR+HF +  + P+ S     ++ +SV  +    ++  N M  CDPR+GKY+ C  ++RG +  ++V      I+ K S  FV+W P   K
Sbjct:   52 ARGHYTIGKELIDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFK 300          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000017746.2 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 208.764 bits (530), Expect = 3.764e-65
Identity = 104/249 (41.77%), Postives = 155/249 (62.25%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            A+GHYT G EL++ V+D +RK A+ C  LQGF + HS GGG G G  +LL++R+  +Y  +  + FS+YP+P+VS  VVEPYN++L+ H  L+ SD   ++DNEA++DIC+  L I  PSY +LN LIS  +  +T   RF G LN DL +   N+VP+PR+HF +  + P+ S     ++ +SV  +    ++  N M  CDPR+GKY+ C  ++RG +  ++V      I+ K S  FV+W P   K
Sbjct:  104 ARGHYTIGKELIDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFK 352          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000000199.1 (SMESG000000199.1)

HSP 1 Score: 498.049 bits (1281), Expect = 1.406e-178
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIGGGCGGGMGTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK
Sbjct:  110 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIGGGCGGGMGTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 357          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000000234.1 (SMESG000000234.1)

HSP 1 Score: 496.893 bits (1278), Expect = 2.614e-178
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIGGGCGGGMGTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK
Sbjct:  110 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIGGGCGGGMGTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 357          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000047284.1 (SMESG000047284.1)

HSP 1 Score: 388.267 bits (996), Expect = 3.288e-135
Identity = 188/249 (75.50%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+DI+RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNNIK
Sbjct:   96 AKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNIK 344          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000046374.1 (SMESG000046374.1)

HSP 1 Score: 388.267 bits (996), Expect = 3.288e-135
Identity = 188/249 (75.50%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+DI+RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNNIK
Sbjct:   96 AKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNIK 344          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000047284.1 (SMESG000047284.1)

HSP 1 Score: 388.267 bits (996), Expect = 3.435e-135
Identity = 188/249 (75.50%), Postives = 219/249 (87.95%), Query Frame = 2
Query:    2 AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIXXXXXXXXXTLLLQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVVIDNEALFDICQNTLKIA-PSYGDLNHLISATMGGVTTCFRFPGQLNADLRKLAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAACDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK 745
            AKGHYTEGAEL++SV+DI+RKEAE CDCLQGFQL HS+GGG G GMGTLL+ +I++EYPDRI  TFSV PSPKVSD VVEPYNA LS+H +++ +DET  IDNEAL+DIC  TLK+  P+YGDLNHL+SATM GVTTC RFPGQLNADLRKLAVNMVPFPRLHFFMPGF PLTSRG+Q Y+ ++VP L QQM+D+KNMMAACDPR+G+YLT + +FRGRMSM+EV+EQ  N+QNKNS YFVEWIPNNIK
Sbjct:  102 AKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNIK 350          
The following BLAST results are available for this feature:
BLAST of Tubulin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB6.864e-13574.30tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB6.864e-13574.30tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB6.864e-13574.30tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB6.864e-13574.30tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB6.864e-13574.30tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbb-41.030e-13373.49Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-24.581e-13272.69Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-24.581e-13272.69Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-24.581e-13272.69Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-24.581e-13272.69Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub85D1.874e-13475.10gene:FBgn0003889 transcript:FBtr0082046[more]
betaTub56D1.197e-13374.70gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub56D3.713e-13374.70gene:FBgn0284243 transcript:FBtr0086537[more]
betaTub60D1.232e-13173.49gene:FBgn0003888 transcript:FBtr0072270[more]
betaTub60D1.389e-13173.49gene:FBgn0003888 transcript:FBtr0343443[more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb2b1.591e-13575.50tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
zgc:1534262.746e-13575.10zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220][more]
tubb4b1.251e-13474.70tubulin, beta 4B class IVb [Source:ZFIN;Acc:ZDB-GE... [more]
zgc:554611.351e-13474.70zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554611.351e-13474.70zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reps21.785e-13574.70RALBP1 associated Eps domain containing 2 [Source:... [more]
znf3304.460e-13575.50zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
ubxn115.140e-13575.10UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
reps21.904e-13474.70RALBP1 associated Eps domain containing 2 [Source:... [more]
tubb1.230e-13374.30tubulin beta class I [Source:NCBI gene;Acc:448742][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb2a9.421e-13575.10tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:... [more]
Tubb2b1.017e-13475.10tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb4b1.957e-13474.70tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb59.317e-13474.30tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb4a5.759e-13273.09tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41386|TBB_HALDI1.902e-13575.10Tubulin beta chain (Fragment) OS=Haliotis discus O... [more]
sp|Q9NFZ6|TBB2_ECHMU6.308e-13575.10Tubulin beta-2 chain OS=Echinococcus multiloculari... [more]
sp|Q9YHC3|TBB1_GADMO1.879e-13475.50Tubulin beta-1 chain OS=Gadus morhua OX=8049 PE=2 ... [more]
sp|P36221|TBB1_NOTNE3.903e-13475.50Tubulin beta-1 chain OS=Notothenia neglecta OX=202... [more]
sp|P11833|TBB_PARLI5.473e-13475.10Tubulin beta chain OS=Paracentrotus lividus OX=765... [more]
back to top
BLAST of Tubulin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E0V9111.725e-13476.61Tubulin beta chain OS=Pediculus humanus subsp. cor... [more]
A0A4U5UTV93.630e-13475.90Tubulin beta chain OS=Collichthys lucidus OX=24015... [more]
A0A2R5L8H53.702e-13476.31Tubulin beta chain (Fragment) OS=Ornithodoros turi... [more]
A0A0C9SCB74.674e-13475.50Tubulin beta chain (Fragment) OS=Amblyomma america... [more]
A0A0P5ECB11.292e-13375.10Tubulin beta chain OS=Daphnia magna OX=35525 PE=3 ... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019550.23.430e-13573.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zgc:554611.249e-13474.70tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB2A1.337e-13374.70tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
TUBB17.472e-12570.28tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000025205.28.170e-6541.37tubulin alpha-8 chain-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb26.983e-12972.22tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
TUBA3C1.212e-6339.68tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.11.486e-5738.21pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
ENSPMAT00000001368.11.550e-3632.33pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubg16.980e-3530.31tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB21.912e-12166.67Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB12.656e-6141.77Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB36.435e-6040.56Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB41.043e-2730.93Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367346.694e-13774.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399458.969e-13574.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359582.759e-13473.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428901.419e-13372.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495184.544e-11966.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb21.367e-13475.10tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
tubb53.004e-13373.90tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
ENSORLT00000045809.18.087e-12469.88tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
ENSORLT00000034480.11.633e-6541.77tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000017746.23.764e-6541.77tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000199.11.406e-178100.00SMESG000000199.1[more]
SMESG000000234.12.614e-178100.00SMESG000000234.1[more]
SMESG000047284.13.288e-13575.50SMESG000047284.1[more]
SMESG000046374.13.288e-13575.50SMESG000046374.1[more]
SMESG000047284.13.435e-13575.50SMESG000047284.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017429 ID=SMED30017429|Name=Tubulin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=745bp
GGCTAAAGGACATTATACCGAAGGGGCGGAATTGTTAGAATCAGTAATGG
ATATTTTAAGAAAGGAAGCAGAAGGATGTGATTGTTTACAGGGTTTTCAA
TTAGCTCATTCAATTGGTGGTGGTTGTGGAGGGGGCATGGGTACTTTGTT
ATTGCAGAGAATAAAAGATGAATATCCAGATCGAATCAACATTACATTTT
CTGTTTATCCGTCTCCAAAAGTATCAGACGTAGTTGTCGAACCTTACAAT
GCTGTTTTATCAATTCACTTGATGCTGGATTTTTCCGACGAAACTGTTGT
CATTGATAATGAAGCGTTGTTTGATATCTGTCAGAATACTTTAAAGATTG
CTCCATCATACGGGGATCTGAATCATTTAATATCTGCTACAATGGGAGGC
GTAACGACATGCTTCAGATTTCCTGGCCAGTTAAATGCTGATCTTCGGAA
ATTAGCTGTGAATATGGTACCCTTTCCCAGATTACACTTTTTTATGCCCG
GATTTGTTCCTTTGACATCTAGGGGTAATCAACCATACAAAAACATTAGT
GTGCCTTCTTTGGTTCAACAGATGTATGATTCAAAAAATATGATGGCAGC
ATGCGATCCAAGAAACGGAAAGTATTTGACCTGTTCCGGTATTTTTCGAG
GCAGAATGAGTATGAGAGAAGTAGAAGAACAGCAATGGAATATTCAAAAT
AAAAACTCACGCTATTTTGTCGAATGGATTCCTAACAATATTAAA
back to top

protein sequence of SMED30017429-orf-1

>SMED30017429-orf-1 ID=SMED30017429-orf-1|Name=SMED30017429-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
AKGHYTEGAELLESVMDILRKEAEGCDCLQGFQLAHSIGGGCGGGMGTLL
LQRIKDEYPDRINITFSVYPSPKVSDVVVEPYNAVLSIHLMLDFSDETVV
IDNEALFDICQNTLKIAPSYGDLNHLISATMGGVTTCFRFPGQLNADLRK
LAVNMVPFPRLHFFMPGFVPLTSRGNQPYKNISVPSLVQQMYDSKNMMAA
CDPRNGKYLTCSGIFRGRMSMREVEEQQWNIQNKNSRYFVEWIPNNIK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR002453Beta_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR003008Tubulin_FtsZ_GTPase
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 7..25
score: 66.86
coord: 143..156
score: 89.06
coord: 51..63
score: 47.16
coord: 245..248
score: 12.17
coord: 209..227
score: 66.68
coord: 110..122
score: 30.64
coord: 163..179
score: 71.93
coord: 227..241
score: 70.32
coord: 128..137
score: 73.71
IPR000217TubulinPRINTSPR01161TUBULINcoord: 50..71
score: 48.0
coord: 89..109
score: 50.3
coord: 75..88
score: 71.28
coord: 31..49
score: 65.03
coord: 5..29
score: 58.08
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..248
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 1..142
e-value: 1.3E-23
score: 94.4
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 1..111
e-value: 5.1E-36
score: 124.7
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 144..248
e-value: 6.2E-16
score: 68.9
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 159..248
e-value: 1.2E-27
score: 96.6
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..161
e-value: 7.9E-67
score: 227.4
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..141
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 162..248
e-value: 2.5E-38
score: 132.6
NoneNo IPR availablePANTHERPTHR11588:SF295coord: 1..248
NoneNo IPR availableCDDcd02187beta_tubulincoord: 1..248
e-value: 2.20615E-158
score: 444.317
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 142..248