G_PROTEIN_RECEP_F3_4 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F3_4 domain-containing protein
Smed IDSMED30017424
Length (bp)2608
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F3_4 domain-containing protein (SMED30017424) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F3_4 domain-containing protein (SMED30017424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F3_4 domain-containing protein (SMED30017424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F3_4 domain-containing protein (SMED30017424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017424SMESG000024293.1 SmedASXL_009054SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30017424SMESG000024293.1 dd_Smed_v4_8408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017424SMESG000024293.1 dd_Smed_v4_8408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017424SMESG000024293.1 dd_Smed_v6_8408_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017424SMESG000024293.1 OX_Smed_1.0.10876ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GPR158 (G protein-coupled receptor 158 [Source:HGNC Symbol;Acc:HGNC:23689])

HSP 1 Score: 237.269 bits (604), Expect = 1.799e-64
Identity = 146/483 (30.23%), Postives = 251/483 (51.97%), Query Frame = 2
Query:  923 VYSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGF----PGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            +Y  Q +L  +   ++  + N+ +  +DQC+      G H+C    + C+     K   F +G Y C C++ F+       N F    P Q +    +++           Y C PC+EGC  C    PC V QE K LR   ++ Q+ C+ +  V+ ++++  R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  + R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V++++    LI W ++    +N ++  +   + K +   ++LI  +C    W+ ++ + E   L   +Y C  V++ PS + E R++ +AV NELIIS +    R  +  ++  D++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  210 IYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPI---KGLGFVLGAYECICKAGFYHPGVLPVNNFRRRGPDQHISGSTKDVSEE-------AYVCLPCREGCPFCADDSPCFV-QEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVC--QNLEKQISLIGQGKTS---DHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 669          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GPR158 (G protein-coupled receptor 158 [Source:HGNC Symbol;Acc:HGNC:23689])

HSP 1 Score: 236.113 bits (601), Expect = 5.205e-64
Identity = 146/483 (30.23%), Postives = 251/483 (51.97%), Query Frame = 2
Query:  923 VYSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGF----PGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            +Y  Q +L  +   ++  + N+ +  +DQC+      G H+C    + C+     K   F +G Y C C++ F+       N F    P Q +    +++           Y C PC+EGC  C    PC V QE K LR   ++ Q+ C+ +  V+ ++++  R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  + R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V++++    LI W ++    +N ++  +   + K +   ++LI  +C    W+ ++ + E   L   +Y C  V++ PS + E R++ +AV NELIIS +    R  +  ++  D++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  289 IYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPI---KGLGFVLGAYECICKAGFYHPGVLPVNNFRRRGPDQHISGSTKDVSEE-------AYVCLPCREGCPFCADDSPCFV-QEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVC--QNLEKQISLIGQGKTS---DHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 748          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GPR179 (G protein-coupled receptor 179 [Source:HGNC Symbol;Acc:HGNC:31371])

HSP 1 Score: 191.43 bits (485), Expect = 3.532e-49
Identity = 141/466 (30.26%), Postives = 222/466 (47.64%), Query Frame = 2
Query:  965 IYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNN--PVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQR-VYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT-ESHI-IQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQ 2329
            +  + ++    ++QCA G       H C   +T C+     +SQ F +G Y C+CR  F+ +         G   E+++Q       P G      QC PC EGC +C    PC V +E  +LR   LA Q+ C+    ++ ++ ++ RR + I  S  +LLE  LFG +L+Y  +   YF P+   C    ++R  GF ++YG + +K+YRVL  F SR AQR   +    +LR LG+L++  +G L  W     +                 +   YL    C    W+ +  + E  LL    + C   ++  S + E R++ IA+ NEL++S      R  ++  +HPD+  L+ F H H+T T ++ L+  PK W L  PP     R  +V    E  + +Q      G       +   +D   IRDELK+LY QLE++KT+ M  +NPH+ +KRG   Q
Sbjct:  268 VQMDVDLQSVDINQCASGPGWYSNTHLCDLNSTQCVPL---ESQGFVLGRYLCRCRPGFYGASPS------GGLEESDFQTTGQFGFPEGRSGRLLQCLPCPEGCTSCMDATPCLV-EEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLETVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQRSALLSSGRLLRRLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHF-YL----CHHDRWDYIMVVAELLLLCWGSFLCYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVPSLHPDWTLLLFFFHTHSTVTTTLALIFIPKFWKLGAPP-----REEMVDEVCEDELDLQHSGSYLGSSIASAWSEHSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRGSSCQ 713          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GPR179 (G protein-coupled receptor 179 [Source:HGNC Symbol;Acc:HGNC:31371])

HSP 1 Score: 189.504 bits (480), Expect = 1.362e-48
Identity = 138/465 (29.68%), Postives = 219/465 (47.10%), Query Frame = 2
Query:  965 IYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNN--PVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT-ESHI-IQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQ 2329
            +  + ++    ++QCA G       H C   +T C+     +SQ F +G Y C+CR  F+ +         G   E+++Q       P G      QC PC EGC +C    PC V +E  +LR   LA Q+ C+    ++ ++ ++ RR + I  S  +LLE  LFG +L+Y  +   YF P+   C    ++R  GF ++YG + +K+YRVL  F SR AQR  +     L     L+++ +   +A    G   R  +           +    YL    C    W+ +  + E  LL    + C   ++  S + E R++ IA+ NEL++S      R  ++  +HPD+  L+ F H H+T T ++ L+  PK W L  PP     R  +V    E  + +Q      G       +   +D   IRDELK+LY QLE++KT+ M  +NPH+ +KRG   Q
Sbjct:  268 VQMDVDLQSVDINQCASGPGWYSNTHLCDLNSTQCVPL---ESQGFVLGRYLCRCRPGFYGASPS------GGLEESDFQTTGQFGFPEGRSGRLLQCLPCPEGCTSCMDATPCLV-EEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLETVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQRSALLSSGRLLRHLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHFYL----CHHDRWDYIMVVAELLLLCWGSFLCYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVPSLHPDWTLLLFFFHTHSTVTTTLALIFIPKFWKLGAPP-----REEMVDEVCEDELDLQHSGSYLGSSIASAWSEHSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRGSSCQ 713          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GPR179 (G protein-coupled receptor 179 [Source:HGNC Symbol;Acc:HGNC:31371])

HSP 1 Score: 189.504 bits (480), Expect = 1.363e-48
Identity = 138/465 (29.68%), Postives = 219/465 (47.10%), Query Frame = 2
Query:  965 IYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNN--PVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT-ESHI-IQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQ 2329
            +  + ++    ++QCA G       H C   +T C+     +SQ F +G Y C+CR  F+ +         G   E+++Q       P G      QC PC EGC +C    PC V +E  +LR   LA Q+ C+    ++ ++ ++ RR + I  S  +LLE  LFG +L+Y  +   YF P+   C    ++R  GF ++YG + +K+YRVL  F SR AQR  +     L     L+++ +   +A    G   R  +           +    YL    C    W+ +  + E  LL    + C   ++  S + E R++ IA+ NEL++S      R  ++  +HPD+  L+ F H H+T T ++ L+  PK W L  PP     R  +V    E  + +Q      G       +   +D   IRDELK+LY QLE++KT+ M  +NPH+ +KRG   Q
Sbjct:  269 VQMDVDLQSVDINQCASGPGWYSNTHLCDLNSTQCVPL---ESQGFVLGRYLCRCRPGFYGASPS------GGLEESDFQTTGQFGFPEGRSGRLLQCLPCPEGCTSCMDATPCLV-EEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLETVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQRSALLSSGRLLRHLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHFYL----CHHDRWDYIMVVAELLLLCWGSFLCYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVPSLHPDWTLLLFFFHTHSTVTTTLALIFIPKFWKLGAPP-----REEMVDEVCEDELDLQHSGSYLGSSIASAWSEHSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRGSSCQ 714          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: F39B2.8 (pep chromosome:WBcel235:I:14760644:14768980:-1 gene:WBGene00009558.1 transcript:F39B2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39B2.8)

HSP 1 Score: 184.882 bits (468), Expect = 2.505e-49
Identity = 122/385 (31.69%), Postives = 198/385 (51.43%), Query Frame = 2
Query: 1310 RGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT-ESHIIQTQQK---LNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK--------QRRFSLQHFHKKHHATSVHDDETSKIS-EDSPGN 2425
            R + LA  S C  +CI   I I   +R R  +   W L+ELFL GA ++Y  +   +  P E  C +  +LR+ GF + YG + +K+YR L  ++ RKAQ V VR+QD+L+YL  ++ + +  L+AW    +      RT                    C  + W ++ + YE  LL L      C K+  S++ E    T+AV  E +I+L+  L R +I +    D +F++ F+H   T ++++++++ PK +     P  S     L  H+  +H    + +   LNG +D  E+ +A+M+ E IR ELKR+YTQL +YK + + +DNPH+S+KRGG+K         RR S+     +     + +DE S ++ E SP N
Sbjct:  211 RHMLLAFNSICALICIAL-IPIVCYQRKRQHEARGWALMELFLIGASILYSVLFLDFVAPPEYGCCVAVWLRQIGFSIFYGSIVLKIYRNLQEYRVRKAQHVSVREQDMLKYLAAMLALTITGLMAWTVGSWGDTALWRT----------------AWPQCLMQGWHVIWHGYE--LLFLLYAVRLCYKARNSDWLERWQFTVAVCLEAVITLMANLIRYSIRNSGRADTLFIVSFVHLQLTVSVNIVIIVAPKFYLSNGEP--SRRSMTLGGHSGRAHPSLAKLRDNILNGTIDFAEVPIADMNPEDIRAELKRVYTQLRMYKLKNLYQDNPHISKKRGGKKWSDKNTKATRRISIPSCSPQ--TKRIEEDEKSDLTVESSPHN 572          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: gbb-2 (Gamma-aminobutyric acid type B receptor subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECB2])

HSP 1 Score: 50.0618 bits (118), Expect = 7.478e-6
Identity = 87/406 (21.43%), Postives = 164/406 (40.39%), Query Frame = 2
Query: 1343 ITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEIT-------CAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAW-LATGFDHRNDKRTFTFFNEKKLTKDLNYLISKV--CRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEY--GEVRFITIAVLNE-----------LIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRL--------VPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLE--IYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDSPGNSGGEEATLTSTS 2461
            I + ++  +I F+ R  R IK S+  L  + + G++  + ++I    D   ++       C  + +    GF L +G ++ K +RV   F + +  R  ++D  +   LG+L+ I +  L+ W   + F       ++T      + +D   +I +V  C S           +G+    +Y  K V      +   E R + +  LN+           +++S+L + T + + ++V+  +     F+    T T+ ++ +  PK+  L R PV   N PR         V    S  +  Q + +   DL  I  AE + +  R  L +  TQL   + K RA              +   RF  Q +     + S  + ETS +      ++  EE +LT+  
Sbjct:  452 IFLALIFLLINFRYRNHRFIKMSSPNLNNIIIAGSICTFASVIMLGLDTRIVSPDVFVWLCYTKTWTLCIGFTLSFGAMFSKTWRVHSIFTNIRMDRKAIKDSKLFIILGILLFIDICVLVTWAFVSPF-------SYTVTELPHIPEDNIVIIPEVEKCNSS---------HSGVFQAVLYAVKGVLMILGCFLAWETRHVNVPALNDSKYIGTSVYCCVVMSVLGLSTSVILQERVNEMFSLASFFVIFSTTLTLCLVFV--PKVIELARNPV--GNEPRAYRRGLMKSVVAKTSQPMSPQPRSDSSGDL--IGKAESENKLRRRYLHQKSTQLWDLVEKLRA--------------QGDTRFLQQEWCLSSASPSSQERETSLLLRQPSSSNNREETSLTAAG 821          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: smog (gene:FBgn0051660 transcript:FBtr0336831)

HSP 1 Score: 259.61 bits (662), Expect = 2.470e-73
Identity = 165/533 (30.96%), Postives = 256/533 (48.03%), Query Frame = 2
Query:  908 FPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLL------RGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK--QRRFSLQHFHKKHHATSVHDD------ETSKISEDSPGNSGGEEATLTSTSN 2464
            +P R+ +S         + I  + +V    L++     H C   TT C+  L E     +   Y C CR S++  +S +  GF G +VE          +   Y  Y C PC  GC  C +   C   QE ++L      R L   +   CI  CIV G+I+F+ R+ + I +  W +LE  L G VL+Y ++   +F  +   C + P+LRE GF+  YG + +K+YR L  F++RKA R  +RD D+L+YLG +V   + ++ A+ A+  D            E    + L    +  C    WE+V+   E  +L   ++     ++A +++ E +F+  A+  E ++S      R   + ++ P  I L  FI    T + ++ L+  PK+WY ++   S     RL        +       GD D+ E+ ++EM  E IR ELKRLYTQLEI K + +R+DNPH+S++RGGRK   RRFSLQ    KH +   H D      E S+  EDS  ++ G   T    S 
Sbjct:  404 WPFRISFSEHRIKVVAAAFIAADEDVCNDGLEEVFGRRHGCDRNTTFCL--LTENKPAATRDVYTCLCRESYYLPNSTL-QGFRGDRVE----------LSEGYDNYSCIPCPGGCTNCDSNGVCLTFQEEEVLNVDACLRLLVAIVLGACILCCIVLGVIVFRQRKCKAIASGMWTVLETILLGIVLLYASVAVHFFPASTERCLLEPWLRELGFITCYGAIILKLYRHLVDFRTRKAHRWVLRDVDLLKYLGTMVFAVICYMAAFTASSLD----------LLESAQLESLREADTNTCHPLKWELVTQTSEMLILCFGLHLSIASRNANTQFRERQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWYQHKQGTSHDAGQRLGGGYAGLCL-------GDPDIGELTISEMSPEDIRAELKRLYTQLEIMKNKTLRQDNPHISKRRGGRKAGHRRFSLQALSAKHRSNKHHQDIEITEAEPSRTPEDSVCSAEGPTDTYAEISG 906          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: smog (gene:FBgn0051660 transcript:FBtr0100301)

HSP 1 Score: 256.529 bits (654), Expect = 3.873e-72
Identity = 169/546 (30.95%), Postives = 260/546 (47.62%), Query Frame = 2
Query:  908 FPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLL------RGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVS-----SANRPRLVPHTESHIIQTQQKLN--------GDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK--QRRFSLQHFHKKHHATSVHDD------ETSKISEDSPGNSGGEEATLTSTSN 2464
            +P R+ +S         + I  + +V    L++     H C   TT C+  L E     +   Y C CR S++  +S +  GF G +VE          +   Y  Y C PC  GC  C +   C   QE ++L      R L   +   CI  CIV G+I+F+ R+ + I +  W +LE  L G VL+Y ++   +F  +   C + P+LRE GF+  YG + +K+YR L  F++RKA R  +RD D+L+YLG +V   + ++ A+ A+  D            E    + L    +  C    WE+V+   E  +L   ++     ++A +++ E +F+  A+  E ++S      R   + ++ P  I L  FI    T + ++ L+  PK+WY ++   S     S   P       SH     Q+L         GD D+ E+ ++EM  E IR ELKRLYTQLEI K + +R+DNPH+S++RGGRK   RRFSLQ    KH +   H D      E S+  EDS  ++ G   T    S 
Sbjct:  404 WPFRISFSEHRIKVVAAAFIAADEDVCNDGLEEVFGRRHGCDRNTTFCL--LTENKPAATRDVYTCLCRESYYLPNSTL-QGFRGDRVE----------LSEGYDNYSCIPCPGGCTNCDSNGVCLTFQEEEVLNVDACLRLLVAIVLGACILCCIVLGVIVFRQRKCKAIASGMWTVLETILLGIVLLYASVAVHFFPASTERCLLEPWLRELGFITCYGAIILKLYRHLVDFRTRKAHRWVLRDVDLLKYLGTMVFAVICYMAAFTASSLD----------LLESAQLESLREADTNTCHPLKWELVTQTSEMLILCFGLHLSIASRNANTQFRERQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWYQHKQVRSLAYDLSIRLPVDAFKGTSH--DAGQRLGGGYAGLCLGDPDIGELTISEMSPEDIRAELKRLYTQLEIMKNKTLRQDNPHISKRRGGRKAGHRRFSLQALSAKHRSNKHHQDIEITEAEPSRTPEDSVCSAEGPTDTYAEISG 924          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: smog (gene:FBgn0051660 transcript:FBtr0304909)

HSP 1 Score: 250.366 bits (638), Expect = 6.253e-70
Identity = 169/553 (30.56%), Postives = 261/553 (47.20%), Query Frame = 2
Query:  908 FPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLL------RGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVS-----SANRPRLVPHTESHIIQTQQKLN--------GDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK--QRRFSLQ------------HFHKKHHAT-SVHDDETSKISEDSPGNSGGEEATLTSTSN 2464
            +P R+ +S         + I  + +V    L++     H C   TT C+  L E     +   Y C CR S++  +S +  GF G +VE          +   Y  Y C PC  GC  C +   C   QE ++L      R L   +   CI  CIV G+I+F+ R+ + I +  W +LE  L G VL+Y ++   +F  +   C + P+LRE GF+  YG + +K+YR L  F++RKA R  +RD D+L+YLG +V   + ++ A+ A+  D            E    + L    +  C    WE+V+   E  +L   ++     ++A +++ E +F+  A+  E ++S      R   + ++ P  I L  FI    T + ++ L+  PK+WY ++   S     S   P       SH     Q+L         GD D+ E+ ++EM  E IR ELKRLYTQLEI K + +R+DNPH+S++RGGRK   RRFSLQ            H   KHH    + + E S+  EDS  ++ G   T    S 
Sbjct:  404 WPFRISFSEHRIKVVAAAFIAADEDVCNDGLEEVFGRRHGCDRNTTFCL--LTENKPAATRDVYTCLCRESYYLPNSTL-QGFRGDRVE----------LSEGYDNYSCIPCPGGCTNCDSNGVCLTFQEEEVLNVDACLRLLVAIVLGACILCCIVLGVIVFRQRKCKAIASGMWTVLETILLGIVLLYASVAVHFFPASTERCLLEPWLRELGFITCYGAIILKLYRHLVDFRTRKAHRWVLRDVDLLKYLGTMVFAVICYMAAFTASSLD----------LLESAQLESLREADTNTCHPLKWELVTQTSEMLILCFGLHLSIASRNANTQFRERQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWYQHKQVRSLAYDLSIRLPVDAFKGTSH--DAGQRLGGGYAGLCLGDPDIGELTISEMSPEDIRAELKRLYTQLEIMKNKTLRQDNPHISKRRGGRKAGHRRFSLQKKGSKDKALSAKHRSNKHHQDIEITEAEPSRTPEDSVCSAEGPTDTYAEISG 931          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: smog (gene:FBgn0051660 transcript:FBtr0304910)

HSP 1 Score: 248.44 bits (633), Expect = 1.275e-69
Identity = 160/513 (31.19%), Postives = 249/513 (48.54%), Query Frame = 2
Query:  908 FPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLL------RGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVS-----SANRPRLVPHTESHIIQTQQKLN--------GDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK--QRRFSLQHFHKKHHATSVH 2383
            +P R+ +S         + I  + +V    L++     H C   TT C+  L E     +   Y C CR S++  +S +  GF G +VE          +   Y  Y C PC  GC  C +   C   QE ++L      R L   +   CI  CIV G+I+F+ R+ + I +  W +LE  L G VL+Y ++   +F  +   C + P+LRE GF+  YG + +K+YR L  F++RKA R  +RD D+L+YLG +V   + ++ A+ A+  D            E    + L    +  C    WE+V+   E  +L   ++     ++A +++ E +F+  A+  E ++S      R   + ++ P  I L  FI    T + ++ L+  PK+WY ++   S     S   P       SH     Q+L         GD D+ E+ ++EM  E IR ELKRLYTQLEI K + +R+DNPH+S++RGGRK   RRFSLQ     H+ + VH
Sbjct:  404 WPFRISFSEHRIKVVAAAFIAADEDVCNDGLEEVFGRRHGCDRNTTFCL--LTENKPAATRDVYTCLCRESYYLPNSTL-QGFRGDRVE----------LSEGYDNYSCIPCPGGCTNCDSNGVCLTFQEEEVLNVDACLRLLVAIVLGACILCCIVLGVIVFRQRKCKAIASGMWTVLETILLGIVLLYASVAVHFFPASTERCLLEPWLRELGFITCYGAIILKLYRHLVDFRTRKAHRWVLRDVDLLKYLGTMVFAVICYMAAFTASSLD----------LLESAQLESLREADTNTCHPLKWELVTQTSEMLILCFGLHLSIASRNANTQFRERQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWYQHKQVRSLAYDLSIRLPVDAFKGTSH--DAGQRLGGGYAGLCLGDPDIGELTISEMSPEDIRAELKRLYTQLEIMKNKTLRQDNPHISKRRGGRKAGHRRFSLQVSRGHHNGSVVH 891          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: smog (gene:FBgn0051660 transcript:FBtr0077388)

HSP 1 Score: 179.489 bits (454), Expect = 1.698e-46
Identity = 112/400 (28.00%), Postives = 188/400 (47.00%), Query Frame = 2
Query:  908 FPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLL------RGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYR 2089
            +P R+ +S         + I  + +V    L++     H C   TT C+  L E     +   Y C CR S++  +S +  GF G +VE          +   Y  Y C PC  GC  C +   C   QE ++L      R L   +   CI  CIV G+I+F+ R+ + I +  W +LE  L G VL+Y ++   +F  +   C + P+LRE GF+  YG + +K+YR L  F++RKA R  +RD D+L+YLG +V   + ++ A+ A+  D            E    + L    +  C    WE+V+   E  +L   ++     ++A +++ E +F+  A+  E ++S      R   + ++ P  I L  FI    T + ++ L+  PK+WY ++
Sbjct:  404 WPFRISFSEHRIKVVAAAFIAADEDVCNDGLEEVFGRRHGCDRNTTFCL--LTENKPAATRDVYTCLCRESYYLPNSTL-QGFRGDRVE----------LSEGYDNYSCIPCPGGCTNCDSNGVCLTFQEEEVLNVDACLRLLVAIVLGACILCCIVLGVIVFRQRKCKAIASGMWTVLETILLGIVLLYASVAVHFFPASTERCLLEPWLRELGFITCYGAIILKLYRHLVDFRTRKAHRWVLRDVDLLKYLGTMVFAVICYMAAFTASSLD----------LLESAQLESLREADTNTCHPLKWELVTQTSEMLILCFGLHLSIASRNANTQFRERQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWYQHK 780          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-156l18.8 (si:ch211-156l18.8 [Source:ZFIN;Acc:ZDB-GENE-141215-43])

HSP 1 Score: 222.246 bits (565), Expect = 1.954e-59
Identity = 146/464 (31.47%), Postives = 236/464 (50.86%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT---ESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGR 2323
            +I  + N+  F +DQCA G       H+C   +  C   + +K   F MG Y C+C+  +++  SD         ++N+  N +NN          C PC  GC  C  G PC V QE  LLR   LA+Q   + + +++ ++ +Q R+T+ I++S  +LLE+ L G++L+Y  +   YF P+   C +  ++R  GF ++YG + +K+YRVL  F SR AQRV Y+    +LR LGV+V+     L AW      +R+        +     +  N     VC    W+ +  + E   L    + C  VK+ PS + E R+++IA+ NEL++S +  L R      +HPD++ L+ F H H T T+++ LL  PK  ++ +P      R  +       E  + ++   LN        +   +D + IRDELK+LY+QLE++KT+ M   NPH+ +KR  R
Sbjct:  298 VIRVDVNIQGFSVDQCATGDFWFANTHQCNRTSMEC-EPIPQKG--FRMGQYCCRCKKGYYSPISD---------IQNKRNNRENNTQACYPEVPVCVPCWPGCAECEDGAPCWV-QEDWLLRTAVLAVQGLFMILVLISMLVAYQCRKTKRIRSSGLLLLEMILCGSLLLYFPVFILYFKPSTFRCILLRWVRLLGFAIVYGTVALKMYRVLKVFLSRTAQRVPYITTTGVLRMLGVMVLTVSWFLCAWTVGVLQNRDRNVPLLIISTTSEGQGFN-----VCDLDRWDYMMAVAELLFLCWGSFLCSAVKTVPSAFHEPRYMSIAIHNELLLSSMFHLLRF-ARPSIHPDWMLLLFFTHTHVTITVTLGLLFVPKFLHMSQP-----GREEIAAEVYEDEVDLRRSCSYLNSSFTSNCWSDQSLDPDDIRDELKKLYSQLEVHKTKRMANSNPHLPKKRSSR 737          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: gpr158b (G protein-coupled receptor 158b [Source:ZFIN;Acc:ZDB-GENE-130530-875])

HSP 1 Score: 218.779 bits (556), Expect = 1.997e-58
Identity = 135/472 (28.60%), Postives = 234/472 (49.58%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTC---IYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFP----GQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            ++  + N+ +  +DQC+      G HRC   +  C   + H       F +  Y CQC+  F+       NGF     G   +  ++              +C PC+EGC  C    PC   ++T L   + ++ Q FC+ +  ++ ++++  R  + IK S  ILLE  L G+VL+Y  ++  Y +P+   C +  ++R  GF ++YG + +K+YRVL  F SR AQR+ Y+    +LR L V++++ M  L AW +    + N +          +T +   L   +C    W+ +    E   L   +Y C  V++ PS + E R++ +A+ NEL+IS +  + R ++   +HPD++ ++ F+H H T T+++ LL+ PK  +       +    R    TE++  +     +G      I  A     +D E IR+ELK+LY+QLEIYK + M  +NPH+ +KR  ++
Sbjct:  299 VVRVDVNLQDVDIDQCSNSGWFAGTHRCNLTSMECNPIVGH------GFVLDKYKCQCKRGFYHPSRVALNGFSKTDLGTYTDESWE-----------LSGRCLPCREGCEFCRDDTPCLAHEDTALRLAM-VSFQGFCMLLDFISMVVVYHFRHNKRIKASGLILLEAILSGSVLLYFPVMIQYLNPSVFRCILLRWVRLLGFAIVYGTVILKLYRVLKVFLSRTAQRIPYMTSWRVLRLLAVILLVVMWFLAAWTSAVCQNHNTRHALIDIG---VTPE--GLQFSMCLLDSWDYMMAAAEFLFLLWGVYLCYAVRTVPSAFHEPRYLAVAIYNELLISAIFHIIRFSLGTGLHPDWMLMLFFVHTHLTVTVTLGLLLIPKFLF-------TGTHAREDIATEAYEDELDMGHSGSCLNSSITSAWSEHSLDPEDIREELKKLYSQLEIYKRKKMLANNPHLQKKRSSKR 740          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 214.157 bits (544), Expect = 2.930e-57
Identity = 143/466 (30.69%), Postives = 234/466 (50.21%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + ++ +  +DQC+      G HRC   T  C   L      F +  Y C C+S ++       NG  G K      + ++ P  + +    C PC+EGC  C    PC V +    LR   L+ Q  C+ +  ++ ++++  RR + I+ S  ILLE  LFGA+L+Y  ++  YF P+   C +  ++R  GF  +YG + +K+YRVL  F SR AQR+ Y+    +LR L ++++I +   IAW  T    +N  R     +    T  L +    +C    W+ +  + E   L   +Y C  V++ PS Y E R++ IAV NELI+S +  + R  +  ++HPD++ ++ F H H T T+++ LL+ PK  +       +    R    TE++  +     +G      I  A     +D E IR+ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  284 GVVRVDVSLQDVDIDQCSADGWFAGTHRCNITTMEC---LPVPGHGFVLDKYKCHCKSGYYHPSRVAVNGKAGGKGTEGLSHNRDVPETSSH----CLPCQEGCSFCKDDTPC-VARGDGALRMAVLSFQGLCMLVDFISMVLLYHFRRNKSIRASGLILLEAILFGALLLYFPVVILYFQPSVFRCILLRWVRLLGFATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSWRVLRLLCIILLIVLWFAIAW--TSAVCQNPNRHLALISVGFTTDGLQF---SMCLLDRWDYMIAVAEFLFLLWGVYLCFAVRTVPSAYHEPRYMAIAVHNELILSAIFHILRFTLAPELHPDWMLMLFFAHTHLTVTVTLGLLLVPKFLF-------AGTHLRDDIATEAYEDELDMGRSGSYLNSSITSAWSEHSLDPEDIREELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 729          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 211.846 bits (538), Expect = 4.019e-56
Identity = 144/466 (30.90%), Postives = 234/466 (50.21%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + ++ +  +DQC+      G HRC   T  C   L      F +  Y C C+S ++       NGF  +      + L +N    E   + C PC+EGC  C    PC V +    LR   L+ Q  C+ +  ++ ++++  RR + I+ S  ILLE  LFGA+L+Y  ++  YF P+   C +  ++R  GF  +YG + +K+YRVL  F SR AQR+ Y+    +LR L ++++I +   IAW  T    +N  R     +    T  L +    +C    W+ +  + E   L   +Y C  V++ PS Y E R++ IAV NELI+S +  + R  +  ++HPD++ ++ F H H T T+++ LL+ PK  +       +    R    TE++  +     +G      I  A     +D E IR+ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  284 GVVRVDVSLQDVDIDQCSADGWFAGTHRCNITTMEC---LPVPGHGFVLDKYKCHCKSGYYHPSRVAVNGFKRKAGGKGTEGLSHNRDVPETSSH-CLPCQEGCSFCKDDTPC-VARGDGALRMAVLSFQGLCMLVDFISMVLLYHFRRNKSIRASGLILLEAILFGALLLYFPVVILYFQPSVFRCILLRWVRLLGFATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSWRVLRLLCIILLIVLWFAIAW--TSAVCQNPNRHLALISVGFTTDGLQF---SMCLLDRWDYMIAVAEFLFLLWGVYLCFAVRTVPSAYHEPRYMAIAVHNELILSAIFHILRFTLAPELHPDWMLMLFFAHTHLTVTVTLGLLLVPKFLF-------AGTHLRDDIATEAYEDELDMGRSGSYLNSSITSAWSEHSLDPEDIREELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 732          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 197.208 bits (500), Expect = 2.152e-51
Identity = 145/494 (29.35%), Postives = 238/494 (48.18%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMW--------------------------YLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEM-DCETI-----RDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + ++ +  +DQC+      G HRC   T  C   L      F +  Y C C+S ++       NGF  +      + L +N    E   + C PC+EGC  C    PC V +    LR   L+ Q  C+ +  ++ ++++  RR + I+ S  ILLE  LFGA+L+Y  ++  YF P+   C +  ++R  GF  +YG + +K+YRVL  F SR AQR+ Y+    +LR L ++++I +   IAW  T    +N  R     +    T  L +    +C    W+ +  + E   L   +Y C  V++ PS Y E R++ IAV NELI+S +  + R  +  ++HPD++ ++ F H H T T+++ LL+ PK                            YL     S+ +   L P      I+T +++     L  IN   +  C+++      +ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  284 GVVRVDVSLQDVDIDQCSADGWFAGTHRCNITTMEC---LPVPGHGFVLDKYKCHCKSGYYHPSRVAVNGFKRKAGGKGTEGLSHNRDVPETSSH-CLPCQEGCSFCKDDTPC-VARGDGALRMAVLSFQGLCMLVDFISMVLLYHFRRNKSIRASGLILLEAILFGALLLYFPVVILYFQPSVFRCILLRWVRLLGFATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSWRVLRLLCIILLIVLWFAIAW--TSAVCQNPNRHLALISVGFTTDGLQF---SMCLLDRWDYMIAVAEFLFLLWGVYLCFAVRTVPSAYHEPRYMAIAVHNELILSAIFHILRFTLAPELHPDWMLMLFFAHTHLTVTVTLGLLLVPKFLFAGTHLRDDIATEAYEDELDMGRSGSYLNSSITSAWSEHSLDPED----IRTPEEMG---QLSSINGCGVRSCDSLWEKRTNEELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 760          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 250.751 bits (639), Expect = 2.685e-69
Identity = 149/466 (31.97%), Postives = 246/466 (52.79%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + N+    +DQC+      G HRCQ  ++ CI     K   F +G Y C C++ F+  H        G   EN +Q+     +  E  +Y+C PC+EGC  CT   PC   QE K LR   ++ Q+FC+ +  ++ ++++  RR + ++ S  +LLE+ LFG++L+Y  ++  YF+P+   C +  ++R  G+  +YG + +K+YRVL  F SR AQR+ Y+    ++R L V++++ +  L+AW  T    +N  R      + + + +L +   K+C    W+ +  + E   L   +Y C  V++ PS + E R++  AV NELI S L    R  +  K+ PD++ ++ F+H H T T++V LL+ PK          S N PR     E++  +     +G      I  A     +D E IR+ELK+LYTQLEIYK + M  +NPH+ +KR  +K
Sbjct:  203 GVLKVDVNLQNIDIDQCSNEGWFSGTHRCQHNSSKCIP---TKGLGFVLGAYKCTCKAGFYYPH--------GMFSENGFQS--KGEISEE--EYKCLPCREGCSNCTDDAPC-YAQEDKYLRIAIISFQAFCMLLDFISMLVVYSFRRAKSVRASGLVLLEVILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGYATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSGRVIRMLSVILLLVLWFLVAW--TSAVCQNMDRNIPLIVQGETSDNLQF---KMCLIDRWDYMMAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAFAVHNELIFSALFHTIRFVLASKLQPDWMLMLFFVHTHLTVTVTVGLLLIPKF-------SRSHNNPRDDIAAEAYEDELDLGRSGSYLNSSITSAWSEHSLDPEDIREELKKLYTQLEIYKRKKMIANNPHLQKKRCSKK 640          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 251.521 bits (641), Expect = 2.785e-69
Identity = 152/470 (32.34%), Postives = 249/470 (52.98%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQ--NLQNN-PVGT-EYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + N+    +DQC+      G HRCQ  ++ CI     K   F +G Y C C++ F+  H        G   EN +Q  N+ N+ P G     +Y+C PC+EGC  CT   PC   QE K LR   ++ Q+FC+ +  ++ ++++  RR + ++ S  +LLE+ LFG++L+Y  ++  YF+P+   C +  ++R  G+  +YG + +K+YRVL  F SR AQR+ Y+    ++R L V++++ +  L+AW  T    +N  R      + + + +L +   K+C    W+ +  + E   L   +Y C  V++ PS + E R++  AV NELI S L    R  +  K+ PD++ ++ F+H H T T++V LL+ PK          S N PR     E++  +     +G      I  A     +D E IR+ELK+LYTQLEIYK + M  +NPH+ +KR  +K
Sbjct:  291 GVLKVDVNLQNIDIDQCSNEGWFSGTHRCQHNSSKCIP---TKGLGFVLGAYKCTCKAGFYYPH--------GMFSENGFQRPNMVNHFPRGEISEEEYKCLPCREGCSNCTDDAPC-YAQEDKYLRIAIISFQAFCMLLDFISMLVVYSFRRAKSVRASGLVLLEVILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGYATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSGRVIRMLSVILLLVLWFLVAW--TSAVCQNMDRNIPLIVQGETSDNLQF---KMCLIDRWDYMMAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAFAVHNELIFSALFHTIRFVLASKLQPDWMLMLFFVHTHLTVTVTVGLLLIPKF-------SRSHNNPRDDIAAEAYEDELDLGRSGSYLNSSITSAWSEHSLDPEDIREELKKLYTQLEIYKRKKMIANNPHLQKKRCSKK 736          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 251.136 bits (640), Expect = 3.480e-69
Identity = 152/470 (32.34%), Postives = 249/470 (52.98%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQ--NLQNN-PVGT-EYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + N+    +DQC+      G HRCQ  ++ CI     K   F +G Y C C++ F+  H        G   EN +Q  N+ N+ P G     +Y+C PC+EGC  CT   PC   QE K LR   ++ Q+FC+ +  ++ ++++  RR + ++ S  +LLE+ LFG++L+Y  ++  YF+P+   C +  ++R  G+  +YG + +K+YRVL  F SR AQR+ Y+    ++R L V++++ +  L+AW  T    +N  R      + + + +L +   K+C    W+ +  + E   L   +Y C  V++ PS + E R++  AV NELI S L    R  +  K+ PD++ ++ F+H H T T++V LL+ PK          S N PR     E++  +     +G      I  A     +D E IR+ELK+LYTQLEIYK + M  +NPH+ +KR  +K
Sbjct:  291 GVLKVDVNLQNIDIDQCSNEGWFSGTHRCQHNSSKCIP---TKGLGFVLGAYKCTCKAGFYYPH--------GMFSENGFQRPNMVNHFPRGEISEEEYKCLPCREGCSNCTDDAPC-YAQEDKYLRIAIISFQAFCMLLDFISMLVVYSFRRAKSVRASGLVLLEVILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGYATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSGRVIRMLSVILLLVLWFLVAW--TSAVCQNMDRNIPLIVQGETSDNLQF---KMCLIDRWDYMMAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAFAVHNELIFSALFHTIRFVLASKLQPDWMLMLFFVHTHLTVTVTVGLLLIPKF-------SRSHNNPRDDIAAEAYEDELDLGRSGSYLNSSITSAWSEHSLDPEDIREELKKLYTQLEIYKRKKMIANNPHLQKKRCSKK 736          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GPR158 (G protein-coupled receptor 158 [Source:NCBI gene;Acc:779597])

HSP 1 Score: 249.21 bits (635), Expect = 2.088e-68
Identity = 149/466 (31.97%), Postives = 248/466 (53.22%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMP-NGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            ++  + N+    +DQC+      G HRCQ  ++ CI     K   F +G Y C C++ F+  H     NGF   K    + + ++  +  E  +Y+C PC+EGC  CT   PC   QE K LR   ++ Q+FC+ +  ++ ++++  RR + ++ S  +LLE+ LFG++L+Y  ++  YF+P+   C +  ++R  G+  +YG + +K+YRVL  F SR AQR+ Y+    ++R L V++++ +  L+AW  T    +N  R      + + + +L +   K+C    W+ +  + E   L   +Y C  V++ PS + E R++  AV NELI S L    R  +  K+ PD++ ++ F+H H T T++V LL+ PK          S N PR     E++  +     +G      I  A     +D E IR+ELK+LYTQLEIYK + M  +NPH+ +KR  +K
Sbjct:  292 VLKVDVNLQNIDIDQCSNEGWFSGTHRCQHNSSKCIP---TKGLGFVLGAYKCTCKAGFYYPHGMFSENGF-QSKPGPLWPHHKSGEISEE--EYKCLPCREGCSNCTDDAPC-YAQEDKYLRIAIISFQAFCMLLDFISMLVVYSFRRAKSVRASGLVLLEVILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGYATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSGRVIRMLSVILLLVLWFLVAW--TSAVCQNMDRNIPLIVQGETSDNLQF---KMCLIDRWDYMMAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAFAVHNELIFSALFHTIRFVLASKLQPDWMLMLFFVHTHLTVTVTVGLLLIPKF-------SRSHNNPRDDIAAEAYEDELDLGRSGSYLNSSITSAWSEHSLDPEDIREELKKLYTQLEIYKRKKMIANNPHLQKKRCSKK 738          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: rpf2 (ribosome production factor 2 homolog [Source:Xenbase;Acc:XB-GENE-967404])

HSP 1 Score: 179.874 bits (455), Expect = 5.582e-46
Identity = 115/358 (32.12%), Postives = 184/358 (51.40%), Query Frame = 2
Query: 1367 IIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDSPGNSGGE 2437
            +++F L+R   I+ S  ILLE  LFG++L+Y  +   YF P+   C    ++R  GF ++YG + +K+YRV+  F SR AQRV Y+    +LR L V ++ C+  L+ W     +  N +R          T+    L+   C    W+ +  + E   L    + C   +S PS + E R++ IA+ NE+I+S    + R  I+  +HPD+  L+ FIH H T T+++ LL  PK  +   PP         V   E  + +++  LN  +     +   +D + IRDELK+LY QLE++KT+ M  +NPH+ +KR  R+    S+          S +   T +  E SPG+SGG+
Sbjct:  314 VLLFPLQR---IRASGLILLETILFGSLLLYFPVFILYFKPSVFRCVALRWVRLLGFCIVYGTIVLKLYRVMKVFLSRTAQRVPYLTSMRLLRMLFVFLLFCIWFLVGWTVGALE--NLQRGVPVVIR---TQTREGLVFYTCDHDRWDYMMSIAEVLFLCWGSFLCYGARSIPSAFHEPRYMGIAIHNEMIVSAAFHVLRFLIVPSLHPDWTLLLFFIHTHGTVTMTLTLLFIPKFLHAGVPPREEIATE--VYEDELDMRRSRSNLNSSIT-SAWSEHSLDPDDIRDELKKLYAQLEVHKTKKMTINNPHLQKKRSSRRGLGRSIMR-RITETPDSANRQSTREDKEGSPGSSGGQ 659          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Gpr158 (G protein-coupled receptor 158 [Source:MGI Symbol;Acc:MGI:2441697])

HSP 1 Score: 233.032 bits (593), Expect = 3.156e-63
Identity = 153/506 (30.24%), Postives = 258/506 (50.99%), Query Frame = 2
Query:  866 WEP--LTCSSNPNGIKFPIRLV------YSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            W P  L C    NG   P  LV      Y  Q +L  +   ++  + ++ +  +DQC+      G H+C    + C   +  K   F +G Y C C++ F+       N F  +  ++ +     + V  E   + C PC+EGC  C    PC V QE K LR   ++ Q+ C+ +  V+ ++++  R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  + R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V+V++    L+ W ++    +N +R      + + +  L +    +C    W+ ++ + E   L   IY C  V++ PS + E R++ +AV NELII+ +    R  +  ++ PD++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  265 WSPPYLECE---NGSYKPGWLVTLSAAFYGLQPNLVPEFRGVMKVDISLQKVDIDQCSSDGWFSGTHKCHLNNSEC---MPIKGLGFVLGAYQCICKAGFYHPRVFSVNNFQRRGPDHHFSGSTKD-VSEE--THVCLPCREGCPFCADDRPCFV-QEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWFLVGWTSSMC--QNLERDILLVGQGQTSDHLTF---NMCLIDRWDYMTAVAEFLFLLWGIYLCYAVRTVPSAFHEPRYMAVAVHNELIITAIFHTIRFVLASRLQPDWMLMLYFAHAHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 748          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Gpr179 (G protein-coupled receptor 179 [Source:MGI Symbol;Acc:MGI:2443409])

HSP 1 Score: 200.29 bits (508), Expect = 2.967e-52
Identity = 140/467 (29.98%), Postives = 231/467 (49.46%), Query Frame = 2
Query:  965 IYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQK---LNGDVDLV--EINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQ 2329
            +  + ++    ++QCA G       H C   +T C+     +SQ F +G Y C+CR  F+ +           +   ++ + Q++ +G      +C+PC EGC +C    PC V +E   LR   LA Q+ C+    ++ ++ ++ R ++ I+ S  +LLE  LFG++L+Y  +   YF P+   C    ++R  GF ++YG + +K+YRVL  F SR AQRV +     +LR LG L+++ +G L+ W A   +                 +   YL    C    W+ +  + E  LL    + C   ++ PS + E R+++IA+ NEL++S      R  ++  +HPD+  L+ F+H H+T T ++ L+  PK W    PP     R  ++       +  Q+    LN  +     E +L   D   IRDELK+LY QLEI KT+ M  +NPH+ +KRG   Q
Sbjct:  268 VQMDIDLQSVDINQCASGPGWYSNTHLCDLNSTQCVPL---ESQGFVLGRYLCRCRPGFYGASGSGGLEESATQAAGQFGSPQDS-LGK---LLRCQPCPEGCTSCLDATPCLV-EEALALRTAVLACQACCMLAVFLSMLVAYRCRGSKRIRASGIVLLETILFGSLLLYFPVFILYFKPSVFRCVALRWVRLLGFAVVYGTIILKLYRVLQLFLSRTAQRVPHPSSGQLLRRLGQLLLLVLGFLVVWTAGALEPGTQHTALVTRGHTPTGRHF-YL----CHHDHWDYIMVVAEMLLLCWGSFLCYATRAVPSAFHEPRYMSIALHNELLLSTAFHTARFVLVPSLHPDWTLLLFFLHTHSTVTATLALIFIPKFWKPGAPP-----REEILDEVYEDELDLQRSGSYLNSSIASAWSERSLEPGD---IRDELKKLYAQLEIRKTKEMAANNPHLPKKRGSSHQ 713          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:MGI Symbol;Acc:MGI:2386030])

HSP 1 Score: 52.7582 bits (125), Expect = 2.212e-6
Identity = 33/137 (24.09%), Postives = 67/137 (48.91%), Query Frame = 2
Query: 1343 ITMCIVTGIIIFQL--RRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPN-------EITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKR 1726
            + M + +  + F +  R  ++IK S+  +  L + G +L Y +I     D +       E  C +R ++   G+   +G ++ K +RV   F++ K ++  ++DQ +L  +G +++I +  LI W A     R  +R
Sbjct:  490 LGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVER 626          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|D4A6L0|GP158_RAT (Probable G-protein coupled receptor 158 OS=Rattus norvegicus OX=10116 GN=Gpr158 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.924e-63
Identity = 154/506 (30.43%), Postives = 260/506 (51.38%), Query Frame = 2
Query:  866 WEP--LTCSSNPNGIKFPIRLV------YSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            W P  L C    NG   P  LV      Y  Q +L  +   ++  + N+ +  +DQC+      G H+C    + C   +  K   F +G Y C C++ F+       N F  +  ++ +     + V  E   + C PC+EGC  C    PC V QE K LR   ++ Q+ C+ +  V+ ++++  R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  ++R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V+V++    L+ W ++    +N +R      + + + +L +    +C    W+ ++ + E   L   IY C  V++ PS + E R++ +AV NELII+ +    R  +  ++ PD++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  265 WSPPFLECE---NGSYKPGWLVTLSAAFYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSEC---MPIKGLGFVLGAYQCVCKAGFYHPRVFSVNNFQRRGPDHHFSGSTKD-VSEE--AHVCLPCREGCPFCADDRPCFV-QEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWFLVGWTSSMC--QNLERDILLVGQGQTSDNLTF---NMCLIDRWDYMTAVAEFLFLLWGIYLCYAVRTVPSAFHEPRYMAVAVHNELIITAIFHTIRFVLASRLQPDWMLMLYFAHTHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 748          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5T848|GP158_HUMAN (Probable G-protein coupled receptor 158 OS=Homo sapiens OX=9606 GN=GPR158 PE=1 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 2.500e-63
Identity = 146/483 (30.23%), Postives = 251/483 (51.97%), Query Frame = 2
Query:  923 VYSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGF----PGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            +Y  Q +L  +   ++  + N+ +  +DQC+      G H+C    + C+     K   F +G Y C C++ F+       N F    P Q +    +++           Y C PC+EGC  C    PC V QE K LR   ++ Q+ C+ +  V+ ++++  R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  + R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V++++    LI W ++    +N ++  +   + K +   ++LI  +C    W+ ++ + E   L   +Y C  V++ PS + E R++ +AV NELIIS +    R  +  ++  D++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  289 IYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPI---KGLGFVLGAYECICKAGFYHPGVLPVNNFRRRGPDQHISGSTKDVSEE-------AYVCLPCREGCPFCADDSPCFV-QEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVC--QNLEKQISLIGQGKTS---DHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 748          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C419|GP158_MOUSE (Probable G-protein coupled receptor 158 OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 2.207e-62
Identity = 153/506 (30.24%), Postives = 258/506 (50.99%), Query Frame = 2
Query:  866 WEP--LTCSSNPNGIKFPIRLV------YSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            W P  L C    NG   P  LV      Y  Q +L  +   ++  + ++ +  +DQC+      G H+C    + C   +  K   F +G Y C C++ F+       N F  +  ++ +     + V  E   + C PC+EGC  C    PC V QE K LR   ++ Q+ C+ +  V+ ++++  R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  + R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V+V++    L+ W ++    +N +R      + + +  L +    +C    W+ ++ + E   L   IY C  V++ PS + E R++ +AV NELII+ +    R  +  ++ PD++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  265 WSPPYLECE---NGSYKPGWLVTLSAAFYGLQPNLVPEFRGVMKVDISLQKVDIDQCSSDGWFSGTHKCHLNNSEC---MPIKGLGFVLGAYQCICKAGFYHPRVFSVNNFQRRGPDHHFSGSTKD-VSEE--THVCLPCREGCPFCADDRPCFV-QEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWFLVGWTSSMC--QNLERDILLVGQGQTSDHLTF---NMCLIDRWDYMTAVAEFLFLLWGIYLCYAVRTVPSAFHEPRYMAVAVHNELIITAIFHTIRFVLASRLQPDWMLMLYFAHAHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 748          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|E1BBQ2|GP158_BOVIN (Probable G-protein coupled receptor 158 OS=Bos taurus OX=9913 GN=GPR158 PE=3 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 2.258e-61
Identity = 152/506 (30.04%), Postives = 263/506 (51.98%), Query Frame = 2
Query:  866 WEP--LTCSSNPNGIKFPIRLV------YSFQTHLTTK-PSIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            W P  L C    NG   P  LV      Y  Q +L  +   ++  + N+ +  +DQC+      G H+C    + C+     K   F +G Y C C++ F+       N F  Q+   ++  +++    +E   + C PC EGC  C    PC V QE K LR   ++ Q+ C+ +  ++ +++++ R+ + I+ S  ILLE  LFG++L+Y  ++  YF+P+   C +  ++R  GF  +YG + +K++RVL  F SR AQR+ Y+    ++R L V++++    L+ W ++    +N +R  +   + + +   ++LI  +C  + W+ ++   E   L   +Y C  V++ PS + E R++ +AV NELIIS +    R  +  ++  D++ +++F H H T T+++ LL+ PK  +       S+N PR    TE++  +     +G      IN A     +D E IRDELK+LY QLEIYK + M  +NPH+ +KR  +K
Sbjct:  265 WSPPYLECE---NGSYKPGWLVTLSAAFYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPI---KGLGFVLGAYQCICKAGFYHPRDFSFNNF--QRRGPDHHFVESAKDVSEEV-HVCLPCSEGCPYCADDSPCFV-QEDKYLRLAIISFQALCMLLDFLSMLVVYRFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLVGWTSSVC--QNLERHISLIGQGRTS---DHLIFSMCLVERWDYMTAAAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSH-------SSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK 748          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PRD1|GP179_HUMAN (Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 1.696e-48
Identity = 141/466 (30.26%), Postives = 222/466 (47.64%), Query Frame = 2
Query:  965 IYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNN--PVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQR-VYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT-ESHI-IQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQ 2329
            +  + ++    ++QCA G       H C   +T C+     +SQ F +G Y C+CR  F+ +         G   E+++Q       P G      QC PC EGC +C    PC V +E  +LR   LA Q+ C+    ++ ++ ++ RR + I  S  +LLE  LFG +L+Y  +   YF P+   C    ++R  GF ++YG + +K+YRVL  F SR AQR   +    +LR LG+L++  +G L  W     +                 +   YL    C    W+ +  + E  LL    + C   ++  S + E R++ IA+ NEL++S      R  ++  +HPD+  L+ F H H+T T ++ L+  PK W L  PP     R  +V    E  + +Q      G       +   +D   IRDELK+LY QLE++KT+ M  +NPH+ +KRG   Q
Sbjct:  268 VQMDVDLQSVDINQCASGPGWYSNTHLCDLNSTQCVPL---ESQGFVLGRYLCRCRPGFYGASPS------GGLEESDFQTTGQFGFPEGRSGRLLQCLPCPEGCTSCMDATPCLV-EEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLETVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQRSALLSSGRLLRRLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHF-YL----CHHDRWDYIMVVAELLLLCWGSFLCYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVPSLHPDWTLLLFFFHTHSTVTTTLALIFIPKFWKLGAPP-----REEMVDEVCEDELDLQHSGSYLGSSIASAWSEHSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRGSSCQ 713          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A4Z2DRF2 (Putative G-protein coupled receptor OS=Schistosoma japonicum OX=6182 GN=EWB00_009907 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.516e-124
Identity = 235/579 (40.59%), Postives = 343/579 (59.24%), Query Frame = 2
Query:  866 WEPLTCSSNPNGIKFPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFD-----------------HRNDKRTFTFFNEKKLTKDLNY----------------------LIS-----------KVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSAN--RPRLVPHTESHIIQTQQKL----NGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDSPGNSGG 2434
            W P+ C +N +    PI L Y     + +    ++FE+++ +F +DQCA  ++RC   TT C+Y  +  S F SM NY C+C   ++    ++ NG+P   +E+       N   +E  ++ C  C  GC  CT+ + C V  +  LLR +PLA Q+FCIT+C++ G+ +F+LRRTRV+K++N +L+E+ L GA+L+Y TI+  YF  ++ITC I P+ RE GF +MYGVL VK+YRVL +FQSRKA RV+VRD+DIL+YLG+ +II + ++IAW A   D                 H+    T       KL K +NY                      ++S           +VCRS  W++V  L E  +L ++I+YC+ V++AP EY E ++I +A++ E+ +S  + L R  I   VHPDY+FL++F   H T T+++LL+  PK+ YL R   +  N  RPR  P T    + T  KL    NGD+D+ ++NLA+MD E IR ELKRLYTQ+E+YKT+AMRKDNPH+S++RGGRKQRRFSLQ FHK+HH  +     TS +S +   N  G
Sbjct:  276 WAPIQCDANSS---IPIILRY----FIYSVDKCLFFEYDLKDFVIDQCALNINRCGA-TTQCVYRKYHPSSF-SMDNYLCECSPGYYAD--NLENGYPAPLIESRIHTALLNG-ESELPRFYCRSCPTGCSKCTSNKLCSVQIDYNLLRAIPLAFQTFCITICLLFGLAMFKLRRTRVVKSANLVLMEIMLIGAILLYSTIVVMYFPVSDITCLILPWFREVGFSIMYGVLIVKIYRVLSTFQSRKAHRVHVRDKDILKYLGMFIIITLTYMIAWTAINLDYISTSPWFHSMHSIQSIHQQSLITMKQEGYIKLRKSINYSHVNNSTTTTATTTTTTDLHESIVSNDSFNDEIVTFEVCRSMSWDVVVELAEFIILAISIHYCRLVRTAPCEYNETQYIGVALIIEMTVSGFLHLLRHFIWYSVHPDYMFLLYFARSHITITVNLLLIFVPKVTYLCRSSKALYNTTRPRGSPGTGDPHLATAGKLNLVSNGDLDIADVNLADMDPEVIRRELKRLYTQIELYKTKAMRKDNPHISKRRGGRKQRRFSLQPFHKRHHGQT-----TSSVSVNMMPNEAG 837          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A504Z161 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_02044 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 3.130e-123
Identity = 236/559 (42.22%), Postives = 332/559 (59.39%), Query Frame = 2
Query:  866 WEPLTCSSNPNGIKFPIRLVYSFQTHLTTKPSIIYF--EFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCIT-CTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDH-------RNDKRTFTF-----------------------FNEKKLTKDLNYLISK-------------VCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPR-----LVPHTESHIIQTQQK----LNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATS 2377
            W    C S P  +   IRL      H    P  I+F  EF+V    ++QCA G+H+C  ETT C Y  + +  F SM NY C C   ++  + +  NGFP   + ++        V TE  Q+ C  C  GC   C     C+V  +  L R +PLA+QSFCIT CI+ GI + +LR+TRV+K+SNW+LLE+ L GA+ +Y  I+  YF  +E+TC + P+LRE GF +MYGVL VK+YRVLC FQSRKA RV+VRD+DIL++LG+ +I    +++AW A   D+       RN + T                           NE  +T +++ LIS              VCRS  W+++  L E  +L ++I+YC+ V++APSEY EV +I+IA++ E+ +S +  + R  I   VHPDY+FL++F+  H T TI++ L+ GPK WYLYRP  S A   R     + P++    + +  K    LNGD+D+ ++NLA+MD E IR ELKRLYTQ+E+YKT+AMRKDNPH+S++RGGRKQRRFSLQ F+K+HH  S
Sbjct:  250 WLANQCESVPGQLSL-IRL----SVHPPDDPKKIHFLFEFDVRNVTVNQCALGIHQCA-ETTKCEYKQYGEWPF-SMDNYLCACEDGYYVENEE--NGFPAPYIRSKSAE---TTVDTEP-QFHCRACPVGCGGRCGNNMHCRVRLDLNLFRAIPLAVQSFCITACILIGIALCRLRKTRVVKSSNWLLLEILLVGAIFLYLIIVVMYFPASEVTCILSPWLRELGFAVMYGVLIVKIYRVLCGFQSRKAHRVHVRDKDILKFLGLFIITSFTYMVAWTAVNLDYLSSTPWSRNPEGTVPISMLIQGSLVKVGQTHSSELMVHGANESGMT-NVSNLISNGMTENKQKETKFDVCRSLSWDVIMGLAEFIILAVSIHYCRLVRTAPSEYNEVMYISIALIIEMTVSGIFNIIRHFIWYSVHPDYMFLLYFLRSHITVTINLALIFGPKAWYLYRPLNSIAGTGRVRTNPVAPYSADPNLASTGKLNLTLNGDLDIADVNLADMDPEVIRRELKRLYTQIELYKTKAMRKDNPHISKRRGGRKQRRFSLQPFYKRHHGQS 794          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A1S3KHW0 (probable G-protein coupled receptor 158 OS=Lingula unguis OX=7574 GN=LOC106182018 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 3.521e-123
Identity = 210/534 (39.33%), Postives = 331/534 (61.99%), Query Frame = 2
Query:  905 KFPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCA------QGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSF-FTSHSDMPNGFPGQKVENEY-QNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK--QRRFSLQHF--HKKH--HATSVHDDETSKISEDSPGNSGGEEATLTSTSN 2464
            +F  R + S + H +T   ++    ++    ++QC        G +RCQPETT CI       + FS+G Y CQC+  + F + +   + F G ++E  Y  +LQ N   +   ++QC PCK GC  C    PC V  + +L+RG+PL IQSFC+T+ ++ GI+I ++R+ + IK S WI+LE+ LFGA+L+Y +++  YF+P  +TC + P+ RE GF +++G L +K+YR L  FQ+R+A+RV++RD+D+L+YL  LVII +G++ AW A  F H +D  + T   E  +  +    +  VC+S +W+ +  + E   L   IY C C++SAPS + E R+I+ A+ NE +IS ++ + R  ++  +HPDY+FL++F+ CH T +++++L+ GPK+WY +RPP +           E   ++    LNG+V   ++N+AEMD E I+ ELKRLYTQL+I+KT++MRKDNPH+S++RGGRK   RRFSLQ F  H KH  H    H+ E S+  E+S  ++ G    +  T+N
Sbjct:   17 RFTGRALSSQKVHQSTYGGVVAIHIDLQRHDINQCTAHGDFFSGTNRCQPETTKCIP---IPGRGFSVGAYKCQCKKGYYFPNITANVSYFDGLEMERVYFSDLQKNKNSSFSEEFQCLPCKRGCDQCVDDSPCLVEYDFRLMRGIPLGIQSFCMTIVLIIGIVIIRIRKKKAIKVSMWIMLEIILFGALLMYTSVVVQYFEPTTLTCILVPWFREVGFAIVFGALILKIYRFLAEFQTRRARRVHIRDKDLLKYLLGLVIIVLGYMCAWTAANFQHEHDGSSLT---EMGMIAEGTQFV--VCKSHWWDYIIEVAEFLFLCCGIYLCYCIRSAPSLFAETRYISWAIYNETVISAILHVARHFLLTILHPDYMFLMYFLRCHLTVSVTLVLVFGPKLWYTHRPPKTDFRGRAFSDVDEITKLRMGLTLNGEV--TDMNIAEMDPEEIKGELKRLYTQLQIFKTKSMRKDNPHISKRRGGRKPTHRRFSLQPFAHHHKHSRHRDHEHEYEMSRTPEESTNSAEGITIIVEDTTN 540          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: K1R8P6 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10024622 PE=4 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 4.928e-122
Identity = 217/510 (42.55%), Postives = 306/510 (60.00%), Query Frame = 2
Query:  974 EFNVSEFKLDQCA--QGL----HRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSF-FTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKD-LNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPK---MWYLYRPPVSSANRPRLVPHT--------ESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQ--RRFSLQHFH-KKHHATSV---HDDETSKISEDSPGNS 2428
            + ++++  ++QCA  Q L    ++C PETT C+ H+         G+Y C C+  F F   +     FPG ++E  + N  NN       +YQC PC  GC  C     C + +   LLRG+PL IQSFCIT+ IV GI++ +LR+++V+  S WILLE+ L GAVL+Y TII  YF+P    C + P+ RE GF ++YG L +KVYR+L  FQSRKA RV+VRD+D+L+YL  ++I+ +G++ AW    +DH ++        E   TKD L Y+   VC+S +WE V  + E   L   IY C  V+SAPS++ E  +IT A+  E +IS++  + R      +HPDY+FL+ F+ C  T TI++LL+ GPK   + Y +RPP     R R    +        ES  +      NGDVD+ EI+LA+MD E IR ELKRLYTQL++YKTR MRKDNPH+S++RGGRKQ  RRFS+Q FH K  H  +    H+ E SK  E+S  ++
Sbjct:    3 DIDINQSDVNQCASDQQLFSESNKCLPETTQCV-HI--PGGGLRAGSYKCVCQKGFYFPDKNSTTKSFPGSELEQAFLNFWNNKTNFSNVEYQCLPCPRGCENCVDDTRC-MAEYNVLLRGIPLGIQSFCITVTIVIGIVVLRLRKSKVMVASMWILLEMVLIGAVLLYATIIIQYFEPTTTICIMIPWFREMGFAVVYGSLVLKVYRLLSEFQSRKAHRVHVRDKDLLKYLCCVIIVVLGYMSAWTTVTYDHIDNGEVIL---EYGFTKDKLKYV---VCKSGWWEYVVEIAELLFLLFGIYLCYRVRSAPSDFAEGTYITAAICYEAVISIVFYVLRHVYWTDLHPDYLFLMSFVRCQLTVTITLLLVFGPKASELLYAHRPPDDHHPRNRAYSSSDVQENMSPESMKLNVGISSNGDVDVAEISLADMDPEDIRAELKRLYTQLQVYKTRIMRKDNPHISKRRGGRKQTHRRFSIQPFHLKSRHERNCPVEHEHEISKTPEESTNSA 502          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A5K4FAI6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 2.992e-121
Identity = 229/563 (40.67%), Postives = 339/563 (60.21%), Query Frame = 2
Query:  866 WEPLTCSSNPNGIKFPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDH-------------RNDKRTFT---------------FFNEKKL----TKDLNYLIS-----------------KVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSAN------RPRLVPHTESHIIQTQQKL----NGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATS 2377
            W P+ C SN      PI L Y     + T    ++FEF++ ++ +DQCA  ++RC   TT C+Y  +    F SM NY C+C   ++T   ++ NG+P   +E++ Q    N   +E  ++ C  C  GC  C +   C+V  +  L+R +PLA Q+FCIT+C++ GI +F+LRR RVIK++N +L+E+ L GA+L+Y TI+  YF  ++I+C I P+ RE GF +MYGVL VK+YRVL  FQSRKA RV+VRD+DIL+YLG+ ++I   ++IAW A   D+              N++++ T               F N+  L    +KD N  I                  +VCR+  W++V  L E  +L ++I+YC+ V++APSEY E ++I +A++ E+ +S  + L R  I   VHPDYIFL++F+  H T T+++LL+  PK+ +L R   S  N       P +V   + H + +  KL    NGD+D+ ++NLA+MD E IR ELKRLYTQ+E+YKT+AMRKDNPH+S++RGGRKQRRFSLQ FHK+HH  +
Sbjct:  241 WAPIQCESNS---IIPIVLRY----FIYTTERSLFFEFDLKDYTIDQCALNINRCGA-TTRCVYKKYNPYAF-SMDNYMCECSPGYYTD--NIENGYPAPLIESKLQTALMND-ESELPRFYCRSCPIGCFNCKSNTLCRVQLDYNLIRAIPLAFQTFCITICLLFGIAMFKLRRARVIKSANLVLMEIMLVGAILLYSTIVVMYFPVSDISCLILPWFREVGFSVMYGVLIVKIYRVLSGFQSRKAHRVHVRDKDILKYLGMFILITFTYMIAWTAINLDYISNSPWIRDDNSMMNNRQSVTPIVSMKQEGYIKIKKFNNQSNLEHFNSKDNNETIHLHENQFSEDSIDEMITFEVCRAMSWDVVVELAEFIILAISIHYCRLVRTAPSEYNETQYIGVALIIEMTVSGFLYLLRHFIWYNVHPDYIFLLYFVRSHITVTVNLLLIFVPKVTFLCRSSKSLCNTARQRGSPGVVYPGDPH-LPSSGKLNLVSNGDLDIADVNLADMDPEVIRRELKRLYTQIELYKTKAMRKDNPHISKRRGGRKQRRFSLQPFHKRHHGQT 790          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 223.787 bits (569), Expect = 2.694e-60
Identity = 136/461 (29.50%), Postives = 234/461 (50.76%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCA-----QGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            ++  + +V +  +DQC+      G HRC   +  C   L      F +  Y CQC+  F+  +      +   ++   +  +Q  P         C PC++GC  C    PC V +    L    L+ Q F + +  ++ ++++  RR + I+ S  +LLE  LFGA+L+Y  ++  YF P+   C +  ++R  GF  +YG + +K+YRVL  F SR AQR+ Y+    +LR LG+++++ +  L+AW +   +  N  R           +DL +    +C    W+ +  + E   L  ++Y C  V++ PS + E R++ IAV NELIIS +  + R  ++ ++HPD++ ++ F H H T T ++ LL+ PK  +L     + A    L       + ++   LN  +     +   +D E IR+ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  255 VVRVDVSVQDVDIDQCSTEGWFAGTHRCNVTSMEC---LPIPGHGFVLDKYKCQCKGDFYHPNRGRLEVY---RILRVFLTMQTPP-------RHCLPCQKGCAYCKDDTPC-VDRGDSYLSITVLSFQGFFMLLDFISMVVVYHFRRNKSIRASGLVLLEAILFGALLLYFPVMVLYFQPSVFRCILLRWVRMLGFATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSWKVLRLLGIILLVVVWFLVAWTSAVCE--NPNRHLALIAVGYTPEDLQF---SMCLLDRWDYMMAVAEFLFLLWSVYLCYAVRTVPSAFHEPRYMAIAVHNELIISSIFHVVRFTLVQELHPDWMLMLFFAHTHLTVTATLGLLLIPKGTHLRDDIATEAYEDEL------DMGRSGSYLNSSITSA-WSEHSLDPEDIREELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 689          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: gpr158a (G protein-coupled receptor 158a [Source:ZFIN;Acc:ZDB-GENE-060130-18])

HSP 1 Score: 223.402 bits (568), Expect = 2.835e-60
Identity = 137/461 (29.72%), Postives = 231/461 (50.11%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCA-----QGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            ++  + +V +  +DQC+      G HRC   +  C   L      F +  Y CQC+  F+      PN  P +                      C PC++GC  C    PC V +    L    L+ Q F + +  ++ ++++  RR + I+ S  +LLE  LFGA+L+Y  ++  YF P+   C +  ++R  GF  +YG + +K+YRVL  F SR AQR+ Y+    +LR LG+++++ +  L+AW +   ++ N  R           +DL +    +C    W+ +  + E   L  ++Y C  V++ PS + E R++ IAV NELIIS +  + R  ++ ++HPD++ ++ F H H T T ++ LL+ PK  +L     + A    L       + ++   LN  +     +   +D E IR+ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  255 VVRVDVSVQDVDIDQCSTEGWFAGTHRCNVTSMEC---LPIPGHGFVLDKYKCQCKGDFY-----HPNRTPPR---------------------HCLPCQKGCAYCKDDTPC-VDRGDSYLSITVLSFQGFFMLLDFISMVVVYHFRRNKSIRASGLVLLEAILFGALLLYFPVMVLYFQPSVFRCILLRWVRMLGFATVYGTVTLKLYRVLKVFLSRTAQRIPYMTSWKVLRLLGIILLVVVWFLVAWTSAVCENPN--RHLALIAVGYTPEDLQF---SMCLLDRWDYMMAVAEFLFLLWSVYLCYAVRTVPSAFHEPRYMAIAVHNELIISSIFHVVRFTLVQELHPDWMLMLFFAHTHLTVTATLGLLLIPKGTHLRDDIATEAYEDEL------DMGRSGSYLNSSITSA-WSEHSLDPEDIREELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 673          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-156l18.8 (probable G-protein coupled receptor 158 [Source:NCBI gene;Acc:103022023])

HSP 1 Score: 212.231 bits (539), Expect = 3.209e-56
Identity = 148/463 (31.97%), Postives = 228/463 (49.24%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCAQG------LHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFP--GQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGR 2323
            ++  + N+  F +DQCA G       H+C   +  C        Q F +G Y C+C+  +++  S+  N            Y NL   PV        C PC  GC  C    PC V QE  LLR   LA+Q   + + +++ +  +Q RRT+ I+ S  +LLE+ LFG++L+Y  +   YF P+   C +  ++R  GF ++YG L +K+YRVL  F SR AQRV Y+     ++ LGV+V+     L AW A    +R+  R          +    +    VC    W+ +  + E   L    + C  VK+ PS + E R++ IA+ NEL++S +  L R      +HPD++ L+ F H H T T+++ LL  PK  Y+ RP          V   E  + ++   LN        +   +D + IRDELK+LY QLE++KT+ M  +NPH+ +KR  R
Sbjct:  320 VVRVDVNIQGFDVDQCASGNVWFSDTHQCNRTSMECDPI---PRQGFRLGQYCCRCKEGYYSPPSNYKNKMADGSNSTRTCYPNL---PV--------CLPCWPGCKQCKDSSPCWV-QEDWLLRAAVLAVQGIFMALVLLSMLRAYQCRRTKRIRASGLMLLEMILFGSLLLYFPVFILYFKPSTFRCILLRWVRLLGFAIVYGTLTLKMYRVLKVFLSRTAQRVPYMSSTTAMKMLGVMVLTVSWFLCAWTAGVLQNRD--RNVPVLITSTTSDGQGF---SVCDLDRWDHMMAVAELLFLCWGSFLCNAVKAVPSAFHEPRYMGIAIHNELLLSAMFHLFRF-ARPSLHPDWMLLLFFTHTHVTITVTLGLLFLPKFLYISRPVKEEVA--AEVYEDEVDLRRSCSYLNSSFTSTCWSDHSLDPDDIRDELKKLYAQLEVHKTKKMANNNPHLQKKRSSR 759          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: gpr158b (G protein-coupled receptor 158b [Source:ZFIN;Acc:ZDB-GENE-130530-875])

HSP 1 Score: 150.214 bits (378), Expect = 1.062e-36
Identity = 126/472 (26.69%), Postives = 201/472 (42.58%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIIS--------LLVILTRMNIIDKVHP-DYIFL-IHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             I+  + N+ +  +DQC+      G HRC   T  C          F +  Y CQC+  F++      NG                         +C PC+EGC  C    PC + QE  +LR    + Q  C+ +  ++  +++  RR + I+ S  ILLE  L GA+L+Y  ++  YF P+   C +  ++R  GF  +YG + +K+YRVL  F SR AQR+ Y+    +LR L  ++++ +  L+AW +      +   T             N     +C    W+ +  + E   L   +Y C     AP      R++ +A+ NEL+IS        L+ I+   N+   + P  ++F   H     AT      L +G    YL     S+ +   L P                             E IR+ELK+LY+QLE+YK + M  +NPH+ +KR  +K
Sbjct:  249 GIVKVDVNLQDEDIDQCSSSGWFAGTHRCNLTTMECKP---VPGHGFVLDKYKCQCKRGFYSPRRVALNGVSSDDD-------------FSDSSARCLPCREGCSFCQDDSPC-LAQEDGVLRVAVASFQGLCMLLDFISMPVVYHFRRNKRIRASGLILLEAILAGAILLYFPVMILYFQPSVFRCVLLRWVRLLGFTTVYGTVILKLYRVLKVFLSRTAQRIPYMTSWRVLRLLAAILLVVLWFLVAWTSAMCQSTDVHHTLVDVGVTPEGLQFN-----MCMLDRWDYMMAVAEFLFLLWGVYLC----YAP------RYMAVAIYNELLISAIFHIIRKLICIIQDSNLTICLFPLQFVFTETHMQDDIATEAYEDELDMGRSGSYLNSSITSAWSEHSLDP-----------------------------EDIREELKKLYSQLEVYKRKKMLANNPHLQKKRSSKK 659          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO38981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD0])

HSP 1 Score: 58.151 bits (139), Expect = 1.384e-8
Identity = 76/289 (26.30%), Postives = 128/289 (44.29%), Query Frame = 2
Query: 1277 PCKVTQETKLLRGLPLAIQSF-CI--TMCIVTGIIIFQL----RRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPN------EITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNY---LISKVC---RSKFWEIVSYLYETGLL--GLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHP--DYIFLIHFIHCHATATISVLLLIGPKM 2074
            P   T + +    +PL +  F C+  ++ IV G++        R  R IK S+  L  + + G +LIY T+     D          TC  R  L   GF + +G ++ K +RV   F + K  +  VRD+D+   LGV+V+I +  L  W+A    H   ++       +K +KD ++   +  + C    S  W +  Y + + LL  GL + +     S P    + RFI I+V N  ++ L  I   ++ +    P   +  +   I    T T+SVL +  PK+
Sbjct:  492 PLDRTIKVRQFIKIPLWLYIFVCLMGSLGIVLGLVFLAFNIKYRNKRYIKLSSPNLNNVVILGCILIYSTVFLYGLDGRVSDKVFTATCRARFCLLSLGFTIGFGAMFSKTWRVHQIFTNVKKVKKVVRDKDLFGMLGVIVLIDVLLLSLWMAL---HPPSRKVIVLEGSRKFSKDRDHEFVMHREECTGPHSLPWLVTFYAFHSLLLVFGLFLAFETRKISVPV-LNDSRFIGISVYN--VVLLCAIGVPLSHVSSSEPAAGFALICAVILFCTTVTLSVLFI--PKV 772          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO46340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC9])

HSP 1 Score: 55.0694 bits (131), Expect = 1.592e-8
Identity = 58/215 (26.98%), Postives = 98/215 (45.58%), Query Frame = 2
Query: 1457 YCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCS---FQSRKAQRVYV--RDQDILRYLGVLVIICMGH-LIAWL---ATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKM 2074
            +  I+ +Y +P    C +R + R  GF L Y  L +K +R L     + S +A R  +  R   +    G+  +  M   L+A+     T FDH        F +  ++T    Y+I   C SKF        E   L   I  C  V+ APS + E +FI+ ++ N  +++L + +T + II+   PD ++L+ F     T T  + ++  PK+
Sbjct:    9 FSQILASYPEPVNHLCIVRLWFRHIGFGLAYTSLLLKTWRYLSGVTVYHSLQALRFIIAFRRYGLSLPSGITFLFIMPMTLLAFPEVDLTCFDH--------FKSSFRMTP--RYVIDWTC-SKF--------EVMFLFWGIRLCYNVRKAPSAFNESKFISWSIYNMTVVTLFLKITSLFIINVAGPDMLYLMEFFRVQLTVTPLLGMVFVPKV 204          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO46341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQD0])

HSP 1 Score: 52.373 bits (124), Expect = 6.151e-8
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = 2
Query: 1016 GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGL-PLAIQSFCITMCIVTGIIIFQ 1381
            G H C+ ETT C+       + F  G+Y C C+  ++         F G  +E  Y +   +   T    ++C PCK+GC TC    PC VT    L   +  LA+ +  +T+ I   ++ ++
Sbjct:   33 GTHHCKNETTQCVP---VTGRGFRAGSYKCICKPGYYFPLLTPQKYFNGTDIE-RYASDNQSEYYTTAGSFECLPCKKGCTTCVDNSPCLVTLNWSLRHAMIALALLTVTVTLGIAAFVVYYR 151          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO38317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD79])

HSP 1 Score: 48.9062 bits (115), Expect = 9.591e-6
Identity = 29/108 (26.85%), Postives = 58/108 (53.70%), Query Frame = 2
Query: 1379 QLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEIT---CAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWL 1693
            + R  R IK S+  L  L + G VL Y +++    D ++++   C +R F  + GF L +G ++ K +RV    +  + +R Y++D  ++  + +++ I +  L+ WL
Sbjct:  428 KFREKRFIKMSSPNLNNLIIVGCVLAYVSVVLFCVDGDKLSDLICQVRVFTLDIGFTLAFGAMFSKAWRVHKITRKLRLKRRYIKDVHLVAMVMIMLSIDIIILVTWL 535          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000011760.2 (probable G-protein coupled receptor 158 [Source:NCBI gene;Acc:101168242])

HSP 1 Score: 218.779 bits (556), Expect = 1.505e-58
Identity = 141/466 (30.26%), Postives = 240/466 (51.50%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLA----EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + N+    ++QC+      G HRC   +  CI         F +  Y CQCR  F+       NGF  ++ ++      N    ++    +C PC+EGC  C    PC V QE   LR    + Q  C+ + + + ++++ LR+ + I+ S  ILLE+ LFGA+L+Y  ++  YF+P+   C +  ++R  GF +MYG + +K+YRVL  F SR AQR+ Y+    +LR L V++++ +  L+AW  T    +N   +          + L +    +C+   W+ +  + E   L   +Y C  V++ PS + E R+I +A+ NEL+IS +  + R +++  +HPD++ ++ F H H T T+++ LL+ PK        +S   + R    TE++  +     +G      I  A     +D + IRDELK+LY QLE+YK + M  +NPH+ +KR  +K
Sbjct:  277 GVVRVDVNLQNLDINQCSNSGWFAGTHRCNLTSMECIP---VGGHGFVLDKYKCQCRRGFYHPSRVALNGFKSKEQDS------NRDETSDVTSSRCLPCQEGCPYCQDDTPCLV-QEDGALRIAVASFQGLCMMLDLASMVVVYHLRKNKSIRTSGLILLEVILFGALLLYFPVMILYFNPSVFRCILLRWVRLMGFAIMYGTVILKLYRVLKVFLSRTAQRMPYMTSWRVLRLLVVILLVVIWFLVAW--TSAVCQNPGLSQALIAAGLTPEGLQF---SMCQLDRWDYMMAVAEFLFLLWGVYLCYAVRTIPSAFHEPRYIAVAIYNELLISAIFHIIRFSLVPGLHPDWMLMLFFAHTHLTVTVTLGLLLVPKF-------LSKGIQARDDIATEAYEEELDMGRSGSYLNNSITSAWSEHSLDPDDIRDELKKLYAQLEVYKRKKMLANNPHLQKKRNSKK 720          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: gpr158a (G protein-coupled receptor 158 [Source:NCBI gene;Acc:101171369])

HSP 1 Score: 210.305 bits (534), Expect = 1.109e-55
Identity = 139/464 (29.96%), Postives = 231/464 (49.78%), Query Frame = 2
Query:  962 IIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYL---YRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
            ++  + N+ +  +DQC+      G HRC   T  C   L  +   F +  Y C C+  F+       N F     + +           E     C PC++GC  C    PC V  E  +LR   L+ Q  C+ +  V+ ++++  RR + I+ S  +LLE  L GA+L+Y  +   +F P+   C +  ++R  GF  +YG L +K+YRVL  F SR AQR+ Y+    +LR LG +++I +  L+AW  T    +N  R     +  +    L +    +C    W+ +  + E   L   +Y C  V++ PS + E R++ IAV NELI+S +  + R  ++ +++PD++ L+ F H H T T+++ LL+ PK  +     R  ++S          E  + ++   LN  +     +   +D E IR+ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  288 VVRVDVNLQDVDIDQCSADGWFAGTHRCNLTTMEC---LPLRGHGFVLDKYQCHCKKGFYHPSRVAVNSFTKSGRKADAAAAGGGAREDEGSSRHCVPCQKGCAECKDDTPC-VAPEDGVLRLAVLSFQCLCMLVVFVSMVLVYHFRRNKSIRASGLVLLEAILCGALLLYFPVGILFFHPSVFRCILLRWVRLLGFATVYGTLTLKLYRVLKVFLSRTAQRIPYLTSWRVLRLLGFILLIVLWFLVAW--TSAVCQNPDRKLALIDVGRTPDGLQF---SMCLLDRWDYMMAVAEFLFLLWAVYLCYAVRTVPSAFHEPRYMAIAVHNELILSAIFHVIRFTLLYELNPDWMLLLFFTHTHLTVTVTLGLLLIPKFLFAGTHMRDDIASEAY-----EDELDMGRSGSYLNSSITSA-WSEHSLDPEDIREELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 736          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: gpr158a (G protein-coupled receptor 158 [Source:NCBI gene;Acc:101171369])

HSP 1 Score: 194.512 bits (493), Expect = 1.388e-50
Identity = 138/487 (28.34%), Postives = 235/487 (48.25%), Query Frame = 2
Query:  959 SIIYFEFNVSEFKLDQCAQ-----GLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRV-YVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYL---YRPPVSSA------NRPRLVPHTESHIIQTQQKLNGDVDLVEI-----NLAEMDCETIR-----------DELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRK 2326
             ++  + N+ +  +DQC+      G HRC   T  C   L  +   F +  Y C C+  F+       N F     + +           E     C PC++GC  C    PC V  E  +LR   L+ Q  C+ +  V+ ++++  RR + I+ S  +LLE  L GA+L+Y  +   +F P+   C +  ++R  GF  +YG L +K+YRVL  F SR AQR+ Y+    +LR LG +++I +  L+AW  T    +N  R     +  +    L +    +C    W+ +  + E   L   +Y C  V++ PS + E R++ IAV NELI+S +  + R  ++ +++PD++ L+ F H H T T+++ LL+ PK  +     R  ++S       +  R   +  S I     + + D + +       +L+ ++   +R           +ELK+LY+QLEIYK + M  +NPH+ +KR  +K
Sbjct:  287 GVVRVDVNLQDVDIDQCSADGWFAGTHRCNLTTMEC---LPLRGHGFVLDKYQCHCKKGFYHPSRVAVNSFTKSGRKADAAAAGGGAREDEGSSRHCVPCQKGCAECKDDTPC-VAPEDGVLRLAVLSFQCLCMLVVFVSMVLVYHFRRNKSIRASGLVLLEAILCGALLLYFPVGILFFHPSVFRCILLRWVRLLGFATVYGTLTLKLYRVLKVFLSRTAQRIPYLTSWRVLRLLGFILLIVLWFLVAW--TSAVCQNPDRKLALIDVGRTPDGLQF---SMCLLDRWDYMMAVAEFLFLLWAVYLCYAVRTVPSAFHEPRYMAIAVHNELILSAIFHVIRFTLLYELNPDWMLLLFFTHTHLTVTVTLGLLLIPKFLFAGTHMRDDIASEAYEDELDMGRSGSYLNSSITSAWSEHSLDPEDIRTPDEMGHLSSVNGCGVRSRDSLWEKRTNEELKKLYSQLEIYKRKKMLANNPHLQKKRSSKK 764          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-156l18.8 (si:ch211-156l18.8 [Source:ZFIN;Acc:ZDB-GENE-141215-43])

HSP 1 Score: 60.077 bits (144), Expect = 1.118e-8
Identity = 49/161 (30.43%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 1910 ITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHT--ESHIIQTQQKLNGDV------DLVEINLA---------------EMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGR 2323
            + IA+ NEL+ S +  L R      +HPD++ L+ F H H T T+++ LL+GPK+         S N+  L  H   +   + T + +  ++      D V++  +                +D E  R+ELK+LY+QLE++KT+ M  +NPH+ +KR  R
Sbjct:    1 MGIAIHNELLFSSIFHLFRFTFT-SLHPDWMLLLSFTHTHVTITVTLALLLGPKVNIQT---CGSKNKHYLFSHAFCDPQFLYTSKPVRDEIAAEVYEDEVDLRRSGSYLNNSFRSAWSEHNVDPEDFREELKKLYSQLEVHKTKKMSANNPHLPKKRSSR 157          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000024293.1 (SMESG000024293.1)

HSP 1 Score: 1432.54 bits (3707), Expect = 0.000e+0
Identity = 717/717 (100.00%), Postives = 717/717 (100.00%), Query Frame = 2
Query:  317 MNVLLIETLAFVLIILSTPRVSKSTNDSNLYRAVKLIQDPKTSCSQFTDEPFNSKSAIYVNRKFPILSQIITNETLSVYFNQTLRVIEQXXXXXXXXXXEINRNQSTEIHEKIKSRLNGLIEFVNSTKSIGLCLDGKLYHSYLLDKQDYLCELDFNSLSNNSHSISDQLNSXXXXXXXXXXXXWEPLTCSSNPNGIKFPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDSPGNSGGEEATLTSTSNK 2467
            MNVLLIETLAFVLIILSTPRVSKSTNDSNLYRAVKLIQDPKTSCSQFTDEPFNSKSAIYVNRKFPILSQIITNETLSVYFNQTLRVIEQFLLFFDYFFFEINRNQSTEIHEKIKSRLNGLIEFVNSTKSIGLCLDGKLYHSYLLDKQDYLCELDFNSLSNNSHSISDQLNSRKIINKNIHRIKWEPLTCSSNPNGIKFPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDSPGNSGGEEATLTSTSNK
Sbjct:    1 MNVLLIETLAFVLIILSTPRVSKSTNDSNLYRAVKLIQDPKTSCSQFTDEPFNSKSAIYVNRKFPILSQIITNETLSVYFNQTLRVIEQFLLFFDYFFFEINRNQSTEIHEKIKSRLNGLIEFVNSTKSIGLCLDGKLYHSYLLDKQDYLCELDFNSLSNNSHSISDQLNSRKIINKNIHRIKWEPLTCSSNPNGIKFPIRLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLFEKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIVSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRPRLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIYKTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDSPGNSGGEEATLTSTSNK 717          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000064049.1 (SMESG000064049.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.393e-6
Identity = 63/311 (20.26%), Postives = 124/311 (39.87%), Query Frame = 2
Query: 1193 QNNPVGTEYFQYQCEPCKEGCITCTTGEPCKVT-------QETKLLRGLPLAIQSFCITMCIVTGIIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRPFLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVIICMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEI-VSYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELII--SLLVILTRMNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMW-YLYRP 2092
            +N      +    C  CK+G    +    C           +  ++  +  +I    IT+ IV   I  +   T V+K+    L+ + L G  L Y T     + P   +C +   +    F L++G L  K  R+ C   S   +++  R    L     +VI+ + +++  +            +  F + K    +   +  +C ++  ++ +S  ++  L+    +Y    ++ P  + E +FI   +    II   L+VI    N+ +       F +HF     TATI ++ L  PK++  L++P
Sbjct:  373 ENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDASVIVAIIFSIVGLIITVIIVG--IFAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNRI-CRILSISKKKIIRRKGRFLTTTAQIVIVFLLNVVEIIIISV------MIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKE---ISLCFAMHF-----TATICIVFLFLPKLYIILFKP 666          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR1581.799e-6430.23G protein-coupled receptor 158 [Source:HGNC Symbol... [more]
GPR1585.205e-6430.23G protein-coupled receptor 158 [Source:HGNC Symbol... [more]
GPR1793.532e-4930.26G protein-coupled receptor 179 [Source:HGNC Symbol... [more]
GPR1791.362e-4829.68G protein-coupled receptor 179 [Source:HGNC Symbol... [more]
GPR1791.363e-4829.68G protein-coupled receptor 179 [Source:HGNC Symbol... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F39B2.82.505e-4931.69pep chromosome:WBcel235:I:14760644:14768980:-1 gen... [more]
gbb-27.478e-621.43Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smog2.470e-7330.96gene:FBgn0051660 transcript:FBtr0336831[more]
smog3.873e-7230.95gene:FBgn0051660 transcript:FBtr0100301[more]
smog6.253e-7030.56gene:FBgn0051660 transcript:FBtr0304909[more]
smog1.275e-6931.19gene:FBgn0051660 transcript:FBtr0304910[more]
smog1.698e-4628.00gene:FBgn0051660 transcript:FBtr0077388[more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-156l18.81.954e-5931.47si:ch211-156l18.8 [Source:ZFIN;Acc:ZDB-GENE-141215... [more]
gpr158b1.997e-5828.60G protein-coupled receptor 158b [Source:ZFIN;Acc:Z... [more]
gpr158a2.930e-5730.69G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
gpr158a4.019e-5630.90G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
gpr158a2.152e-5129.35G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR1582.685e-6931.97G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
GPR1582.785e-6932.34G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
GPR1583.480e-6932.34G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
GPR1582.088e-6831.97G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
rpf25.582e-4632.12ribosome production factor 2 homolog [Source:Xenba... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gpr1583.156e-6330.24G protein-coupled receptor 158 [Source:MGI Symbol;... [more]
Gpr1792.967e-5229.98G protein-coupled receptor 179 [Source:MGI Symbol;... [more]
Gabbr22.212e-624.09gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D4A6L0|GP158_RAT1.924e-6330.43Probable G-protein coupled receptor 158 OS=Rattus ... [more]
sp|Q5T848|GP158_HUMAN2.500e-6330.23Probable G-protein coupled receptor 158 OS=Homo sa... [more]
sp|Q8C419|GP158_MOUSE2.207e-6230.24Probable G-protein coupled receptor 158 OS=Mus mus... [more]
sp|E1BBQ2|GP158_BOVIN2.258e-6130.04Probable G-protein coupled receptor 158 OS=Bos tau... [more]
sp|Q6PRD1|GP179_HUMAN1.696e-4830.26Probable G-protein coupled receptor 179 OS=Homo sa... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DRF21.516e-12440.59Putative G-protein coupled receptor OS=Schistosoma... [more]
A0A504Z1613.130e-12342.22G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A1S3KHW03.521e-12339.33probable G-protein coupled receptor 158 OS=Lingula... [more]
K1R8P64.928e-12242.55G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A5K4FAI62.992e-12140.67Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpr158a2.694e-6029.50G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
gpr158a2.835e-6029.72G protein-coupled receptor 158a [Source:ZFIN;Acc:Z... [more]
si:ch211-156l18.83.209e-5631.97probable G-protein coupled receptor 158 [Source:NC... [more]
gpr158b1.062e-3626.69G protein-coupled receptor 158b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO389811.384e-826.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463401.592e-826.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463416.151e-827.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383179.591e-626.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000011760.21.505e-5830.26probable G-protein coupled receptor 158 [Source:NC... [more]
gpr158a1.109e-5529.96G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
gpr158a1.388e-5028.34G protein-coupled receptor 158 [Source:NCBI gene;A... [more]
si:ch211-156l18.81.118e-830.43si:ch211-156l18.8 [Source:ZFIN;Acc:ZDB-GENE-141215... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024293.10.000e+0100.00SMESG000024293.1[more]
SMESG000064049.11.393e-620.26SMESG000064049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017424 ID=SMED30017424|Name=G_PROTEIN_RECEP_F3_4 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2608bp
AAAAAAATTTTCTTCACTCTATTTCTCTGTCTCGGGAAAAATTGATTTCT
GCGACTGGATGAAATTCATTTTTTAGGTTAGGAAAAAAATACCACTTTAC
AGAGAGAAGACTTTCTCTTGGATTCAGTCAGTTGGGGGAACTATGAAAAA
GAAACAGACTAACATTGAAGAATTGCTGATCAATTCACAACGCTGATTCG
TATCTATATATATATATATTTTTTAATATACACTTATCGATAGTTATATA
ATATTTGAAATTATCAATTCTTGAAATGGATTTATCTGAAAATGTCTATG
GATGGAAAATTGATCAATGAATGTGTTATTGATTGAAACACTTGCTTTCG
TTTTGATCATCCTCTCAACACCGCGGGTTTCCAAATCGACAAACGACTCC
AATTTGTATCGGGCAGTGAAACTTATCCAAGACCCCAAAACCAGTTGCTC
ACAATTCACAGATGAACCATTCAATTCCAAATCCGCGATTTATGTGAACA
GAAAATTTCCAATATTATCTCAGATTATAACCAATGAAACTTTGTCGGTT
TATTTCAATCAAACCTTGCGAGTCATTGAACAATTTCTTTTGTTTTTCGA
TTATTTCTTTTTCGAAATCAACAGAAATCAATCAACGGAAATCCACGAGA
AAATCAAATCGCGCCTCAATGGATTAATAGAATTTGTCAATTCCACCAAA
TCGATTGGATTATGCCTAGATGGCAAACTCTATCATTCCTATCTGTTAGA
CAAACAGGACTATCTCTGTGAATTGGATTTCAATTCTTTATCCAATAATT
CTCATAGTATTAGTGATCAATTAAATTCTCGGAAAATTATCAATAAAAAT
ATTCATCGAATCAAATGGGAGCCATTGACATGTTCTTCGAATCCAAATGG
AATTAAGTTTCCTATTAGACTAGTTTACTCATTTCAGACCCATTTGACCA
CCAAACCGTCGATTATCTATTTCGAATTCAATGTCAGTGAATTCAAGTTG
GATCAATGTGCACAGGGGCTTCATCGTTGTCAACCTGAAACAACTACATG
TATTTATCACCTTTTTGAAAAAAGCCAGTTTTTCTCAATGGGAAATTATT
ATTGTCAGTGCCGGTCCAGCTTCTTCACCAGTCACAGTGATATGCCTAAT
GGATTTCCAGGACAAAAAGTTGAGAATGAATATCAAAATCTTCAAAATAA
TCCAGTAGGTACTGAGTATTTCCAATACCAATGCGAACCCTGTAAAGAAG
GATGTATAACATGTACAACGGGGGAGCCATGTAAGGTAACTCAAGAAACG
AAGTTACTCCGTGGACTTCCTTTAGCCATTCAGTCTTTTTGCATAACAAT
GTGCATTGTTACTGGTATCATAATTTTCCAGCTTCGTCGTACCAGAGTAA
TCAAGAACAGTAACTGGATTTTATTAGAATTATTTTTATTCGGAGCTGTC
TTAATTTATTGTACTATTATCAATGCATATTTTGATCCAAATGAAATCAC
ATGTGCTATTAGGCCTTTCCTCCGAGAAGGTGGCTTCGTTTTAATGTATG
GAGTGCTTTACGTTAAAGTTTACAGAGTACTCTGCAGTTTTCAGTCTCGC
AAAGCACAACGAGTCTATGTGAGAGATCAAGACATTCTTCGATACCTTGG
CGTCCTGGTAATAATATGTATGGGCCATTTAATAGCATGGCTAGCTACAG
GATTTGACCATAGAAATGACAAACGCACTTTCACTTTTTTTAATGAAAAG
AAACTCACTAAAGATCTCAATTATTTGATTTCTAAAGTATGTAGGTCAAA
ATTCTGGGAAATCGTTTCCTATTTATATGAAACTGGTTTGCTTGGATTGA
CGATTTATTATTGTAAATGCGTCAAGTCAGCTCCGTCCGAATATGGAGAA
GTCCGTTTTATCACAATAGCAGTTTTAAATGAGCTTATTATTAGTCTTCT
GGTCATTTTGACTAGGATGAATATTATTGATAAAGTTCATCCAGATTATA
TTTTCCTAATTCATTTCATTCATTGTCATGCAACCGCTACTATATCAGTT
TTACTGCTCATCGGGCCAAAAATGTGGTACTTGTATCGGCCTCCAGTCTC
TTCAGCAAATAGACCACGCTTGGTCCCACACACTGAGTCCCATATCATTC
AAACCCAACAAAAACTAAACGGTGATGTAGATTTGGTGGAAATCAATCTC
GCAGAAATGGACTGTGAAACTATTCGAGATGAACTCAAGAGATTATACAC
ACAACTTGAAATTTATAAAACCAGAGCAATGAGAAAAGACAATCCTCACG
TGAGTCGGAAAAGAGGAGGACGAAAACAGAGAAGGTTTTCATTGCAACAT
TTCCATAAAAAGCACCATGCAACCAGTGTTCACGACGACGAAACGTCAAA
GATATCAGAAGATTCTCCGGGAAACAGTGGTGGAGAAGAAGCAACATTAA
CGTCTACTAGTAATAAATGATCAATTTTAGTTCTTTTGAAAAAAAACATT
TGAACTCTGTACATCTCAGTCTCTTATGAACGAAACACTTTTCGTGCTAC
TGATTTCTTAATATCTAAAATGAGAATGCTGTAAATAATTGCTAAGATCT
ATGCTGGA
back to top

protein sequence of SMED30017424-orf-1

>SMED30017424-orf-1 ID=SMED30017424-orf-1|Name=SMED30017424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=718bp
MNVLLIETLAFVLIILSTPRVSKSTNDSNLYRAVKLIQDPKTSCSQFTDE
PFNSKSAIYVNRKFPILSQIITNETLSVYFNQTLRVIEQFLLFFDYFFFE
INRNQSTEIHEKIKSRLNGLIEFVNSTKSIGLCLDGKLYHSYLLDKQDYL
CELDFNSLSNNSHSISDQLNSRKIINKNIHRIKWEPLTCSSNPNGIKFPI
RLVYSFQTHLTTKPSIIYFEFNVSEFKLDQCAQGLHRCQPETTTCIYHLF
EKSQFFSMGNYYCQCRSSFFTSHSDMPNGFPGQKVENEYQNLQNNPVGTE
YFQYQCEPCKEGCITCTTGEPCKVTQETKLLRGLPLAIQSFCITMCIVTG
IIIFQLRRTRVIKNSNWILLELFLFGAVLIYCTIINAYFDPNEITCAIRP
FLREGGFVLMYGVLYVKVYRVLCSFQSRKAQRVYVRDQDILRYLGVLVII
CMGHLIAWLATGFDHRNDKRTFTFFNEKKLTKDLNYLISKVCRSKFWEIV
SYLYETGLLGLTIYYCKCVKSAPSEYGEVRFITIAVLNELIISLLVILTR
MNIIDKVHPDYIFLIHFIHCHATATISVLLLIGPKMWYLYRPPVSSANRP
RLVPHTESHIIQTQQKLNGDVDLVEINLAEMDCETIRDELKRLYTQLEIY
KTRAMRKDNPHVSRKRGGRKQRRFSLQHFHKKHHATSVHDDETSKISEDS
PGNSGGEEATLTSTSNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017978GPCR_3_C
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0002805regulation of antimicrobial peptide biosynthetic process
GO:0003380establishment or maintenance of cytoskeleton polarity involved in gastrulation
GO:0003384apical constriction involved in gastrulation
GO:0010470regulation of gastrulation
GO:0043519regulation of myosin II filament organization
GO:0048383mesectoderm development
GO:0060027convergent extension involved in gastrulation
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 626..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 698..717
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 677..717
NoneNo IPR availablePANTHERPTHR32546G-PROTEIN COUPLED RECEPTOR 158-RELATEDcoord: 217..695
NoneNo IPR availableCDDcd152937tmC_GPR158-likecoord: 330..591
e-value: 3.42278E-84
score: 264.461
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.705
NoneNo IPR availableTMHMMTMhelixcoord: 367..389
NoneNo IPR availableTMHMMTMhelixcoord: 561..583
NoneNo IPR availableTMHMMTMhelixcoord: 404..423
NoneNo IPR availableTMHMMTMhelixcoord: 529..548
NoneNo IPR availableTMHMMTMhelixcoord: 440..462
NoneNo IPR availableTMHMMTMhelixcoord: 335..354
IPR017978GPCR family 3, C-terminalPFAMPF000037tm_3coord: 343..588
e-value: 5.4E-46
score: 157.2
IPR017978GPCR family 3, C-terminalPROSITEPS50259G_PROTEIN_RECEP_F3_4coord: 331..593
score: 16.873