Casein kinase II subunit alpha

Overview
NameCasein kinase II subunit alpha
Smed IDSMED30017418
Length (bp)1507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Casein kinase II subunit alpha (SMED30017418) t-SNE clustered cells

Violin plots show distribution of expression levels for Casein kinase II subunit alpha (SMED30017418) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Casein kinase II subunit alpha (SMED30017418) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Casein kinase II subunit alpha (SMED30017418) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017418

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017418SMESG000024545.1 Contig35630newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017418SMESG000024545.1 Contig35630uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30017418SMESG000024545.1 dd_Smed_v4_1000_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Casein kinase II subunit alpha vs. Ensembl Human
Match: CSNK2A1 (casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2457])

HSP 1 Score: 510.375 bits (1313), Expect = 1.724e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Human
Match: CSNK2A1 (casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2457])

HSP 1 Score: 510.375 bits (1313), Expect = 1.724e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Human
Match: CSNK2A1 (casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2457])

HSP 1 Score: 510.375 bits (1313), Expect = 1.724e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Human
Match: CSNK2A1 (casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2457])

HSP 1 Score: 510.375 bits (1313), Expect = 1.724e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Human
Match: CSNK2A1 (casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2457])

HSP 1 Score: 510.375 bits (1313), Expect = 1.724e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Celegans
Match: kin-3 (Casein kinase II subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P18334])

HSP 1 Score: 474.552 bits (1220), Expect = 3.046e-166
Identity = 235/329 (71.43%), Postives = 290/329 (88.15%), Query Frame = 1
Query:   49 PLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS 1035
            P+ S++R+YA+ N +RP+EY+ Y    +EWG  DDYQ+VRK+GRGKYSEVF G + ST+E+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL D+V+DP+S TPALIFE+V+N+DFK LY TLSDYDIR+Y++ELLKAL+ CHS GIMHRDVKPHNVMID ++R+LRLIDWGLAEFYHP ++YNVRVASRYFKGPELL+DYQ YDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGTD+LY YI +Y I+LDP++N+ILGRHSRKRWERF++ +NQHL++ EALDFLDKLLRYDH ER+T++EA+ H YF  +V+  +
Sbjct:    3 PIPSRARVYAEVNPSRPREYWDYEAHMIEWGQIDDYQLVRKLGRGKYSEVFEGFKMSTDEKVVVKILKPVKKKKIKREIKILENLRGGTNIITLLDVVKDPISRTPALIFEHVNNSDFKQLYQTLSDYDIRYYLYELLKALDFCHSQGIMHRDVKPHNVMIDAEKRELRLIDWGLAEFYHPRQDYNVRVASRYFKGPELLVDYQCYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTDELYEYIARYHIDLDPRFNDILGRHSRKRWERFIHAENQHLVTPEALDFLDKLLRYDHAERLTAQEAMGHEYFRPVVEAHA 331          
BLAST of Casein kinase II subunit alpha vs. Ensembl Celegans
Match: cdk-12 (Cyclin-dependent kinase 12 [Source:UniProtKB/Swiss-Prot;Acc:P46551])

HSP 1 Score: 143.28 bits (360), Expect = 2.541e-36
Identity = 106/349 (30.37%), Postives = 193/349 (55.30%), Query Frame = 1
Query:   37 INSMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXX-----XXXREIKILQNL--KGCINI--ITLEDIVRDPMSNTPA---LIFEYVDNTDFKDLYPT--LSDYD---IRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEE-YNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHS---RKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTI 1020
            I + P+ +  R +A    NRP +  S+++T L       Y ++ +IG G Y +V+  +   T E+V +K ++   +         REIKIL+ L  K  + +  I ++DI  D +  T A   L+FEYVD+ D   L  +  L D++   I     +LL+ L   H+ G +HRD+K  N+++++ + +L++ D GLA  +      Y  RV + +++ PELLL  + Y  ++D+WS GCML   +F ++P F G+N + QL  I+KV G+ ++  +         P+  E++G ++   ++ ++R +  + +H++  EA+D LDK+L  + ++RI++KEAL H +  ++
Sbjct:  280 IATRPVITTRRGHA---TNRPSDSDSWYKTNLT-----HYTMLDQIGEGTYGQVYKAVNNLTGEQVALKRVRLENEKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDH-DLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNN-KGELKIADLGLARLWEKESRLYTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGE-LFTRKPLFNGNNEFGQLELISKVCGSPNVDNW---------PELTELVGWNTFRMKRTYQRRIREEFEHIMPREAVDLLDKMLTLNPEKRISAKEALNHPWIRSL 608          
BLAST of Casein kinase II subunit alpha vs. Ensembl Celegans
Match: cdk-12 (Cyclin-dependent kinase 12 [Source:UniProtKB/Swiss-Prot;Acc:P46551])

HSP 1 Score: 143.28 bits (360), Expect = 2.633e-36
Identity = 106/349 (30.37%), Postives = 193/349 (55.30%), Query Frame = 1
Query:   37 INSMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXX-----XXXREIKILQNL--KGCINI--ITLEDIVRDPMSNTPA---LIFEYVDNTDFKDLYPT--LSDYD---IRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEE-YNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHS---RKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTI 1020
            I + P+ +  R +A    NRP +  S+++T L       Y ++ +IG G Y +V+  +   T E+V +K ++   +         REIKIL+ L  K  + +  I ++DI  D +  T A   L+FEYVD+ D   L  +  L D++   I     +LL+ L   H+ G +HRD+K  N+++++ + +L++ D GLA  +      Y  RV + +++ PELLL  + Y  ++D+WS GCML   +F ++P F G+N + QL  I+KV G+ ++  +         P+  E++G ++   ++ ++R +  + +H++  EA+D LDK+L  + ++RI++KEAL H +  ++
Sbjct:  280 IATRPVITTRRGHA---TNRPSDSDSWYKTNLT-----HYTMLDQIGEGTYGQVYKAVNNLTGEQVALKRVRLENEKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDH-DLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNN-KGELKIADLGLARLWEKESRLYTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGE-LFTRKPLFNGNNEFGQLELISKVCGSPNVDNW---------PELTELVGWNTFRMKRTYQRRIREEFEHIMPREAVDLLDKMLTLNPEKRISAKEALNHPWIRSL 608          
BLAST of Casein kinase II subunit alpha vs. Ensembl Celegans
Match: cdk-12 (Cyclin-dependent kinase 12 [Source:UniProtKB/Swiss-Prot;Acc:P46551])

HSP 1 Score: 143.28 bits (360), Expect = 3.107e-36
Identity = 106/349 (30.37%), Postives = 193/349 (55.30%), Query Frame = 1
Query:   37 INSMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXX-----XXXREIKILQNL--KGCINI--ITLEDIVRDPMSNTPA---LIFEYVDNTDFKDLYPT--LSDYD---IRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEE-YNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHS---RKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTI 1020
            I + P+ +  R +A    NRP +  S+++T L       Y ++ +IG G Y +V+  +   T E+V +K ++   +         REIKIL+ L  K  + +  I ++DI  D +  T A   L+FEYVD+ D   L  +  L D++   I     +LL+ L   H+ G +HRD+K  N+++++ + +L++ D GLA  +      Y  RV + +++ PELLL  + Y  ++D+WS GCML   +F ++P F G+N + QL  I+KV G+ ++  +         P+  E++G ++   ++ ++R +  + +H++  EA+D LDK+L  + ++RI++KEAL H +  ++
Sbjct:  280 IATRPVITTRRGHA---TNRPSDSDSWYKTNLT-----HYTMLDQIGEGTYGQVYKAVNNLTGEQVALKRVRLENEKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDH-DLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNN-KGELKIADLGLARLWEKESRLYTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGE-LFTRKPLFNGNNEFGQLELISKVCGSPNVDNW---------PELTELVGWNTFRMKRTYQRRIREEFEHIMPREAVDLLDKMLTLNPEKRISAKEALNHPWIRSL 608          
BLAST of Casein kinase II subunit alpha vs. Ensembl Celegans
Match: cdk-2 (Cyclin-dependent kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O61847])

HSP 1 Score: 130.183 bits (326), Expect = 1.537e-33
Identity = 91/298 (30.54%), Postives = 156/298 (52.35%), Query Frame = 1
Query:  163 VRKIGRGKYSEVFAGIRFSTNEEXXXXXXXX-----XXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPA-LIFEYVDNTDFKDLYPTLSDYD-------IRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAE-FYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWE-RFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            +R+IG G Y  VF  I    N +  +K+++             REI  +++L+   NI+TL DI+    +N+   ++FE++D  D K+L   L   +       ++ ++++LL AL+ CH   I+HRD+KP N+++      +++ D+GLA  F  P   Y   V + +++ PE+LL  Q Y  SLDMWSLGC+ + I   K P F G     QL +I +++GT ++ ++     ++  P Y  +       +W      ++    ++   LD L ++LRY  + R+T+K AL H YF
Sbjct:   18 LRRIGEGTYGVVFKAIHVRDNVKCALKMIRTDRDEEGIPSTCLREISCIKDLQH-DNIVTLFDII---YANSKLYMVFEFIDR-DLKNLLEMLEPTNSVLPPNYVKSFMWQLLSALSYCHLRRIVHRDLKPQNILVSDSG-VIKIADFGLARNFSFPSRNYTHEVVTLWYRPPEILLGSQRYSTSLDMWSLGCIFSEIASNK-PLFPGECEISQLFKIFEIVGTPNIKSWPG---VDSFPHYKAVF-----PQWPVNLKKLEETSCLTGNGLDVLREILRYPPERRLTAKGALSHRYF 300          
BLAST of Casein kinase II subunit alpha vs. Ensembl Fly
Match: CkIIalpha (gene:FBgn0264492 transcript:FBtr0344974)

HSP 1 Score: 476.093 bits (1224), Expect = 3.228e-167
Identity = 239/329 (72.64%), Postives = 286/329 (86.93%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQ 1032
            M L S +R+Y D N ++P EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  +T E+ V+K+LKPVKK KIKREIKIL+NL+G  NIITL  +V+DP+S TPALIFE+V+NTDFK LY TL+DY+IR+Y+FELLKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT++LYAY+ KY I+LDP++++IL RHSRKRWERFV+ DNQHL+S EALDFLDKLLRYDH +R+T++EA+ H YF  IV  Q
Sbjct:    1 MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329          
BLAST of Casein kinase II subunit alpha vs. Ensembl Fly
Match: CkIIalpha (gene:FBgn0264492 transcript:FBtr0070044)

HSP 1 Score: 476.093 bits (1224), Expect = 3.228e-167
Identity = 239/329 (72.64%), Postives = 286/329 (86.93%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQ 1032
            M L S +R+Y D N ++P EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  +T E+ V+K+LKPVKK KIKREIKIL+NL+G  NIITL  +V+DP+S TPALIFE+V+NTDFK LY TL+DY+IR+Y+FELLKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT++LYAY+ KY I+LDP++++IL RHSRKRWERFV+ DNQHL+S EALDFLDKLLRYDH +R+T++EA+ H YF  IV  Q
Sbjct:    1 MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329          
BLAST of Casein kinase II subunit alpha vs. Ensembl Fly
Match: CkIIalpha (gene:FBgn0264492 transcript:FBtr0345138)

HSP 1 Score: 476.093 bits (1224), Expect = 3.228e-167
Identity = 239/329 (72.64%), Postives = 286/329 (86.93%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQ 1032
            M L S +R+Y D N ++P EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  +T E+ V+K+LKPVKK KIKREIKIL+NL+G  NIITL  +V+DP+S TPALIFE+V+NTDFK LY TL+DY+IR+Y+FELLKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT++LYAY+ KY I+LDP++++IL RHSRKRWERFV+ DNQHL+S EALDFLDKLLRYDH +R+T++EA+ H YF  IV  Q
Sbjct:    1 MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329          
BLAST of Casein kinase II subunit alpha vs. Ensembl Fly
Match: CkIIalpha (gene:FBgn0264492 transcript:FBtr0111141)

HSP 1 Score: 476.093 bits (1224), Expect = 3.228e-167
Identity = 239/329 (72.64%), Postives = 286/329 (86.93%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQ 1032
            M L S +R+Y D N ++P EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  +T E+ V+K+LKPVKK KIKREIKIL+NL+G  NIITL  +V+DP+S TPALIFE+V+NTDFK LY TL+DY+IR+Y+FELLKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT++LYAY+ KY I+LDP++++IL RHSRKRWERFV+ DNQHL+S EALDFLDKLLRYDH +R+T++EA+ H YF  IV  Q
Sbjct:    1 MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329          
BLAST of Casein kinase II subunit alpha vs. Ensembl Fly
Match: CkIIalpha (gene:FBgn0264492 transcript:FBtr0070043)

HSP 1 Score: 476.093 bits (1224), Expect = 3.228e-167
Identity = 239/329 (72.64%), Postives = 286/329 (86.93%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQ 1032
            M L S +R+Y D N ++P EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  +T E+ V+K+LKPVKK KIKREIKIL+NL+G  NIITL  +V+DP+S TPALIFE+V+NTDFK LY TL+DY+IR+Y+FELLKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT++LYAY+ KY I+LDP++++IL RHSRKRWERFV+ DNQHL+S EALDFLDKLLRYDH +R+T++EA+ H YF  IV  Q
Sbjct:    1 MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329          
BLAST of Casein kinase II subunit alpha vs. Ensembl Zebrafish
Match: zgc:86598 (zgc:86598 [Source:ZFIN;Acc:ZDB-GENE-040625-181])

HSP 1 Score: 508.064 bits (1307), Expect = 9.373e-179
Identity = 252/343 (73.47%), Postives = 299/343 (87.17%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGS 1071
            S P++S+SR+Y D N  RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DI++DP+S TPAL+FE+V+NTDFK LY TLSDYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFY IV++Q+ M +      GS
Sbjct:    2 SGPVTSRSRVYPDVNTQRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDIIKDPVSRTPALVFEHVNNTDFKQLYQTLSDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPSQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMEHPYFYPIVKDQARMGSTSGLSTGS 344          
BLAST of Casein kinase II subunit alpha vs. Ensembl Zebrafish
Match: zgc:86598 (zgc:86598 [Source:ZFIN;Acc:ZDB-GENE-040625-181])

HSP 1 Score: 508.064 bits (1307), Expect = 9.373e-179
Identity = 252/343 (73.47%), Postives = 299/343 (87.17%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGS 1071
            S P++S+SR+Y D N  RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DI++DP+S TPAL+FE+V+NTDFK LY TLSDYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFY IV++Q+ M +      GS
Sbjct:    2 SGPVTSRSRVYPDVNTQRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDIIKDPVSRTPALVFEHVNNTDFKQLYQTLSDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPSQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMEHPYFYPIVKDQARMGSTSGLSTGS 344          
BLAST of Casein kinase II subunit alpha vs. Ensembl Zebrafish
Match: zgc:86598 (zgc:86598 [Source:ZFIN;Acc:ZDB-GENE-040625-181])

HSP 1 Score: 508.064 bits (1307), Expect = 9.373e-179
Identity = 252/343 (73.47%), Postives = 299/343 (87.17%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGS 1071
            S P++S+SR+Y D N  RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DI++DP+S TPAL+FE+V+NTDFK LY TLSDYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFY IV++Q+ M +      GS
Sbjct:    2 SGPVTSRSRVYPDVNTQRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDIIKDPVSRTPALVFEHVNNTDFKQLYQTLSDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPSQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMEHPYFYPIVKDQARMGSTSGLSTGS 344          
BLAST of Casein kinase II subunit alpha vs. Ensembl Zebrafish
Match: csnk2a1 (casein kinase 2, alpha 1 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-27])

HSP 1 Score: 502.286 bits (1292), Expect = 2.236e-176
Identity = 251/338 (74.26%), Postives = 298/338 (88.17%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS-GMVAAG 1053
            S P+ S+SR+Y D N  RP+EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DI++DP+S TPAL+FE+V+NTDFK LY TLSDYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H+YFY IV++Q  G  AAG
Sbjct:    2 SGPVPSRSRVYPDVNTQRPREYWDYESHVVDWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDIIKDPVSRTPALVFEHVNNTDFKQLYQTLSDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPNQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMDHSYFYPIVKDQGRGAPAAG 339          
BLAST of Casein kinase II subunit alpha vs. Ensembl Zebrafish
Match: csnk2a1 (casein kinase 2, alpha 1 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-27])

HSP 1 Score: 502.286 bits (1292), Expect = 2.236e-176
Identity = 251/338 (74.26%), Postives = 298/338 (88.17%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS-GMVAAG 1053
            S P+ S+SR+Y D N  RP+EY+ Y    ++WG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DI++DP+S TPAL+FE+V+NTDFK LY TLSDYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H+YFY IV++Q  G  AAG
Sbjct:    2 SGPVPSRSRVYPDVNTQRPREYWDYESHVVDWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDIIKDPVSRTPALVFEHVNNTDFKQLYQTLSDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPNQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMDHSYFYPIVKDQGRGAPAAG 339          
BLAST of Casein kinase II subunit alpha vs. Ensembl Xenopus
Match: fndc4 (fibronectin type III domain containing 4 [Source:Xenbase;Acc:XB-GENE-997773])

HSP 1 Score: 471.085 bits (1211), Expect = 1.156e-164
Identity = 239/315 (75.87%), Postives = 281/315 (89.21%), Query Frame = 1
Query:  148 DDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H YFY IV++QS M    + +GST + S  +
Sbjct:    2 DDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQTRLTAREAMDHPYFYPIVKDQSRMGGSNMPSGSTPVSSASM 316          
BLAST of Casein kinase II subunit alpha vs. Ensembl Xenopus
Match: fndc4 (fibronectin type III domain containing 4 [Source:Xenbase;Acc:XB-GENE-997773])

HSP 1 Score: 470.7 bits (1210), Expect = 2.529e-164
Identity = 239/315 (75.87%), Postives = 281/315 (89.21%), Query Frame = 1
Query:  148 DDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H YFY IV++QS M    + +GST + S  +
Sbjct:    9 DDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQTRLTAREAMDHPYFYPIVKDQSRMGGSNMPSGSTPVSSASM 323          
BLAST of Casein kinase II subunit alpha vs. Ensembl Xenopus
Match: csnk2a2 (casein kinase 2 alpha 2 [Source:NCBI gene;Acc:493442])

HSP 1 Score: 465.307 bits (1196), Expect = 2.086e-162
Identity = 232/344 (67.44%), Postives = 287/344 (83.43%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDLKV 1086
             SK+R+YAD N  R +EY+ Y      WG+ +DYQ+VRK+GRGKYSEVF  I  + NE VV+K+LKPVKK KIKRE+KIL+NL+G  NII L D ++DP+S TPAL+FEY++NTDFK LY  L+DYDIR+Y++ELLKAL+ CHS G+MHRDVKPHNVMIDHQ++KLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+LY+Y+ KY IELDP +N+ILG+HSRKRWE F++ +N+HL+S EALD LDKLLRYDHQ+R+T++EA++H YFY +++E   + A   + L  G L  
Sbjct:    7 GSKARVYADVNSLRSREYWDYEAHVPNWGNQEDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIRLLDTIKDPVSKTPALVFEYINNTDFKQLYQILTDYDIRYYMYELLKALDYCHSQGVMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYSYLKKYHIELDPHFNDILGQHSRKRWENFLHSENRHLVSAEALDLLDKLLRYDHQQRLTAREAMDHPYFYPVIKE---LQAQTDSTLLPGSLSA 347          
BLAST of Casein kinase II subunit alpha vs. Ensembl Xenopus
Match: csnk2a2 (casein kinase 2 alpha 2 [Source:NCBI gene;Acc:493442])

HSP 1 Score: 456.447 bits (1173), Expect = 2.785e-159
Identity = 226/319 (70.85%), Postives = 276/319 (86.52%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
             SK+R+YAD N  R +EY+ Y      WG+ +DYQ+VRK+GRGKYSEVF  I  + NE VV+K+LKPVKK KIKRE+KIL+NL+G  NII L D ++DP+S TPAL+FEY++NTDFK LY  L+DYDIR+Y++ELLKAL+ CHS G+MHRDVKPHNVMIDHQ++KLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+LY+Y+ KY IELDP +N+ILG+HSRKRWE F++ +N+HL+S EALD LDKLLRYDHQ+R+T++EA++H YF
Sbjct:    7 GSKARVYADVNSLRSREYWDYEAHVPNWGNQEDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIRLLDTIKDPVSKTPALVFEYINNTDFKQLYQILTDYDIRYYMYELLKALDYCHSQGVMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYSYLKKYHIELDPHFNDILGQHSRKRWENFLHSENRHLVSAEALDLLDKLLRYDHQQRLTAREAMDHPYF 325          
BLAST of Casein kinase II subunit alpha vs. Ensembl Xenopus
Match: fndc4 (fibronectin type III domain containing 4 [Source:Xenbase;Acc:XB-GENE-997773])

HSP 1 Score: 450.669 bits (1158), Expect = 1.685e-157
Identity = 230/293 (78.50%), Postives = 267/293 (91.13%), Query Frame = 1
Query:  148 DDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQ 1026
            DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H YF   +Q
Sbjct:    2 DDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQTRLTAREAMDHPYFCKCLQ 294          
BLAST of Casein kinase II subunit alpha vs. Ensembl Mouse
Match: Csnk2a1 (casein kinase 2, alpha 1 polypeptide [Source:MGI Symbol;Acc:MGI:88543])

HSP 1 Score: 513.072 bits (1320), Expect = 1.182e-180
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Mouse
Match: Csnk2a2 (casein kinase 2, alpha prime polypeptide [Source:MGI Symbol;Acc:MGI:88547])

HSP 1 Score: 474.552 bits (1220), Expect = 3.052e-166
Identity = 239/340 (70.29%), Postives = 289/340 (85.00%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSG 1074
             S++R+YA+ N  R +EY+ Y      WG+ DDYQ+VRK+GRGKYSEVF  I  + NE VV+K+LKPVKK KIKRE+KIL+NL+G  NII L D V+DP+S TPAL+FEY++NTDFK LY  L+D+DIRFY++ELLKAL+ CHS GIMHRDVKPHNVMIDHQ++KLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+LY Y+ KY I+LDP +N+ILG+HSRKRWE F++ +N+HL+S EALD LDKLLRYDHQ+R+T+KEA+EH YFY +V+EQS    A +TVL SG
Sbjct:    7 GSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQS-QPCAENTVLSSG 345          
BLAST of Casein kinase II subunit alpha vs. Ensembl Mouse
Match: Csnk2a2 (casein kinase 2, alpha prime polypeptide [Source:MGI Symbol;Acc:MGI:88547])

HSP 1 Score: 474.552 bits (1220), Expect = 3.052e-166
Identity = 239/340 (70.29%), Postives = 289/340 (85.00%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSG 1074
             S++R+YA+ N  R +EY+ Y      WG+ DDYQ+VRK+GRGKYSEVF  I  + NE VV+K+LKPVKK KIKRE+KIL+NL+G  NII L D V+DP+S TPAL+FEY++NTDFK LY  L+D+DIRFY++ELLKAL+ CHS GIMHRDVKPHNVMIDHQ++KLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+LY Y+ KY I+LDP +N+ILG+HSRKRWE F++ +N+HL+S EALD LDKLLRYDHQ+R+T+KEA+EH YFY +V+EQS    A +TVL SG
Sbjct:    7 GSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQS-QPCAENTVLSSG 345          
BLAST of Casein kinase II subunit alpha vs. Ensembl Mouse
Match: Csnk2a2 (casein kinase 2, alpha prime polypeptide [Source:MGI Symbol;Acc:MGI:88547])

HSP 1 Score: 365.155 bits (936), Expect = 5.395e-125
Identity = 169/225 (75.11%), Postives = 199/225 (88.44%), Query Frame = 1
Query:  400 FKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSG 1074
             K LY  L+D+DIRFY++ELLKAL+ CHS GIMHRDVKPHNVMIDHQ++KLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+LY Y+ KY I+LDP +N+ILG+HSRKRWE F++ +N+HL+S EALD LDKLLRYDHQ+R+T+KEA+EH YFY +V+EQS    A +TVL SG
Sbjct:    7 LKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQS-QPCAENTVLSSG 230          
BLAST of Casein kinase II subunit alpha vs. Ensembl Mouse
Match: Csnk2a2 (casein kinase 2, alpha prime polypeptide [Source:MGI Symbol;Acc:MGI:88547])

HSP 1 Score: 345.125 bits (884), Expect = 5.888e-117
Identity = 164/248 (66.13%), Postives = 197/248 (79.44%), Query Frame = 1
Query:  292 LQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS 1035
            L+NL+G  NII L D V+DP+S TPAL+FEY++NTDFK LY  L+D+DIRFY++ELL                            KLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+LY Y+ KY I+LDP +N+ILG+HSRKRWE F++ +N+HL+S EALD LDKLLRYDHQ+R+T+KEA+EH YFY +V+EQS
Sbjct:   19 LENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELL----------------------------KLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQS 238          
BLAST of Casein kinase II subunit alpha vs. UniProt/SwissProt
Match: sp|Q60737|CSK21_MOUSE (Casein kinase II subunit alpha OS=Mus musculus OX=10090 GN=Csnk2a1 PE=1 SV=2)

HSP 1 Score: 513.072 bits (1320), Expect = 8.268e-180
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. UniProt/SwissProt
Match: sp|P19139|CSK21_RAT (Casein kinase II subunit alpha OS=Rattus norvegicus OX=10116 GN=Csnk2a1 PE=1 SV=2)

HSP 1 Score: 512.301 bits (1318), Expect = 1.396e-179
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSAGMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. UniProt/SwissProt
Match: sp|P68400|CSK21_HUMAN (Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 8.278e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. UniProt/SwissProt
Match: sp|P68399|CSK21_BOVIN (Casein kinase II subunit alpha OS=Bos taurus OX=9913 GN=CSNK2A1 PE=1 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 8.278e-179
Identity = 254/350 (72.57%), Postives = 306/350 (87.43%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +  GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. UniProt/SwissProt
Match: sp|P21868|CSK21_CHICK (Casein kinase II subunit alpha OS=Gallus gallus OX=9031 GN=CSNK2A1 PE=2 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 6.446e-178
Identity = 254/350 (72.57%), Postives = 304/350 (86.86%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFY IV++Q+ M    +  GST + S  +
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYPIVKDQARMGSSNMPGGSTPVSSASM 351          
BLAST of Casein kinase II subunit alpha vs. TrEMBL
Match: G3SRS0 (Protein kinase domain-containing protein OS=Loxodonta africana OX=9785 GN=CSNK2A1 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.324e-177
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. TrEMBL
Match: Q61177 (Casein kinase II alpha subunit OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.371e-177
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. TrEMBL
Match: A0A2K5Q3G4 (Protein kinase domain-containing protein OS=Cebus capucinus imitator OX=1737458 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.566e-177
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. TrEMBL
Match: A0A2K5E7I8 (Protein kinase domain-containing protein OS=Aotus nancymaae OX=37293 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.566e-177
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. TrEMBL
Match: F7I6P4 (Casein kinase II subunit alpha isoform a OS=Callithrix jacchus OX=9483 GN=CSNK2A1 PE=2 SV=2)

HSP 1 Score: 512.301 bits (1318), Expect = 4.566e-177
Identity = 255/350 (72.86%), Postives = 307/350 (87.71%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM----VAAGSTVLGSGDL 1080
            S P+ S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFYT+V++Q+ M    +A GST + S ++
Sbjct:    2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMAGGSTPVSSANM 351          
BLAST of Casein kinase II subunit alpha vs. Ensembl Cavefish
Match: csnk2a1 (casein kinase II subunit alpha-like [Source:NCBI gene;Acc:103028340])

HSP 1 Score: 503.827 bits (1296), Expect = 3.839e-177
Identity = 253/338 (74.85%), Postives = 297/338 (87.87%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS-GMVAAG 1053
            S P+SS+SR+Y D N  RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL DIV+DP+S TPAL+FE+V+NTDFK LY TLSDYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H YFY IV++Q  G   AG
Sbjct:    2 SGPVSSRSRVYPDVNTQRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDIVKDPVSRTPALVFEHVNNTDFKQLYQTLSDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPNQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMDHPYFYPIVKDQGRGAPPAG 339          
BLAST of Casein kinase II subunit alpha vs. Ensembl Cavefish
Match: csnk2a4 (casein kinase II subunit alpha [Source:NCBI gene;Acc:103042686])

HSP 1 Score: 503.442 bits (1295), Expect = 4.749e-177
Identity = 251/348 (72.13%), Postives = 305/348 (87.64%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDLKV 1086
            S P+ S++R+Y + N +RP+EY+ Y    +EWG+ DD+Q+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII+L DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IEL+P++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFY +V++QS MV  GST + + +  V
Sbjct:    2 SGPVPSRARVYTEVNTHRPREYWDYESHVVEWGNQDDFQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIISLIDIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELEPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQARLTAREAMEHPYFYPVVKDQSRMV--GSTNVPAANTAV 347          
BLAST of Casein kinase II subunit alpha vs. Ensembl Cavefish
Match: csnk2a4 (casein kinase II subunit alpha [Source:NCBI gene;Acc:103042686])

HSP 1 Score: 491.5 bits (1264), Expect = 8.973e-173
Identity = 249/356 (69.94%), Postives = 301/356 (84.55%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVA--AGSTVLGSGDLKVIPLAQA 1104
            S P+ S++R+Y + N +RP+EY+ Y    +EWG+ DD+Q+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII+L DIV+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IEL+P++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YF       S  +   AGS VL + +    P+  A
Sbjct:    2 SGPVPSRARVYTEVNTHRPREYWDYESHVVEWGNQDDFQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIISLIDIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELEPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQARLTAREAMEHPYFCIAALPASTALGPLAGSPVLSAANNLSAPVPAA 357          
BLAST of Casein kinase II subunit alpha vs. Ensembl Cavefish
Match: csnk2a2b (casein kinase 2 alpha 2 [Source:NCBI gene;Acc:103042119])

HSP 1 Score: 467.618 bits (1202), Expect = 1.403e-163
Identity = 234/340 (68.82%), Postives = 287/340 (84.41%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSG 1074
             SK+R+YAD N  + +EY+ Y      W + +DYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII L D V+DP+S TPAL+FE ++NTDFK+LY  L+D+DIRFY++ELLKAL+ CHSMGIMHRDVKPHNVMIDHQ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGTD+L+ Y+ KY IELDP++ ++LG+ +RKRWE+FV  +NQHL+S EALD LDKLLRYDHQ+R+T+ EA+EH YFY +++EQS  +A   + +GSG
Sbjct:    7 GSKARVYADVNTLKSREYWDYEAHVPSWSNQEDYQLVRKLGRGKYSEVFEAININNNEKVVVKILKPVKKKKIKREIKILENLRGGTNIIRLVDTVKDPVSRTPALVFECINNTDFKELYQKLTDFDIRFYMYELLKALDYCHSMGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFQKEPFFHGQDNYDQLVRIAKVLGTDELFGYLRKYHIELDPRFKDLLGQQTRKRWEQFVQTENQHLVSPEALDLLDKLLRYDHQQRLTATEAMEHPYFYPVLKEQS--LANADSTVGSG 344          
BLAST of Casein kinase II subunit alpha vs. Ensembl Cavefish
Match: csnk2a2a (casein kinase 2, alpha prime polypeptide a [Source:ZFIN;Acc:ZDB-GENE-990415-28])

HSP 1 Score: 457.603 bits (1176), Expect = 3.322e-158
Identity = 229/342 (66.96%), Postives = 285/342 (83.33%), Query Frame = 1
Query:   49 PLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSG 1074
            P +SK+R+YAD N  + K+Y+ Y      W + DDYQ+VRK+GRGKYSEVF  I  ++N+ VV+K+LKPVKK KIKREIKIL+NL+G  NII L D V+DP+S TPAL+FE ++NTDFKDLY  L+D+DIRFY++ELLKAL+  HSMGIMHRDVKPHNVMIDHQ RKLRLIDWGLAEFYHP +EYNVRVASR +KGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGT++LY+Y++KY IELD ++ ++LG+ +RKRWE FV  +NQHL+S EALD LDKLLRYDHQ+R+T++EA+EH YFY +++ QS   + G+  + S 
Sbjct:   95 PAASKARVYADVNTLKSKDYWDYEAHVPSWSNQDDYQLVRKLGRGKYSEVFEAININSNDRVVVKILKPVKKKKIKREIKILENLRGGTNIIRLVDTVKDPVSRTPALVFECINNTDFKDLYQRLTDFDIRFYLYELLKALDYSHSMGIMHRDVKPHNVMIDHQMRKLRLIDWGLAEFYHPSQEYNVRVASRSYKGPELLVDYQMYDYSLDMWSLGCMLASMIFQKEPFFHGQDNYDQLVRIAKVLGTEELYSYLNKYHIELDTRFKDLLGQQTRKRWEHFVQPENQHLVSPEALDLLDKLLRYDHQQRLTAQEAMEHPYFYPVLKGQSLSNSDGTLAISSS 436          
BLAST of Casein kinase II subunit alpha vs. Ensembl Sea Lamprey
Match: CSNK2A2 (casein kinase 2 alpha 2 [Source:HGNC Symbol;Acc:HGNC:2459])

HSP 1 Score: 502.286 bits (1292), Expect = 3.006e-177
Identity = 249/338 (73.67%), Postives = 299/338 (88.46%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGS 1056
            S P++S++R+Y D N +RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NIITL D+V+DP+S TPAL+FE+V+NTDFK LY TL+DYDIRFY++E+L+AL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLD+WSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA+EH YFY IV+EQ G +   S
Sbjct:    2 SAPVASRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLLDVVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILRALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDLWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQTRLTAREAMEHPYFYPIVKEQ-GRIGTNS 338          
BLAST of Casein kinase II subunit alpha vs. Ensembl Sea Lamprey
Match: CSNK2A2 (casein kinase 2 alpha 2 [Source:HGNC Symbol;Acc:HGNC:2459])

HSP 1 Score: 490.73 bits (1262), Expect = 1.161e-172
Identity = 247/351 (70.37%), Postives = 300/351 (85.47%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQ------SGMVAAGSTVLGSGD 1077
            S P++S+ ++YA+AN +R ++Y+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKILQNL+G  NIITL DIV+DP+S TPAL+FEYV+NTD+K LY TL+D DIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIA+VLGT++LY YI KY I+LDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T +EA+EH YFY +V+E       SG+    +T   + D
Sbjct:    2 SGPVASRPKLYAEANSHRARDYWDYEAHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILQNLRGGPNIITLLDIVKDPVSRTPALVFEYVNNTDYKQLYQTLTDQDIRFYMYEILKALDFCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIARVLGTEELYTYIDKYNIDLDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQTRLTPREAMEHPYFYPVVKEHGRKGSMSGLFGNSTTPSSTPD 352          
BLAST of Casein kinase II subunit alpha vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 126.331 bits (316), Expect = 4.773e-33
Identity = 93/304 (30.59%), Postives = 148/304 (48.68%), Query Frame = 1
Query:  148 DDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXX-----XXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDI-----RFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAE-FYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQ 1026
            D++Q V KIG G Y  V+      T E V +K                REI +L+ L    NI+ L  I+         L+FE +D  D K      +   I     + Y+++LL+ +  CHS  I+HRD+KP N++I+ +   ++L D+GLA  F  P   Y   V + +++ PE+LL  + Y  S+D+WS+GC+ A ++ ++   F G +  DQL RI + LGT D   +    ++   P Y     R + +   + V   N      E  D L  +L+YD  +R+T+  AL H +F  + Q
Sbjct:    2 DNFQKVEKIGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVPSTAIREISLLRELNHP-NIVRLLTIIHS--EKKLYLVFELLDQ-DLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEG-AIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRA-LFPGDSEIDQLFRIFRTLGTPDEVVWPGVSQL---PDYKSTFPRWANQELTKVVPTLN-----FEGRDLLALMLQYDPNQRVTANMALSHCFFQNVKQ 291          
BLAST of Casein kinase II subunit alpha vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 127.872 bits (320), Expect = 4.786e-33
Identity = 94/323 (29.10%), Postives = 172/323 (53.25%), Query Frame = 1
Query:   82 ANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXX-----XXXXXXXXXXREIKILQNLK-----GCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDL--YPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWER-FVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            A+ +  K +Y     ++ W  P  Y  +  +G G Y  V + +   T  +V +K         V   +  RE+++L+++K     G +++ T  D + D   +   L+  ++  TD   +  +   SD  +++ I+++LK L   HS GI+HRD+KP N+ ++ +  +L+++D+GLA   H  +E    V +R+++ PE++L++  Y  ++D+WS+GC++A +I  K P F G+++ DQL  I K+ GT   Y      E E   KY + L +  ++R    F N +        A+D L+K+L  D ++R T+ EAL+H +F
Sbjct:    3 AHASSRKGFYRIEINKMVWEVPKRYSQLFAVGSGAYGTVCSSMDLVTGSKVAVKKLYRPFQSRVFAKRAYRELRLLKHMKHENVIGLVDVFTPNDTL-DQFQDF-YLVMPFM-GTDLSKIMKHGKQSDDKVQYLIYQILKGLKYIHSSGIIHRDLKPGNLAVN-EDCELKILDFGLAR--HADQEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGK-PLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAA-KYIKTLPKMEKRRISTVFPNANPI------AIDLLEKMLALDPEQRPTASEALQHPFF 311          
BLAST of Casein kinase II subunit alpha vs. Ensembl Sea Lamprey
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 121.324 bits (303), Expect = 2.201e-31
Identity = 84/253 (33.20%), Postives = 135/253 (53.36%), Query Frame = 1
Query:  277 REIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYV--DNTDFKDLYPTLSDYDIRF-----YIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAE-FYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            REI +L+ L+   NI+ L+D++    S    LIFEY+  D   + D  P     +        Y+ ++L+A+  CHS  ++HRD+KP N++ID +   ++L D+GLA  F  P   Y   V + +++ PE+LL    Y   +DMWS+G +LA ++  K P F G +  DQL RI ++LGT     +    ++   P Y     + S  +W     V +   ++ + +D L+K+L YD   RI++K AL H YF
Sbjct:   38 REIALLRELRHP-NIVRLQDVLLQ--SARLYLIFEYLPMDLKRYLDAIPAGHCMEPPLIQGQSYLHQILQAVVFCHSRRVLHRDLKPQNLLID-RHGHIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGTPRYSTPVDMWSVGTILAEMV-NKRPLFHGDSEIDQLFRIFRILGTPTTEVW---PDVVTLPDY-----KPSFPKWVPSGLVAHVPGLNQDGIDLLEKMLTYDPARRISAKRALTHPYF 277          
BLAST of Casein kinase II subunit alpha vs. Ensembl Yeast
Match: CKA2 (Alpha' catalytic subunit of casein kinase 2 (CK2); CK2 is a Ser/Thr protein kinase with roles in cell growth and proliferation; CK2, comprised of CKA1, CKA2, CKB1 and CKB2, has many substrates including transcription factors and all RNA polymerases; protein abundance increases in response to DNA replication stress; regulates Fkh1p-mediated donor preference during mating-type switching [Source:SGD;Acc:S000005587])

HSP 1 Score: 359.377 bits (921), Expect = 4.494e-122
Identity = 185/321 (57.63%), Postives = 236/321 (73.52%), Query Frame = 1
Query:   58 SKSRIYADANINRPKEYYSYHQ-TELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYT 1017
            S +R+Y +A   RP+EY+ Y Q   ++WG   +Y+I+ KIGRGKYSEVF+G     N++ VIKVLKPVK  KI RE+KIL NL G  N++ L DIV+D  S  PALIFE + N DF+ LYPT    DI++Y  +LL AL+ CHSMGIMHRDVKP NVMID   RKLRLIDWGLAEFYHPG +YNVRVASRY KGPELL++   YDYSLD+WS+GCMLA+I+FKKEPFF+G +N DQL +IA VLGT +L  Y+ KY + L  +Y+ I+   ++K W  F+  + + L   E +D +D LLRYDHQER+T+KEA++H +F T
Sbjct:   17 SVARVYKNACEERPQEYWDYEQGVTIDWGKISNYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVKMKKIYRELKILTNLTGGPNVVGLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSSNPDQLVKIATVLGTKELLGYLGKYGLHLPSEYDNIMRDFTKKSWTHFITSETK-LAVPEVVDLIDNLLRYDHQERLTAKEAMDHKFFKT 336          
BLAST of Casein kinase II subunit alpha vs. Ensembl Yeast
Match: CKA1 (Alpha catalytic subunit of casein kinase 2 (CK2); a Ser/Thr protein kinase with roles in cell growth and proliferation; CK2, comprised of CKA1, CKA2, CKB1 and CKB2, has many substrates including transcription factors and all RNA polymerases; regulates Fkh1p-mediated donor preference during mating-type switching [Source:SGD;Acc:S000001297])

HSP 1 Score: 355.91 bits (912), Expect = 2.717e-120
Identity = 202/364 (55.49%), Postives = 254/364 (69.78%), Query Frame = 1
Query:   58 SKSRIYADANINRPKEYYSYHQTELEWGS-PDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLK--------------------------------------GCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISN-EALDFLDKLLRYDHQERITSKEALEHNYFYTIVQE 1029
            S++R+Y + N  R +EY+ Y  T ++W +   DY+I  K+GRGKYSEVF G++  +  ++VIK+LKPVKK KIKREIKIL +L                                       G  NII L DI++DP+S TPAL+FEYVDN DF+ LYP L+D +IRFY+FELLKAL+ CHSMGIMHRDVKPHNVMIDH+ +KLRLIDWGLAEFYH   EYNVRVASR+FKGPELL+DY+MYDYSLD+WS G MLAS+IFK+EPFF G +N DQL +I KVLGT D   Y+ KYEI L P+    + ++ RK W RF+N  N+HL  N E +D +D LLRYDHQER+T+KEA+ H +F  I ++
Sbjct:    7 SEARVYTNINKQRTEEYWDYENTVIDWSTNTKDYEIENKVGRGKYSEVFQGVKLDSKVKIVIKMLKPVKKKKIKREIKILTDLSNEKVPPTTLPFQKDQYYTNQKEDVLKFIRPYIFDQPHNGHANIIHLFDIIKDPISKTPALVFEYVDNVDFRILYPKLTDLEIRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHVNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGTSDFEKYLLKYEITL-PREFYDMDQYIRKPWHRFINDGNKHLSGNDEIIDLIDNLLRYDHQERLTAKEAMGHPWFAPIREQ 369          
BLAST of Casein kinase II subunit alpha vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 132.109 bits (331), Expect = 2.270e-35
Identity = 88/305 (28.85%), Postives = 162/305 (53.11%), Query Frame = 1
Query:  142 SPDDYQIVRKIGRGKYSEVFAGIRFSTNE----EXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDN-----TDFKDLYPTLSDYD---IRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAE-FYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGT--DDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            S   ++ + K+G G Y+ V+ G+  +T      + V    +        REI +++ LK   NI+ L D++     N   L+FE++DN      D + +  T    +   ++++ ++LL+ L  CH   I+HRD+KP N++I+ +R +L+L D+GLA  F  P   ++  V + +++ P++L+  + Y  S+D+WS GC+LA +I  K P F G N+ +QL  I  ++GT  + L+  + K      PKYN  + +   +   + +    +  +    +DFL  LL+ +   R+++K+AL H +F
Sbjct:    3 SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHE-NIVRLYDVIH--TENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLIN-KRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGK-PLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKL-----PKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWF 297          
BLAST of Casein kinase II subunit alpha vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 122.865 bits (307), Expect = 2.232e-31
Identity = 94/312 (30.13%), Postives = 166/312 (53.21%), Query Frame = 1
Query:  145 PDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXX----XXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMS----NTPALIFEYVDNTDFKDL-------YPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVR--------VASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            P  Y++V  IG G Y  V + I   +  +V IK      K +   +  REIK+L+      NII++ D VR P+S    N   L+ E ++ TD + +       + TLSD  ++++ +++L+AL   HS  ++HRD+KP N++++     L++ D+GLA       +            VA+R+++ PE++L +Q Y  ++D+WS GC+LA ++  K P F G + + QL  I +VLGT     + ++ + +   +Y   L       WE    V ++  ++ + +D LDK+L+++  +RI++ EAL H Y 
Sbjct:   10 PSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVR-PVSIDKLNAVYLVEELME-TDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLN-SNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGK-PLFPGRDYHHQLWLILEVLGTPSFEDF-NQIKSKRAKEYIANLPMRPPLPWE---TVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYL 313          
BLAST of Casein kinase II subunit alpha vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 121.709 bits (304), Expect = 2.258e-30
Identity = 95/307 (30.94%), Postives = 162/307 (52.77%), Query Frame = 1
Query:  154 YQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXX--------XXXXREIKILQNLKGCINIITL--EDIVRDPMSNTPAL-IFEYVDNTDFKDLYPT---LSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVR-----VASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGT--DDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            +Q++++IG G Y  +    RF+   E     +K V           +  RE+K+L++ +G  NI  L   DIV  P  +   L ++E +   D   +  +   L+D   + + +++L  L   HS  ++HRD+KP N++++    +L++ D+GLA  Y      N +     VA+R+++ PE++L YQ Y  ++D+WS GC+LA  +  K P F+G +  +QL +I +VLGT  D+    I    ++    Y   LG   +     FVN+      +++ALD L+++L +D Q+RIT  EALEH Y 
Sbjct:   23 FQLIKEIGHGAYG-IVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADC-QLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK-PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQ---DYIHQLGFIPKV---PFVNLYPN--ANSQALDLLEQMLAFDPQKRITVDEALEHPYL 318          
BLAST of Casein kinase II subunit alpha vs. Ensembl Nematostella
Match: EDO41552 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3V6])

HSP 1 Score: 478.019 bits (1229), Expect = 8.148e-168
Identity = 236/333 (70.87%), Postives = 290/333 (87.09%), Query Frame = 1
Query:   37 INSMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS 1035
            ++S   SS++R+YAD N++RP+EY+ Y    +EWG  D+Y++VRK+GRGKYSEVF  I  + +E+VV+K+LKPVKK KIKREIKILQNL+G +NII L D+V+DP+S TPALIFEYV+NTDFK LY T +D+DIRFY+FELLKAL+ CHS GIMHRDVKPHNVMIDH  R LRLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+D+Q YDYSLDMWS GCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DL+ YI KY IELDP++N+ILGRHS+KRWERFV+ +NQHL+S EALD LD+LL+YD QER+++KEA++H YFY +V++Q 
Sbjct:    1 MSSATASSRARVYADVNVHRPREYWDYESHVIEWGQQDNYELVRKLGRGKYSEVFEAINITNDEKVVVKILKPVKKKKIKREIKILQNLRGGVNIIDLLDVVKDPVSRTPALIFEYVNNTDFKQLYQTFTDFDIRFYLFELLKALDFCHSRGIMHRDVKPHNVMIDHDNRTLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDHQEYDYSLDMWSFGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLFDYIEKYHIELDPRFNDILGRHSKKRWERFVHSENQHLVSPEALDLLDRLLKYDIQERVSAKEAMDHPYFYPVVKQQG 333          
BLAST of Casein kinase II subunit alpha vs. Ensembl Nematostella
Match: EDO26521 (pep supercontig:ASM20922v1:NEMVEscaffold_6854:158:6600:-1 gene:NEMVEDRAFT_v1g154013 transcript:EDO26521 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 3.075e-59
Identity = 86/105 (81.90%), Postives = 98/105 (93.33%), Query Frame = 1
Query:  550 LRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGR 864
            +RLIDWGLAEFYHPG+EYNVRVASRYFKGPELL+D+Q YDYSLDMWS GCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DL+ YI KY IELDP++N+ILGR
Sbjct:    1 MRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDHQEYDYSLDMWSFGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLFDYIEKYHIELDPRFNDILGR 105          
BLAST of Casein kinase II subunit alpha vs. Ensembl Nematostella
Match: EDO48117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK70])

HSP 1 Score: 135.576 bits (340), Expect = 5.705e-36
Identity = 97/330 (29.39%), Postives = 170/330 (51.52%), Query Frame = 1
Query:  124 TELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNE----EXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFK----DLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYH-PGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGT--DDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDL 1080
            +EL +G  + Y  + K+G G Y+ VF G    T+     + +    +        RE+ +L+ LK   NI+TL D V    S T  L+FEY++  D K    D    +S  ++R ++F+LL+ L+ CH   ++HRD+KP N++I+  + +L+L D+GLA     P + Y+  V + +++ P++LL    Y   +DMW +GC+   +   + P F G    D+L  I KVLGT  ++++  I   E  +  K+ +         + R   + +   + N  L+ L+K L Y  ++R+++ +A+ H+YFY++          G+  L  GDL
Sbjct:    1 SELGYGKMETYTKLDKLGEGTYATVFKGKSKLTDNIVALKEIRLEHEEGAPCTAIREVSLLKGLKHA-NIVTLHDTVHTQKSLT--LVFEYLEK-DLKQYMDDCGGIMSMNNVRIFLFQLLRGLDYCHKRKVLHRDLKPQNLLIN-DKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTAYSTQIDMWGVGCIFFEMATGR-PLFPGSTVEDELLLIFKVLGTPSEEVWPGISANEAFIAGKFPD---------YPRENLIIHAPRLDNSGLELLEKFLEYTVKDRVSAHDAMRHDYFYSL----------GTRCLNLGDL 305          
BLAST of Casein kinase II subunit alpha vs. Ensembl Nematostella
Match: EDO49420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF7])

HSP 1 Score: 126.331 bits (316), Expect = 7.060e-33
Identity = 92/296 (31.08%), Postives = 152/296 (51.35%), Query Frame = 1
Query:  154 YQIVRKIGRGKYSEVFAGIRFSTNE-----EXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTL-SDYD---IRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAE-FYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            Y  + KIG G Y  VF G    T E      V +            REI +L+ LK   NI+ L D++      T  L+FE+ D  D K  + +   + D   ++ ++F+LL+ L  CHS  ++HRD+KP N++I+ +  +L+L D+GLA  F  P   ++  V + +++ P++L+  ++Y  S+DMWS GC+ A +     P F G++  DQL RI K+LGT    ++ +  ++   P Y E   +         V       +S+   D L KLL  +   RI++++A++H YF
Sbjct:    4 YDKLEKIGEGTYGTVFKGKNKETREILALKRVRLDDDDEGVPSSALREICLLKELKHN-NIVRLYDVLHSEKKLT--LVFEFCDQ-DLKKYFDSCQGEVDASVVKSFMFQLLRGLAFCHSHNVLHRDLKPQNLLIN-KDGELKLADFGLARAFGIPVRCFSAEVVTLWYRPPDVLMGAKLYSTSIDMWSAGCIFAEMANGGRPLFPGNDVDDQLRRIFKILGTPTEESWPNVSKL---PDYKEFPPQGPSVSLGMVVPK-----LSSTGRDLLQKLLVSNPAHRISAEDAMKHAYF 286          
BLAST of Casein kinase II subunit alpha vs. Ensembl Nematostella
Match: EDO49865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX1])

HSP 1 Score: 127.487 bits (319), Expect = 7.534e-33
Identity = 93/300 (31.00%), Postives = 159/300 (53.00%), Query Frame = 1
Query:  154 YQIVRKIGRGKYSEVFAGIRFSTNE-----EXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYV--DNTD-FKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAE-FYHPGE-EYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLI---SNEALDFLDKLLRYDHQERITSKEALEHNYFY 1014
            Y I+ +IG G +  VF      + E     +V ++ L+    +   REIK LQ  +    ++ L D+   P      L+FEY+  D ++  ++    L++  I+ Y+  LLK +  CH+ GIMHRD+KP N++I      L++ D+GLA  F + GE +Y+ +VA+R+++ PELL   + YD  +D+W++GC+   ++    P F G N+ +QL  + K LGT +   +    ++   P YN+I        +     +  + ++   S EA+D L + L Y  ++RI + EAL H YF+
Sbjct:    7 YTILGRIGEGAHGIVFKAKHIESGEIVALKKVPLRRLEDGIPNTALREIKSLQENEENPYVVKLIDVF--PHGTGFVLVFEYMWSDLSEVLRNSERPLTEAQIKGYLLMLLKGVAYCHNKGIMHRDLKPANLLISSTGH-LKIADFGLARVFSNEGERQYSHQVATRWYRAPELLYGARKYDEGVDLWAVGCIFGELL-NNSPLFPGENDIEQLCCVLKTLGTPNEEIWPGMTDL---PDYNKI-------TFPDMPAIPLEKIVPDASPEAMDLLKRFLVYPSKKRIPASEALLHPYFF 292          
BLAST of Casein kinase II subunit alpha vs. Ensembl Medaka
Match: csnk2a1 (casein kinase II subunit alpha [Source:NCBI gene;Acc:101156432])

HSP 1 Score: 497.278 bits (1279), Expect = 1.275e-174
Identity = 247/338 (73.08%), Postives = 294/338 (86.98%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGS 1056
            S P+ S+SR+Y D N  RP+EY+ Y    +EWG+ DDYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII+L DIV+DP+S TPAL+FE+V+NTDFK LY TLSD+DIRFY++E+LKAL+ CHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF GH+NYDQL RIAKVLGT+DLY YI KY IELDP++N+ILGRHSRKRWERFV+ +NQHL+S EALDFLDKLLRYDHQ R+T++EA++H YF+ IV++Q      G 
Sbjct:    2 SGPVPSRSRVYPDVNTQRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIISLLDIVKDPVSRTPALVFEHVNNTDFKQLYQTLSDFDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPNQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDFLDKLLRYDHQARLTAREAMDHPYFFPIVKDQGRGATPGG 339          
BLAST of Casein kinase II subunit alpha vs. Ensembl Medaka
Match: CSNK2A2 (casein kinase 2 alpha 2 [Source:NCBI gene;Acc:101171988])

HSP 1 Score: 467.233 bits (1201), Expect = 2.380e-163
Identity = 236/342 (69.01%), Postives = 286/342 (83.63%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQS------GMVAAGSTV 1062
             SKSR+YAD N  + +EY+ Y      W + +DYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII L D V+DP+S TPAL+FE ++NTDFK+LY  L+DYDIRFY++ELLKAL+ CHSMGIMHRDVKPHNVMIDHQ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF+KEPFF G +NYDQL RIAKVLGT++L+ Y+ KY IELDP++ ++LG+ SRKRWE+FV  +NQHL+S EALD LDKLLRYDHQ+R+T+ EA+EH YFY +V+EQS       MV++G+  
Sbjct:    7 GSKSRVYADVNTLKSREYWDYEAHVPNWNNQEDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGTNIIRLVDTVKDPVSRTPALVFECINNTDFKELYQKLTDYDIRFYMYELLKALDYCHSMGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPSQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFQKEPFFHGQDNYDQLVRIAKVLGTEELFGYLRKYHIELDPRFKDLLGQQSRKRWEQFVQTENQHLVSPEALDLLDKLLRYDHQQRLTATEAMEHPYFYPVVKEQSLSNSDNNMVSSGNNT 348          
BLAST of Casein kinase II subunit alpha vs. Ensembl Medaka
Match: csnk2a2a (casein kinase II subunit alpha' [Source:NCBI gene;Acc:101163644])

HSP 1 Score: 418.313 bits (1074), Expect = 1.606e-143
Identity = 211/299 (70.57%), Postives = 252/299 (84.28%), Query Frame = 1
Query:   34 LINSMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEA 930
            +  S P SSK+R+Y D N  + +EY+ Y      W + D+YQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII L D V+DP+S TPAL+FEY++NTDFK+LY  L+DYDIRFY+FELLKAL+ CHSMGIMHRDVKPHNVMIDHQ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF KEPFF G +NYDQL RIAKVLGTD+LY Y+HKY IELD ++ ++LG+ +RKRWE+F+  +NQHL+S EA
Sbjct:    1 MPGSTPASSKARVYTDVNTQKNREYWDYDAHVPNWSNQDNYQLVRKLGRGKYSEVFEAINVTNNEKVVVKILKPVKKKKIKREIKILENLRGGTNIIRLVDTVKDPVSRTPALVFEYINNTDFKELYQKLTDYDIRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFLKEPFFHGQDNYDQLVRIAKVLGTDELYGYLHKYHIELDTRFKDLLGQQTRKRWEQFIQSENQHLVSPEA 299          
BLAST of Casein kinase II subunit alpha vs. Ensembl Medaka
Match: csnk2a2a (casein kinase II subunit alpha' [Source:NCBI gene;Acc:101163644])

HSP 1 Score: 404.445 bits (1038), Expect = 1.482e-139
Identity = 199/345 (57.68%), Postives = 240/345 (69.57%), Query Frame = 1
Query:   43 SMPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGD 1077
            S P SSK+R+Y D N  + +EY+ Y      W + D+YQ+VRK+GRGKYSEVF  I  + NE+VV               +KIL                                    K+LY  L+DYDIRFY+FELLKAL+ CHSMGIMHRDVKPHNVMIDHQ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELL+DYQMYDYSLDMWSLGCMLAS+IF KEPFF G +NYDQL RIAKVLGTD+LY Y+HKY IELD ++ ++LG+ +RKRWE+F+  +NQHL+S EALD LDKLLRYDHQ+R+T+ EA+ H YFY +V+EQ       +  + S +
Sbjct:    4 STPASSKARVYTDVNTQKNREYWDYDAHVPNWSNQDNYQLVRKLGRGKYSEVFEAINVTNNEKVV---------------VKIL------------------------------------KELYQKLTDYDIRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFLKEPFFHGQDNYDQLVRIAKVLGTDELYGYLHKYHIELDTRFKDLLGQQTRKRWEQFIQSENQHLVSPEALDLLDKLLRYDHQQRLTAAEAMRHPYFYPVVKEQVNANTDSTKAISSSN 297          
BLAST of Casein kinase II subunit alpha vs. Ensembl Medaka
Match: CSNK2A2 (casein kinase 2 alpha 2 [Source:NCBI gene;Acc:101171988])

HSP 1 Score: 374.4 bits (960), Expect = 9.112e-127
Identity = 204/326 (62.58%), Postives = 249/326 (76.38%), Query Frame = 1
Query:   55 SSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILG-------RHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
             SKSR+YAD N  + +EY+ Y      W + +DYQ+VRK+GRGKYSEVF  I  + NE+VV+K+LKPVKK KIKREIKIL+NL+G  NII L D V+DP+S TPAL+FE ++NTDFK+LY  L+DYDIRFY++ELLKAL+ CHSMGIMHRDVKPHNVMIDHQ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPE LL+ ++    LDMWSLGCMLAS+IF+KEPFF G +NYDQ++  A  +        + ++ +E         G       R SRKRWE+FV  +NQHL+S EALD LDKLLRYDHQ+R+T+ EA+EH YF
Sbjct:    7 GSKSRVYADVNTLKSREYWDYEAHVPNWNNQEDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGTNIIRLVDTVKDPVSRTPALVFECINNTDFKELYQKLTDYDIRFYMYELLKALDYCHSMGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPSQEYNVRVASRYFKGPE-LLNIRI----LDMWSLGCMLASMIFQKEPFFHGQDNYDQVSENAAAVQV------LWRFSVEAHFSAAAPAGLTGCHFRRQSRKRWEQFVQTENQHLVSPEALDLLDKLLRYDHQQRLTATEAMEHPYF 321          
BLAST of Casein kinase II subunit alpha vs. Planmine SMEST
Match: SMESG000024545.1 (SMESG000024545.1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 346/347 (99.71%), Postives = 347/347 (100.00%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDLKV 1086
            MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEVVIKVLKPVKKDKIKREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDLK+
Sbjct:    1 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEVVIKVLKPVKKDKIKREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDLKM 347          
BLAST of Casein kinase II subunit alpha vs. Planmine SMEST
Match: SMESG000068560.1 (SMESG000068560.1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 253/332 (76.20%), Postives = 302/332 (90.96%), Query Frame = 1
Query:   46 MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQEQSGM 1041
            MP++SKSRIYAD N+NRP+EY+ Y   ++EW + DDYQIV+K+GRGKYSEVF G+   TNE+ VIKVLKPVKK KIKREIKIL+NL+G  NIITL+ +V+DP+S TPAL+FE+V+N DFK LY TL+DYDIR+YIFELLKAL+CCHSMGIMHRDVKPHNVMIDH+ RKLRLIDWGLAEFYHP +EYNVRVASRYFKGPELLLDYQ+YDYSLDMWSLGCM AS+IF+KEPFF GH+NYDQL RIAKVLGTD+LY YIHKY+IELDP++NEILGRHSRKRWERF++ +NQHL+S ++LDFLDKLL+YDHQ+R+T++EA+EH+YF+ IVQEQ G+
Sbjct:    1 MPVTSKSRIYADVNVNRPREYWDYEAYQVEWRNQDDYQIVKKLGRGKYSEVFEGVNVVTNEKCVIKVLKPVKKKKIKREIKILENLRGVPNIITLQAVVKDPISRTPALVFEHVNNIDFKQLYQTLTDYDIRYYIFELLKALDCCHSMGIMHRDVKPHNVMIDHEYRKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLLDYQLYDYSLDMWSLGCMFASMIFRKEPFFHGHDNYDQLVRIAKVLGTDELYEYIHKYQIELDPRFNEILGRHSRKRWERFIHSENQHLVSADSLDFLDKLLQYDHQQRLTAREAMEHSYFFHIVQEQGGI 332          
BLAST of Casein kinase II subunit alpha vs. Planmine SMEST
Match: SMESG000039019.1 (SMESG000039019.1)

HSP 1 Score: 330.872 bits (847), Expect = 6.551e-111
Identity = 159/324 (49.07%), Postives = 222/324 (68.52%), Query Frame = 1
Query:   58 SKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSEVFAGIRFSTNEEXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYFYTIVQE 1029
            S SR+Y+D N ++PK Y  Y+  ++ + S DDY I++KIGRGKYSEVF G+  STN  +V               IK+L+                   S TP+ IFEY++N +FK+LY   +  DI +Y+ +LL AL+CCHSMGIMHRDVKP N++I+++ + LRLIDWGLA+FYHP ++YNVRVASRYFKGPELL++++MYDYSLD+W++GC+LA +IFKK+  F+G +N DQL +I K LGT    +Y+ KY+I+L+ K   +  R+  K W ++V+ +NQHL+  E+   LD LLR+DHQ R+T+KEAL H +F T  QE
Sbjct:    4 SLSRVYSDVNKSKPKGYSEYNDLDITYQSCDDYSIIKKIGRGKYSEVFLGVEDSTNRNIV---------------IKVLK-------------------SQTPSFIFEYIENENFKELYKNFTKMDICYYLRQLLLALDCCHSMGIMHRDVKPQNIVINNRTKTLRLIDWGLADFYHPKQKYNVRVASRYFKGPELLVNFEMYDYSLDLWAVGCVLAGMIFKKDTMFQGKDNVDQLLKIVKTLGTTSFESYLKKYQIKLNLKEANLRKRYPIKPWSQYVDNENQHLVCQESFHLLDNLLRFDHQTRLTAKEALSHRFFATFSQE 293          
BLAST of Casein kinase II subunit alpha vs. Planmine SMEST
Match: SMESG000052413.1 (SMESG000052413.1)

HSP 1 Score: 127.102 bits (318), Expect = 1.698e-32
Identity = 92/299 (30.77%), Postives = 156/299 (52.17%), Query Frame = 1
Query:  151 DYQIVRKIGRGKYSEVFAGIRFSTNE-----EXXXXXXXXXXXXXXXREIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKDLYPT----LSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFY-HPGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELD--PKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            D+  + KIG G Y  V+  I   TNE     ++  +  +        REI IL+ L+   NI+ L+  + +       L+FEY+ N D +         ++D  ++ + +++++ L  CH+   MHRD+KP N+++D  +  ++L D+GLA  Y  P +     V + +++ PE++L+ + Y  ++D+WS+ C++A +I  K P FRG +  DQL  I KVLGT D     +K   +LD  P +N +          R V V +++L      D L+K+L Y   ER   ++AL H+YF
Sbjct:    7 DFTRIEKIGEGTYGIVYKSINKITNEFAAIKKIRSENDEDGIAPTTLREISILKELRHP-NIVYLQQTIAE--KGKLYLVFEYL-NMDLRRYLDNEENPMNDIILKKFSYQIMQGLLYCHTRRFMHRDLKPQNLLVDTNKHIIKLADFGLARCYGAPVKNLTHEVVTLWYRAPEVILNAKRYSCAIDVWSVACIMAEMITYK-PLFRGDSEIDQLFAIFKVLGTPD-----NKVWPDLDKFPGWNPLFPVWRYDLRSRLVEVIDENL-----FDLLEKMLVYHPLERTNIRDALLHDYF 290          
BLAST of Casein kinase II subunit alpha vs. Planmine SMEST
Match: SMESG000074437.1 (SMESG000074437.1)

HSP 1 Score: 124.405 bits (311), Expect = 6.825e-32
Identity = 76/250 (30.40%), Postives = 137/250 (54.80%), Query Frame = 1
Query:  277 REIKILQNLKGCINIITLEDIVRDPMSNTPALIFEYVDNTDFKD----LYPTLSDYDIRFYIFELLKALNCCHSMGIMHRDVKPHNVMIDHQRRKLRLIDWGLAEFYH-PGEEYNVRVASRYFKGPELLLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTDDLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLDKLLRYDHQERITSKEALEHNYF 1011
            REI IL+NL+   NI++LE ++  P  N   ++FE++D  D +     L   L+   IR  +++LL+ L  CH   ++HRD+KP N++++     ++L D+GL   Y  P ++    + +++++ PE++L  + Y+ S+DMWS+GC+ A +     P F G +   QL +I ++ GT D  +   + E     K+ ++    +       ++V     +S   +D L KLL Y+  ER+ S++ L H+YF
Sbjct:   20 REISILKNLQHP-NIVSLEKVILLP--NKLYMVFEFID-MDLQAFALRLDTGLNSEIIRSIMYQLLQGLLYCHKRRVIHRDLKPQNILVNKTGTLVKLADFGLGRIYGIPSKKMTTEIITQWYRAPEIILGAKTYNCSVDMWSVGCIFAELAL-GAPLFNGDSEIGQLFKIFQINGTPDANSIFIRLE-----KWQDVFPNWTGTT----LSVKMDGYLSKIGIDLLSKLLVYNPLERLNSQDTLLHDYF 255          
The following BLAST results are available for this feature:
BLAST of Casein kinase II subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK2A11.724e-17972.57casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK2A11.724e-17972.57casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK2A11.724e-17972.57casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK2A11.724e-17972.57casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK2A11.724e-17972.57casein kinase 2 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-33.046e-16671.43Casein kinase II subunit alpha [Source:UniProtKB/... [more]
cdk-122.541e-3630.37Cyclin-dependent kinase 12 [Source:UniProtKB/Swis... [more]
cdk-122.633e-3630.37Cyclin-dependent kinase 12 [Source:UniProtKB/Swis... [more]
cdk-123.107e-3630.37Cyclin-dependent kinase 12 [Source:UniProtKB/Swis... [more]
cdk-21.537e-3330.54Cyclin-dependent kinase 2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CkIIalpha3.228e-16772.64gene:FBgn0264492 transcript:FBtr0344974[more]
CkIIalpha3.228e-16772.64gene:FBgn0264492 transcript:FBtr0070044[more]
CkIIalpha3.228e-16772.64gene:FBgn0264492 transcript:FBtr0345138[more]
CkIIalpha3.228e-16772.64gene:FBgn0264492 transcript:FBtr0111141[more]
CkIIalpha3.228e-16772.64gene:FBgn0264492 transcript:FBtr0070043[more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:865989.373e-17973.47zgc:86598 [Source:ZFIN;Acc:ZDB-GENE-040625-181][more]
zgc:865989.373e-17973.47zgc:86598 [Source:ZFIN;Acc:ZDB-GENE-040625-181][more]
zgc:865989.373e-17973.47zgc:86598 [Source:ZFIN;Acc:ZDB-GENE-040625-181][more]
csnk2a12.236e-17674.26casein kinase 2, alpha 1 polypeptide [Source:ZFIN;... [more]
csnk2a12.236e-17674.26casein kinase 2, alpha 1 polypeptide [Source:ZFIN;... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fndc41.156e-16475.87fibronectin type III domain containing 4 [Source:X... [more]
fndc42.529e-16475.87fibronectin type III domain containing 4 [Source:X... [more]
csnk2a22.086e-16267.44casein kinase 2 alpha 2 [Source:NCBI gene;Acc:4934... [more]
csnk2a22.785e-15970.85casein kinase 2 alpha 2 [Source:NCBI gene;Acc:4934... [more]
fndc41.685e-15778.50fibronectin type III domain containing 4 [Source:X... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csnk2a11.182e-18072.86casein kinase 2, alpha 1 polypeptide [Source:MGI S... [more]
Csnk2a23.052e-16670.29casein kinase 2, alpha prime polypeptide [Source:M... [more]
Csnk2a23.052e-16670.29casein kinase 2, alpha prime polypeptide [Source:M... [more]
Csnk2a25.395e-12575.11casein kinase 2, alpha prime polypeptide [Source:M... [more]
Csnk2a25.888e-11766.13casein kinase 2, alpha prime polypeptide [Source:M... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60737|CSK21_MOUSE8.268e-18072.86Casein kinase II subunit alpha OS=Mus musculus OX=... [more]
sp|P19139|CSK21_RAT1.396e-17972.86Casein kinase II subunit alpha OS=Rattus norvegicu... [more]
sp|P68400|CSK21_HUMAN8.278e-17972.57Casein kinase II subunit alpha OS=Homo sapiens OX=... [more]
sp|P68399|CSK21_BOVIN8.278e-17972.57Casein kinase II subunit alpha OS=Bos taurus OX=99... [more]
sp|P21868|CSK21_CHICK6.446e-17872.57Casein kinase II subunit alpha OS=Gallus gallus OX... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3SRS04.324e-17772.86Protein kinase domain-containing protein OS=Loxodo... [more]
Q611774.371e-17772.86Casein kinase II alpha subunit OS=Mus musculus OX=... [more]
A0A2K5Q3G44.566e-17772.86Protein kinase domain-containing protein OS=Cebus ... [more]
A0A2K5E7I84.566e-17772.86Protein kinase domain-containing protein OS=Aotus ... [more]
F7I6P44.566e-17772.86Casein kinase II subunit alpha isoform a OS=Callit... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk2a13.839e-17774.85casein kinase II subunit alpha-like [Source:NCBI g... [more]
csnk2a44.749e-17772.13casein kinase II subunit alpha [Source:NCBI gene;A... [more]
csnk2a48.973e-17369.94casein kinase II subunit alpha [Source:NCBI gene;A... [more]
csnk2a2b1.403e-16368.82casein kinase 2 alpha 2 [Source:NCBI gene;Acc:1030... [more]
csnk2a2a3.322e-15866.96casein kinase 2, alpha prime polypeptide a [Source... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK2A23.006e-17773.67casein kinase 2 alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
CSNK2A21.161e-17270.37casein kinase 2 alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
cdk24.773e-3330.59cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mapk12a4.786e-3329.10mitogen-activated protein kinase 12a [Source:NCBI ... [more]
cdk12.201e-3133.20cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CKA24.494e-12257.63Alpha' catalytic subunit of casein kinase 2 (CK2);... [more]
CKA12.717e-12055.49Alpha catalytic subunit of casein kinase 2 (CK2); ... [more]
PHO852.270e-3528.85Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KSS12.232e-3130.13Mitogen-activated protein kinase (MAPK); involved ... [more]
SLT22.258e-3030.94Serine/threonine MAP kinase; coordinates expressio... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415528.148e-16870.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265213.075e-5981.90pep supercontig:ASM20922v1:NEMVEscaffold_6854:158:... [more]
EDO481175.705e-3629.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494207.060e-3331.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498657.534e-3331.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk2a11.275e-17473.08casein kinase II subunit alpha [Source:NCBI gene;A... [more]
CSNK2A22.380e-16369.01casein kinase 2 alpha 2 [Source:NCBI gene;Acc:1011... [more]
csnk2a2a1.606e-14370.57casein kinase II subunit alpha' [Source:NCBI gene;... [more]
csnk2a2a1.482e-13957.68casein kinase II subunit alpha' [Source:NCBI gene;... [more]
CSNK2A29.112e-12762.58casein kinase 2 alpha 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Casein kinase II subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024545.10.000e+099.71SMESG000024545.1[more]
SMESG000068560.10.000e+076.20SMESG000068560.1[more]
SMESG000039019.16.551e-11149.07SMESG000039019.1[more]
SMESG000052413.11.698e-3230.77SMESG000052413.1[more]
SMESG000074437.16.825e-3230.40SMESG000074437.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017418 ID=SMED30017418|Name=Casein kinase II subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1507bp
GTTTGTTTTACTATTTGCAGAAGTTGAGAAAATTTAATAAATTCGATGCC
ATTGTCTAGTAAATCGCGAATTTATGCAGATGCCAACATAAATAGACCAA
AGGAATATTATAGCTATCATCAAACAGAATTAGAATGGGGTTCTCCGGAT
GACTATCAAATTGTCCGTAAAATTGGCAGAGGGAAGTACAGTGAAGTTTT
TGCAGGTATCAGGTTTTCAACAAATGAGGAAGTAGTTATAAAAGTTTTAA
AACCTGTTAAAAAAGATAAAATAAAACGAGAAATCAAAATTCTACAGAAT
CTTAAAGGGTGCATAAATATTATCACTCTGGAGGATATTGTGCGTGATCC
AATGTCGAATACTCCTGCTTTGATATTCGAATATGTGGACAACACTGACT
TCAAGGATCTCTATCCGACTCTTTCTGATTATGATATAAGATTTTACATA
TTCGAATTGCTCAAAGCATTGAATTGTTGCCATTCGATGGGAATAATGCA
TCGGGATGTGAAACCTCATAATGTTATGATTGATCATCAGAGGAGAAAGC
TGCGACTCATTGATTGGGGTCTAGCGGAATTTTATCATCCTGGAGAAGAA
TACAATGTCAGAGTGGCTTCCCGATATTTTAAGGGTCCCGAATTGCTACT
TGACTATCAGATGTACGATTATTCTCTCGACATGTGGTCGCTAGGGTGTA
TGCTTGCCAGTATCATATTCAAAAAGGAGCCATTTTTCCGTGGTCACAAT
AACTATGATCAACTAGCCCGCATAGCAAAGGTACTCGGTACTGATGATTT
GTACGCCTATATCCACAAATACGAAATCGAATTGGATCCAAAGTACAACG
AGATTCTGGGCCGACATTCAAGGAAACGGTGGGAGCGATTTGTCAATGTC
GATAATCAGCATCTGATATCGAACGAGGCTTTGGATTTCCTCGACAAGCT
TCTGAGATACGATCATCAGGAGCGAATTACGTCGAAGGAAGCATTGGAGC
ACAATTACTTCTATACGATCGTGCAAGAACAGAGTGGCATGGTAGCTGCC
GGATCTACGGTATTGGGATCTGGTGATTTGAAGGTAATCCCGTTGGCACA
GGCACGAGCTCGTGCGATGCCGATGTGATGCTGACTACTTATATTGATGT
TGTATGTGTCTATTTGCATTTAGATGGAGTAGAGACGACTGTCGTCACCG
AGACTGCCGGATCATCATTGCGAGAAATGATTGAGGAGATTGGCGGCGGC
GAGCAACTATTCCAACTGTTATAGACAATATACATTTGTGTGCGTCAATG
TTAGTATGCGTGCAAGGGTGTATGTATCATACAATACTATATTATATGAT
TGTCTGTGTGTATTATATTATATGGACGTGTTTGTGTGTATTATGTTATA
TGGACGTGTTTGTGTGTATTATGTTATATGGACGTGTTTGTGTGTATTAT
GTTATATGGACGTGTTTGTGTGTATTATGTTATATGGACGTGTTTGTGTG
TATTATG
back to top

protein sequence of SMED30017418-orf-1

>SMED30017418-orf-1 ID=SMED30017418-orf-1|Name=SMED30017418-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MPLSSKSRIYADANINRPKEYYSYHQTELEWGSPDDYQIVRKIGRGKYSE
VFAGIRFSTNEEVVIKVLKPVKKDKIKREIKILQNLKGCINIITLEDIVR
DPMSNTPALIFEYVDNTDFKDLYPTLSDYDIRFYIFELLKALNCCHSMGI
MHRDVKPHNVMIDHQRRKLRLIDWGLAEFYHPGEEYNVRVASRYFKGPEL
LLDYQMYDYSLDMWSLGCMLASIIFKKEPFFRGHNNYDQLARIAKVLGTD
DLYAYIHKYEIELDPKYNEILGRHSRKRWERFVNVDNQHLISNEALDFLD
KLLRYDHQERITSKEALEHNYFYTIVQEQSGMVAAGSTVLGSGDLKVIPL
AQARARAMPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0018105peptidyl-serine phosphorylation
GO:1905818regulation of chromosome separation
GO:0006468protein phosphorylation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006915apoptotic process
GO:0007049cell cycle
GO:0008284positive regulation of cell proliferation
GO:0016055Wnt signaling pathway
GO:0016310phosphorylation
GO:0021987cerebral cortex development
GO:0030177positive regulation of Wnt signaling pathway
GO:0030307positive regulation of cell growth
GO:0033574response to testosterone
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045732positive regulation of protein catabolic process
GO:0048511rhythmic process
GO:0071174mitotic spindle checkpoint
GO:0097421liver regeneration
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0003674molecular_function
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0043021ribonucleoprotein complex binding
Vocabulary: cellular component
TermDefinition
GO:0000785chromatin
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 37..322
e-value: 4.3E-69
score: 245.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 37..322
e-value: 1.3E-65
score: 221.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 37..322
score: 42.025
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 37..113
e-value: 2.3E-106
score: 357.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 114..322
e-value: 2.3E-106
score: 357.3
NoneNo IPR availablePANTHERPTHR24054CASEIN KINASE II SUBUNIT ALPHAcoord: 2..336
NoneNo IPR availablePANTHERPTHR24054:SF16CASEIN KINASE II SUBUNIT ALPHA-RELATEDcoord: 2..336
NoneNo IPR availableCDDcd14132STKc_CK2_alphacoord: 18..323
e-value: 0.0
score: 599.142
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 43..66
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 150..162
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 10..326