Calponin-like protein

Overview
NameCalponin-like protein
Smed IDSMED30017416
Length (bp)323
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calponin-like protein (SMED30017416) t-SNE clustered cells

Violin plots show distribution of expression levels for Calponin-like protein (SMED30017416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Calponin-like protein vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 55.0694 bits (131), Expect = 8.154e-10
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:   64 DAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:   15 EGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 95          

HSP 2 Score: 53.9138 bits (128), Expect = 2.278e-9
Identity = 40/106 (37.74%), Postives = 59/106 (55.66%), Query Frame = 1
Query:   25 RHIADIR--CNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFINDVSNGI-----EISDEGKN 315
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D    +     E++ +G+ 
Sbjct:   42 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELAPKGRT 143          
BLAST of Calponin-like protein vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 54.6842 bits (130), Expect = 1.347e-9
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:   64 DAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  109 EGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 189          

HSP 2 Score: 53.9138 bits (128), Expect = 2.465e-9
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  136 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 219          
BLAST of Calponin-like protein vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 54.6842 bits (130), Expect = 1.347e-9
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:   64 DAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  109 EGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 189          

HSP 2 Score: 53.9138 bits (128), Expect = 2.465e-9
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  136 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 219          
BLAST of Calponin-like protein vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 54.6842 bits (130), Expect = 1.866e-9
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:   64 DAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  159 EGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 239          

HSP 2 Score: 53.9138 bits (128), Expect = 3.407e-9
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 269          
BLAST of Calponin-like protein vs. Ensembl Human
Match: CNN3 (calponin 3 [Source:HGNC Symbol;Acc:HGNC:2157])

HSP 1 Score: 53.9138 bits (128), Expect = 3.437e-9
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   70 KGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGM-RIGTQRFIND 276
            + VIGLQ G+NK A+QAGM   GT+R + D     +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  115 QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYD 184          
BLAST of Calponin-like protein vs. Ensembl Celegans
Match: clik-1 (CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;Acc:H2L0M6])

HSP 1 Score: 43.5134 bits (101), Expect = 6.206e-6
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 1
Query:   46 CNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGM 246
              E    + G++ LQ+G+NK A+QAGM  IG  R ++   T  +  DS +  I LQ G+NK A QAGM
Sbjct:  190 PEEKARASDGIVPLQSGTNKLASQAGMTGIGMPRIVDVRRTNDQDRDS-QGFIHLQMGTNKFANQAGM 256          
BLAST of Calponin-like protein vs. Ensembl Celegans
Match: clik-1 (CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;Acc:H2L0M6])

HSP 1 Score: 43.5134 bits (101), Expect = 6.206e-6
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 1
Query:   46 CNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGM 246
              E    + G++ LQ+G+NK A+QAGM  IG  R ++   T  +  DS +  I LQ G+NK A QAGM
Sbjct:  190 PEEKARASDGIVPLQSGTNKLASQAGMTGIGMPRIVDVRRTNDQDRDS-QGFIHLQMGTNKFANQAGM 256          
BLAST of Calponin-like protein vs. Ensembl Zebrafish
Match: cnn1b (calponin 1, basic, smooth muscle, b [Source:ZFIN;Acc:ZDB-GENE-091118-54])

HSP 1 Score: 60.077 bits (144), Expect = 1.228e-11
Identity = 37/86 (43.02%), Postives = 54/86 (62.79%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGM-RIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D  TG+E +   ++ I LQ G+NKGA+QAGM   GT+R I +    +E+ D
Sbjct:  156 EKLKEGRNIIGLQMGTNKFASQKGMTSYGTRRHLYDPKTGME-NPLDQSTISLQMGTNKGASQAGMTAPGTKRQIFEKKLDMEMCD 240          
BLAST of Calponin-like protein vs. Ensembl Zebrafish
Match: cnn3a (calponin 3, acidic a [Source:ZFIN;Acc:ZDB-GENE-030131-5130])

HSP 1 Score: 59.3066 bits (142), Expect = 2.487e-11
Identity = 38/78 (48.72%), Postives = 48/78 (61.54%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            VIGLQ G+NK A+QAGM   GT+R + D  T  E     +T I LQ G+NKGA+QAGM   GT+R I D    ++  D
Sbjct:  163 VIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTE-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIYDQKAALQPMD 239          

HSP 2 Score: 51.2174 bits (121), Expect = 1.884e-8
Identity = 31/77 (40.26%), Postives = 44/77 (57.14%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI 252
            RH+ D +        +  I LQ G+NKGA+QAGM   GT+R I D    ++  D+  + I LQ G+NK A+Q GM +
Sbjct:  186 RHLYDPKTQTEKPYDQTTISLQMGTNKGASQAGMSAPGTRRDIYDQKAALQPMDN--STISLQMGTNKVASQKGMSV 260          
BLAST of Calponin-like protein vs. Ensembl Zebrafish
Match: cnn2 (calponin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-542])

HSP 1 Score: 56.9954 bits (136), Expect = 1.547e-10
Identity = 36/78 (46.15%), Postives = 48/78 (61.54%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            VIGLQ G+NK A+QAGM   GT+R + D  + + +     + I LQ G+NKGA+QAGM   GT+R I D   G +  D
Sbjct:  164 VIGLQMGTNKCASQAGMNAYGTRRHLYDPKSHI-LPPMDHSTISLQMGTNKGASQAGMTAPGTRRAIYDQKTGTDKCD 240          

HSP 2 Score: 55.0694 bits (131), Expect = 8.205e-10
Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDV 279
            RH+ D + + +       I LQ G+NKGA+QAGM   GT+R I D  TG +  D+  + + LQ G ++GA Q+G   G  R I D 
Sbjct:  187 RHLYDPKSHILPPMDHSTISLQMGTNKGASQAGMTAPGTRRAIYDQKTGTDKCDN--STMSLQMGYSQGANQSGQNFGLGRQIYDA 270          
BLAST of Calponin-like protein vs. Ensembl Zebrafish
Match: cnn3b (calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050522-263])

HSP 1 Score: 55.8398 bits (133), Expect = 4.403e-10
Identity = 37/78 (47.44%), Postives = 48/78 (61.54%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D    ++  D
Sbjct:  122 VIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQAD-KPFDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLD 198          
BLAST of Calponin-like protein vs. Ensembl Zebrafish
Match: cnn3b (calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050522-263])

HSP 1 Score: 55.8398 bits (133), Expect = 4.410e-10
Identity = 37/78 (47.44%), Postives = 48/78 (61.54%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D    ++  D
Sbjct:  163 VIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQAD-KPFDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLD 239          
BLAST of Calponin-like protein vs. Ensembl Xenopus
Match: cnn1 (calponin 1, basic, smooth muscle [Source:NCBI gene;Acc:407907])

HSP 1 Score: 56.9954 bits (136), Expect = 2.129e-10
Identity = 36/78 (46.15%), Postives = 46/78 (58.97%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            VIGLQ G+NK A+Q+GM   GT+R + D    + +     + I LQ GSNKGA+Q GM   GT+R I D   G E  D
Sbjct:  165 VIGLQMGTNKCASQSGMTAYGTRRHLYDPKNTI-LPPMDHSTISLQMGSNKGASQVGMTAPGTRRHIYDTKLGTEKCD 241          

HSP 2 Score: 52.373 bits (124), Expect = 1.087e-8
Identity = 34/85 (40.00%), Postives = 44/85 (51.76%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFIND 276
            RH+ D +   +       I LQ GSNKGA+Q GM   GT+R I D   G E  D+  + + LQ G  +GA Q+G   G  R I D
Sbjct:  188 RHLYDPKNTILPPMDHSTISLQMGSNKGASQVGMTAPGTRRHIYDTKLGTEKCDN--SSMSLQMGYTQGANQSGQIFGLGRQIYD 270          
BLAST of Calponin-like protein vs. Ensembl Xenopus
Match: slc5a8.1 (solute carrier family 5 member 8, gene 1 [Source:Xenbase;Acc:XB-GENE-479634])

HSP 1 Score: 56.225 bits (134), Expect = 4.864e-10
Identity = 39/88 (44.32%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+Q+GM   GT+R I D   G+E  D+    I LQ GSNKGA+Q GM + G  R + D
Sbjct:  185 RHLYDPKLANDQPLDQA--TISLQMGTNKGASQSGMTAPGTKRQIFDQKLGMEHCDT--QTISLQMGSNKGASQQGMTVYGLPRQVYD 268          

HSP 2 Score: 51.6026 bits (122), Expect = 1.928e-8
Identity = 34/82 (41.46%), Postives = 48/82 (58.54%), Query Frame = 1
Query:   64 DAKGVIGLQAGSNKGATQAGM-RIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            + + +IGLQ G+NK A+Q GM   GT+R + D     +     +  I LQ G+NKGA+Q+GM   GT+R I D   G+E  D
Sbjct:  158 EGRNIIGLQMGTNKYASQKGMTSYGTRRHLYDPKLAND-QPLDQATISLQMGTNKGASQSGMTAPGTKRQIFDQKLGMEHCD 238          
BLAST of Calponin-like protein vs. Ensembl Xenopus
Match: tfdp1 (transcription factor Dp-1 [Source:Xenbase;Acc:XB-GENE-1219073])

HSP 1 Score: 54.299 bits (129), Expect = 2.165e-9
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   70 KGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFIND 276
            + VIGLQ G+NK A+QAGM   GT+R + D     +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:   96 QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMPAPGTRRDIYD 165          
BLAST of Calponin-like protein vs. Ensembl Xenopus
Match: tfdp1 (transcription factor Dp-1 [Source:Xenbase;Acc:XB-GENE-1219073])

HSP 1 Score: 53.9138 bits (128), Expect = 2.926e-9
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   70 KGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFIND 276
            + VIGLQ G+NK A+QAGM   GT+R + D     +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  161 QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMPAPGTRRDIYD 230          
BLAST of Calponin-like protein vs. Ensembl Mouse
Match: Cnn1 (calponin 1 [Source:MGI Symbol;Acc:MGI:104979])

HSP 1 Score: 55.4546 bits (132), Expect = 5.157e-10
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  105 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 189          

HSP 2 Score: 53.9138 bits (128), Expect = 1.657e-9
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  136 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 219          
BLAST of Calponin-like protein vs. Ensembl Mouse
Match: Cnn1 (calponin 1 [Source:MGI Symbol;Acc:MGI:104979])

HSP 1 Score: 55.4546 bits (132), Expect = 5.638e-10
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 239          

HSP 2 Score: 53.9138 bits (128), Expect = 2.293e-9
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 269          
BLAST of Calponin-like protein vs. Ensembl Mouse
Match: Cnn3 (calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919244])

HSP 1 Score: 53.1434 bits (126), Expect = 1.103e-9
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   70 KGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGM-RIGTQRFIND 276
            + VIGLQ G+NK A+QAGM   GT+R + D     +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:   64 QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYD 133          
BLAST of Calponin-like protein vs. Ensembl Mouse
Match: Cnn3 (calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919244])

HSP 1 Score: 53.5286 bits (127), Expect = 2.944e-9
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   70 KGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGM-RIGTQRFIND 276
            + VIGLQ G+NK A+QAGM   GT+R + D     +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  115 QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYD 184          
BLAST of Calponin-like protein vs. Ensembl Mouse
Match: Cnn3 (calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919244])

HSP 1 Score: 51.2174 bits (121), Expect = 2.180e-8
Identity = 35/72 (48.61%), Postives = 45/72 (62.50%), Query Frame = 1
Query:   67 AKGVIGLQAGSNKGATQAGMRI-GTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
             + VIGLQ G+NK A+QAGM   GT+R + D     +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  160 GQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYD 230          
BLAST of Calponin-like protein vs. UniProt/SwissProt
Match: sp|P26932|CNN1_CHICK (Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 6.761e-10
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I + S G+E  D+   +I LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPSLGMERCDT--NIIGLQMGSNKGASQQGMTVYGLPRQVYD 269          

HSP 2 Score: 56.6102 bits (135), Expect = 1.513e-9
Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I + S G+E  D
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPSLGMERCD 239          
BLAST of Calponin-like protein vs. UniProt/SwissProt
Match: sp|Q7YRL2|CNN1_SHEEP (Calponin-1 OS=Ovis aries OX=9940 GN=CNN1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.791e-9
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 239          

HSP 2 Score: 53.9138 bits (128), Expect = 1.411e-8
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 269          
BLAST of Calponin-like protein vs. UniProt/SwissProt
Match: sp|Q2HJ38|CNN1_BOVIN (Calponin-1 OS=Bos taurus OX=9913 GN=CNN1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.867e-9
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 239          

HSP 2 Score: 53.9138 bits (128), Expect = 1.542e-8
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 269          
BLAST of Calponin-like protein vs. UniProt/SwissProt
Match: sp|Q08092|CNN1_PIG (Calponin-1 OS=Sus scrofa OX=9823 GN=CNN1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.905e-9
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 239          

HSP 2 Score: 53.9138 bits (128), Expect = 1.383e-8
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 269          
BLAST of Calponin-like protein vs. UniProt/SwissProt
Match: sp|Q08091|CNN1_MOUSE (Calponin-1 OS=Mus musculus OX=10090 GN=Cnn1 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.944e-9
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCD 239          

HSP 2 Score: 53.9138 bits (128), Expect = 1.604e-8
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 1
Query:   25 RHIADIRC--NEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +   ++  D A   I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNKGA+Q GM + G  R + D
Sbjct:  186 RHLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT--LNVSLQMGSNKGASQRGMTVYGLPRQVYD 269          
BLAST of Calponin-like protein vs. TrEMBL
Match: A0A158QT63 (Transgelin OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2185 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.567e-27
Identity = 60/106 (56.60%), Postives = 82/106 (77.36%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            G+SM AVRH+ADI+ +EM  +A+G+IGLQAGSNKGA+Q+GM +G+ R I D+    E+SD+GKT ++LQ G+NKGA+Q+GM +G  R I D  N  E+S EGK+VI
Sbjct:  183 GMSMGAVRHVADIKADEMSKEAQGIIGLQAGSNKGASQSGMAMGSVRHITDIKVD-EMSDAGKTSLNLQTGTNKGASQSGMAMGAIRHIAD-QNISEMSAEGKSVI 286          

HSP 2 Score: 98.5969 bits (244), Expect = 6.338e-22
Identity = 48/96 (50.00%), Postives = 73/96 (76.04%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNG 288
            +G+++ ++RH+ADI+ +EM  D+ GVIGLQAG+N+ ATQ+GM +G++R + D+  G E+S     +I LQ+GSN+GA+QAGM  GTQR I++V  G
Sbjct:  338 SGMAIGSMRHVADIKVDEMTKDSHGVIGLQAGTNQYATQSGMSMGSRRHVADIKIG-EMSKESAGIIGLQSGSNQGASQAGMSFGTQRHIDNVKVG 432          

HSP 3 Score: 96.2857 bits (238), Expect = 4.188e-21
Identity = 49/93 (52.69%), Postives = 68/93 (73.12%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDV 279
            +G++M A+RHIAD   +EM  + K VIGLQ GSNKGA+Q+GM +GT+R + D+     +S  G+ +I LQAGSNKGATQ+GM IG+ R + D+
Sbjct:  260 SGMAMGAIRHIADQNISEMSAEGKSVIGLQYGSNKGASQSGMAMGTRRHVADIKVD-PMSREGEGIIGLQAGSNKGATQSGMAIGSMRHVADI 351          

HSP 4 Score: 93.2041 bits (230), Expect = 6.148e-20
Identity = 49/107 (45.79%), Postives = 74/107 (69.16%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G++M   RH+ADI+ + M  + +G+IGLQAGSNKGATQ+GM IG+ R + D+    E++     VI LQAG+N+ ATQ+GM +G++R + D+  G E+S E   +I
Sbjct:  299 SGMAMGTRRHVADIKVDPMSREGEGIIGLQAGSNKGATQSGMAIGSMRHVADIKVD-EMTKDSHGVIGLQAGTNQYATQSGMSMGSRRHVADIKIG-EMSKESAGII 403          

HSP 5 Score: 92.4337 bits (228), Expect = 1.229e-19
Identity = 51/107 (47.66%), Postives = 74/107 (69.16%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G++M +VRHI DI+ +EM D  K  + LQ G+NKGA+Q+GM +G  R I D +   E+S  GK+VI LQ GSNKGA+Q+GM +GT+R + D+     +S EG+ +I
Sbjct:  221 SGMAMGSVRHITDIKVDEMSDAGKTSLNLQTGTNKGASQSGMAMGAIRHIADQNIS-EMSAEGKSVIGLQYGSNKGASQSGMAMGTRRHVADIKVD-PMSREGEGII 325          

HSP 6 Score: 74.3294 bits (181), Expect = 3.450e-13
Identity = 42/85 (49.41%), Postives = 58/85 (68.24%), Query Frame = 1
Query:   67 AKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +K +IGLQAGSNKGA+Q GM +G  R + D+    E+S   + +I LQAGSNKGA+Q+GM +G+ R I D+    E+SD GK  +
Sbjct:  165 SKTIIGLQAGSNKGASQKGMSMGAVRHVADIKAD-EMSKEAQGIIGLQAGSNKGASQSGMAMGSVRHITDIKVD-EMSDAGKTSL 247          
BLAST of Calponin-like protein vs. TrEMBL
Match: A0A5K3FFN3 (Transgelin OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.619e-27
Identity = 60/106 (56.60%), Postives = 82/106 (77.36%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            G+SM AVRH+ADI+ +EM  +A+G+IGLQAGSNKGA+Q+GM +G+ R I D+    E+SD+GKT ++LQ G+NKGA+Q+GM +G  R I D  N  E+S EGK+VI
Sbjct:  190 GMSMGAVRHVADIKADEMSKEAQGIIGLQAGSNKGASQSGMAMGSVRHITDIKVD-EMSDAGKTSLNLQTGTNKGASQSGMAMGAIRHIAD-QNISEMSAEGKSVI 293          

HSP 2 Score: 98.5969 bits (244), Expect = 6.842e-22
Identity = 48/96 (50.00%), Postives = 73/96 (76.04%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNG 288
            +G+++ ++RH+ADI+ +EM  D+ GVIGLQAG+N+ ATQ+GM +G++R + D+  G E+S     +I LQ+GSN+GA+QAGM  GTQR I++V  G
Sbjct:  345 SGMAIGSMRHVADIKVDEMTKDSHGVIGLQAGTNQYATQSGMSMGSRRHVADIKIG-EMSKESAGIIGLQSGSNQGASQAGMSFGTQRHIDNVKVG 439          

HSP 3 Score: 96.2857 bits (238), Expect = 4.239e-21
Identity = 49/93 (52.69%), Postives = 68/93 (73.12%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDV 279
            +G++M A+RHIAD   +EM  + K VIGLQ GSNKGA+Q+GM +GT+R + D+     +S  G+ +I LQAGSNKGATQ+GM IG+ R + D+
Sbjct:  267 SGMAMGAIRHIADQNISEMSAEGKSVIGLQYGSNKGASQSGMAMGTRRHVADIKVD-PMSREGEGIIGLQAGSNKGATQSGMAIGSMRHVADI 358          

HSP 4 Score: 93.2041 bits (230), Expect = 6.314e-20
Identity = 49/107 (45.79%), Postives = 74/107 (69.16%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G++M   RH+ADI+ + M  + +G+IGLQAGSNKGATQ+GM IG+ R + D+    E++     VI LQAG+N+ ATQ+GM +G++R + D+  G E+S E   +I
Sbjct:  306 SGMAMGTRRHVADIKVDPMSREGEGIIGLQAGSNKGATQSGMAIGSMRHVADIKVD-EMTKDSHGVIGLQAGTNQYATQSGMSMGSRRHVADIKIG-EMSKESAGII 410          

HSP 5 Score: 92.4337 bits (228), Expect = 1.248e-19
Identity = 51/107 (47.66%), Postives = 74/107 (69.16%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G++M +VRHI DI+ +EM D  K  + LQ G+NKGA+Q+GM +G  R I D +   E+S  GK+VI LQ GSNKGA+Q+GM +GT+R + D+     +S EG+ +I
Sbjct:  228 SGMAMGSVRHITDIKVDEMSDAGKTSLNLQTGTNKGASQSGMAMGAIRHIADQNIS-EMSAEGKSVIGLQYGSNKGASQSGMAMGTRRHVADIKVD-PMSREGEGII 332          

HSP 6 Score: 74.3294 bits (181), Expect = 3.350e-13
Identity = 42/85 (49.41%), Postives = 58/85 (68.24%), Query Frame = 1
Query:   67 AKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +K +IGLQAGSNKGA+Q GM +G  R + D+    E+S   + +I LQAGSNKGA+Q+GM +G+ R I D+    E+SD GK  +
Sbjct:  172 SKTIIGLQAGSNKGASQKGMSMGAVRHVADIKAD-EMSKEAQGIIGLQAGSNKGASQSGMAMGSVRHITDIKVD-EMSDAGKTSL 254          
BLAST of Calponin-like protein vs. TrEMBL
Match: W6USP8 (Calponin OV9M OS=Echinococcus granulosus OX=6210 GN=EGR_00867 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.708e-26
Identity = 59/106 (55.66%), Postives = 77/106 (72.64%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            G+S+ AVRHIADI+  +M  +A+G+IGLQAGSNKGA+Q+GM IG  R I D+    ++S  GKTVI LQAGSNKGA+Q+GM +G  R + D+     IS+ GK VI
Sbjct:   20 GMSIGAVRHIADIKAGDMTREAQGIIGLQAGSNKGASQSGMSIGAMRHIADLKID-QMSADGKTVIGLQAGSNKGASQSGMNMGGIRHVADI-KADSISESGKKVI 123          

HSP 2 Score: 100.523 bits (249), Expect = 2.393e-24
Identity = 57/107 (53.27%), Postives = 78/107 (72.90%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G+S+ A+RHIAD++ ++M  D K VIGLQAGSNKGA+Q+GM +G  R + D+     IS+SGK VI LQAG+NK + Q+GM +G  R I D+  G  +SDEGK+VI
Sbjct:   58 SGMSIGAMRHIADLKIDQMSADGKTVIGLQAGSNKGASQSGMNMGGIRHVADIKAD-SISESGKKVIGLQAGTNKVSNQSGMSMGKIRHIADLKVG-AMSDEGKSVI 162          

HSP 3 Score: 87.0409 bits (214), Expect = 4.510e-19
Identity = 46/90 (51.11%), Postives = 65/90 (72.22%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFI 270
            +G++M  +RH+ADI+ + + +  K VIGLQAG+NK + Q+GM +G  R I D+  G  +SD GK+VI LQAGSN+GATQAG+  G +R I
Sbjct:   97 SGMNMGGIRHVADIKADSISESGKKVIGLQAGTNKVSNQSGMSMGKIRHIADLKVGA-MSDEGKSVIGLQAGSNEGATQAGIAFGGRRDI 185          

HSP 4 Score: 74.3294 bits (181), Expect = 4.235e-14
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            VIGLQAGSNKGA+Q GM IG  R I D+  G +++   + +I LQAGSNKGA+Q+GM IG  R I D+    ++S +GK VI
Sbjct:    5 VIGLQAGSNKGASQKGMSIGAVRHIADIKAG-DMTREAQGIIGLQAGSNKGASQSGMSIGAMRHIADLKID-QMSADGKTVI 84          
BLAST of Calponin-like protein vs. TrEMBL
Match: A0A0R3T7M5 (Transgelin OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS3062 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.271e-26
Identity = 58/107 (54.21%), Postives = 82/107 (76.64%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G++M A+RHIAD+  + M  + K +IGLQ+GSNKGA QAGM +G+ R + D+ TG E+++ GKTVI LQAGSN+GA Q+GM +G+ R I D+  G ++SDEGK+VI
Sbjct:  211 SGMAMGAIRHIADLPVDAMSAEGKTIIGLQSGSNKGANQAGMAMGSIRHVADMKTG-EMTEGGKTVIGLQAGSNQGANQSGMSMGSIRHIADLKTG-KMSDEGKSVI 315          

HSP 2 Score: 106.686 bits (265), Expect = 5.960e-25
Identity = 58/106 (54.72%), Postives = 79/106 (74.53%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            G+S+ AVRHIADI+ ++M  DA+G+IGLQAGSNKGA+Q+GM +G  R I D+     +S  GKT+I LQ+GSNKGA QAGM +G+ R + D+  G E+++ GK VI
Sbjct:  173 GMSIGAVRHIADIKADDMSKDAQGIIGLQAGSNKGASQSGMAMGAIRHIADLPVDA-MSAEGKTIIGLQSGSNKGANQAGMAMGSIRHVADMKTG-EMTEGGKTVI 276          

HSP 3 Score: 103.219 bits (256), Expect = 1.261e-23
Identity = 56/106 (52.83%), Postives = 77/106 (72.64%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            G++M ++RH+AD++  EM +  K VIGLQAGSN+GA Q+GM +G+ R I D+ TG ++SD GK+VI LQAGSNKGA+Q GM IG  R I D+    ++S E KN +
Sbjct:  251 GMAMGSIRHVADMKTGEMTEGGKTVIGLQAGSNQGANQSGMSMGSIRHIADLKTG-KMSDEGKSVIGLQAGSNKGASQKGMNIGNTRHIADMKID-DMSAEAKNFV 354          

HSP 4 Score: 95.9005 bits (237), Expect = 5.310e-21
Identity = 54/107 (50.47%), Postives = 73/107 (68.22%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G+SM ++RHIAD++  +M D+ K VIGLQAGSNKGA+Q GM IG  R I D+    ++S   K  + LQAG+N+ A+Q GM +G  R IND+  G EIS+ GK  I
Sbjct:  289 SGMSMGSIRHIADLKTGKMSDEGKSVIGLQAGSNKGASQKGMNIGNTRHIADMKID-DMSAEAKNFVGLQAGTNQLASQTGMSMGGIRHINDLKVG-EISESGKKEI 393          

HSP 5 Score: 87.4261 bits (215), Expect = 7.468e-18
Identity = 47/89 (52.81%), Postives = 63/89 (70.79%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFI 270
            G+++   RHIAD++ ++M  +AK  +GLQAG+N+ A+Q GM +G  R IND+  G EIS+SGK  I LQAGSN GA QAGM  G +R I
Sbjct:  329 GMNIGNTRHIADMKIDDMSAEAKNFVGLQAGTNQLASQTGMSMGGIRHINDLKVG-EISESGKKEISLQAGSNAGANQAGMSFGNRRNI 416          

HSP 6 Score: 69.707 bits (169), Expect = 1.219e-11
Identity = 42/82 (51.22%), Postives = 55/82 (67.07%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +IGLQAGSNKGA+Q GM IG  R I D+    ++S   + +I LQAGSNKGA+Q+GM +G  R I D+     +S EGK +I
Sbjct:  158 IIGLQAGSNKGASQKGMSIGAVRHIADIKAD-DMSKDAQGIIGLQAGSNKGASQSGMAMGAIRHIADLPVDA-MSAEGKTII 237          
BLAST of Calponin-like protein vs. TrEMBL
Match: A0A183SYR3 (Transgelin OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9361 PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 9.348e-26
Identity = 59/107 (55.14%), Postives = 79/107 (73.83%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G+SM A RHIADI+ +EM  +AKGVIGLQ+GSNKGA+Q+GM +G  R I D+    E+S++GKT I L +G+NKGA+Q+GM +G  R I D   G E+S EGK+ I
Sbjct:  172 SGMSMGATRHIADIKVDEMSAEAKGVIGLQSGSNKGASQSGMSMGATRHIADLKVD-EMSEAGKTSIGLLSGTNKGASQSGMSMGAVRHIADTRVG-EMSAEGKSTI 276          

HSP 2 Score: 99.7525 bits (247), Expect = 1.034e-22
Identity = 55/96 (57.29%), Postives = 66/96 (68.75%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNG 288
            +G+SM AVRHIAD R  EM  + K  IGLQAGSN+GATQ+GM +G  R I D+    ++S  G +VI LQAGSN GA+QAGM  G QR I DV  G
Sbjct:  250 SGMSMGAVRHIADTRVGEMSAEGKSTIGLQAGSNQGATQSGMTMGGVRHIADIKV-EDMSKEGASVIGLQAGSNLGASQAGMNFGAQRHIGDVKVG 344          

HSP 3 Score: 77.0258 bits (188), Expect = 2.988e-14
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            E  + +K +IGLQAGSNKGA+Q+GM +G  R I D+    E+S   K VI LQ+GSNKGA+Q+GM +G  R I D+    E+S+ GK  I
Sbjct:  150 EQLNASKTIIGLQAGSNKGASQSGMSMGATRHIADIKVD-EMSAEAKGVIGLQSGSNKGASQSGMSMGATRHIADLKVD-EMSEAGKTSI 237          
BLAST of Calponin-like protein vs. Ensembl Cavefish
Match: cnn3a (calponin 3 [Source:NCBI gene;Acc:103024651])

HSP 1 Score: 56.6102 bits (135), Expect = 1.929e-10
Identity = 41/95 (43.16%), Postives = 53/95 (55.79%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            RH  D    E     + VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D    ++  D
Sbjct:  150 RHFDD----EKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLD 239          
BLAST of Calponin-like protein vs. Ensembl Cavefish
Match: cnn1b (calponin 1 [Source:NCBI gene;Acc:103040806])

HSP 1 Score: 55.8398 bits (133), Expect = 3.717e-10
Identity = 36/86 (41.86%), Postives = 51/86 (59.30%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGM-RIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+NK A+Q GM   GT+R + D   G+E +   ++ I LQ G+NKGA Q+GM   GT+R I D    +E  D
Sbjct:  157 EKLKEGRNIIGLQMGTNKFASQKGMTSYGTRRHLYDPKVGME-NPLDQSTISLQMGTNKGANQSGMTAPGTKRQIFDKKLDMESCD 241          

HSP 2 Score: 48.521 bits (114), Expect = 1.559e-7
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH+ D +        +  I LQ G+NKGA Q+GM   GT+R I D    +E  D+    + LQ G+NK A+Q+GM + G  R + D
Sbjct:  188 RHLYDPKVGMENPLDQSTISLQMGTNKGANQSGMTAPGTKRQIFDKKLDMESCDTA--TVSLQMGTNKVASQSGMTVYGLPRQVYD 271          
BLAST of Calponin-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000006562.2 (calponin-3-like [Source:NCBI gene;Acc:103046041])

HSP 1 Score: 54.6842 bits (130), Expect = 9.803e-10
Identity = 36/69 (52.17%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMRI-GTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  160 VIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFD 227          
BLAST of Calponin-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000037688.1 (calponin-3-like [Source:NCBI gene;Acc:103046041])

HSP 1 Score: 53.9138 bits (128), Expect = 1.576e-9
Identity = 36/69 (52.17%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMRI-GTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  163 VIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFD 230          
BLAST of Calponin-like protein vs. Ensembl Cavefish
Match: cnn3a (calponin 3 [Source:NCBI gene;Acc:103024651])

HSP 1 Score: 53.5286 bits (127), Expect = 2.726e-9
Identity = 40/86 (46.51%), Postives = 50/86 (58.14%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRI-GTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            RH  D    E     + VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  151 RHFDD----EKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFD 231          
BLAST of Calponin-like protein vs. Ensembl Medaka
Match: ENSORLT00000007021.2 (calponin 2 [Source:NCBI gene;Acc:101165178])

HSP 1 Score: 56.6102 bits (135), Expect = 1.897e-10
Identity = 37/78 (47.44%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            VIGLQ G+NK A+QAGM   GT+R + D    ++      T I LQ G+NKGA+QAGM   GT+R I D   G +  D
Sbjct:  162 VIGLQMGTNKCASQAGMNAYGTRRHLYDPKAHIQ-PPMDNTTISLQMGTNKGASQAGMTAPGTRRAIYDQKLGTDKCD 238          

HSP 2 Score: 50.447 bits (119), Expect = 3.050e-8
Identity = 33/86 (38.37%), Postives = 46/86 (53.49%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDV 279
            RH+ D + +         I LQ G+NKGA+QAGM   GT+R I D   G +  D+  + + LQ G ++GA Q+G   G  R I D 
Sbjct:  185 RHLYDPKAHIQPPMDNTTISLQMGTNKGASQAGMTAPGTRRAIYDQKLGTDKCDN--STMSLQMGFSQGANQSGQNFGLGRQIYDA 268          
BLAST of Calponin-like protein vs. Ensembl Medaka
Match: cnn1b (calponin 1 [Source:NCBI gene;Acc:101163085])

HSP 1 Score: 55.0694 bits (131), Expect = 6.238e-10
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGM-RIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMR-IGTQRFINDVSNGIEISD 303
            E   + + +IGLQ G+N+ A+Q GM   GT+R + D   G++ +   ++ I LQ G+NKGATQAGM   GT+R I D    +E  D
Sbjct:  156 EKLREGRNIIGLQMGTNQFASQKGMTSYGTRRHLFDAKIGMD-NPIDQSTISLQMGTNKGATQAGMTAPGTRRHIFDKKLELENCD 240          

HSP 2 Score: 52.7582 bits (125), Expect = 4.758e-9
Identity = 42/110 (38.18%), Postives = 55/110 (50.00%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMR-IGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGM-RIGTQRFIND-----------VSNGIEISDEGKN 315
            RH+ D +        +  I LQ G+NKGATQAGM   GT+R I D    +E  D+  T I LQ G+NK A+Q GM   G  R + D            +NG E+  +G N
Sbjct:  187 RHLFDAKIGMDNPIDQSTISLQMGTNKGATQAGMTAPGTRRHIFDKKLELENCDT--TTISLQMGTNKVASQQGMTTYGLPRQVYDNKYCANPTEGFYNNGSEVEFDGYN 294          
BLAST of Calponin-like protein vs. Ensembl Medaka
Match: cnn3b (calponin 3 [Source:NCBI gene;Acc:101163038])

HSP 1 Score: 55.0694 bits (131), Expect = 7.663e-10
Identity = 36/69 (52.17%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   76 VIGLQAGSNKGATQAGMRI-GTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI-GTQRFIND 276
            VIGLQ G+NK A+QAGM   GT+R + D  T  +     +T I LQ G+NKGA+QAGM   GT+R I D
Sbjct:  202 VIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPHDQTTISLQMGTNKGASQAGMAAPGTRRDIFD 269          

HSP 2 Score: 48.1358 bits (113), Expect = 1.722e-7
Identity = 31/77 (40.26%), Postives = 44/77 (57.14%), Query Frame = 1
Query:   25 RHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRI-GTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRI 252
            RH+ D +        +  I LQ G+NKGA+QAGM   GT+R I D    ++  D+  + I LQ G+NK A+Q GM +
Sbjct:  225 RHLYDPKTQTDKPHDQTTISLQMGTNKGASQAGMAAPGTRRDIFDQKVALQPLDN--STISLQMGTNKVASQRGMSV 299          
BLAST of Calponin-like protein vs. Planmine SMEST
Match: SMESG000057600.1 (SMESG000057600.1)

HSP 1 Score: 204.142 bits (518), Expect = 7.901e-64
Identity = 103/107 (96.26%), Postives = 105/107 (98.13%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            TG+SM AVRHIADIRC+EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVI LQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI
Sbjct:  467 TGMSMGAVRHIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIGLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 573          

HSP 2 Score: 197.208 bits (500), Expect = 4.112e-61
Identity = 99/107 (92.52%), Postives = 102/107 (95.33%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            TG+SM AVRHIADIRC+EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGK VI LQAGSNKGATQAGMRIGTQRFINDVS G+EISD GKNVI
Sbjct:  348 TGMSMGAVRHIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVI 454          

HSP 3 Score: 187.963 bits (476), Expect = 1.242e-57
Identity = 95/107 (88.79%), Postives = 99/107 (92.52%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            TG+SM AVRHIADIRC+EMCD AKGVIGLQAGSNK A+Q GMRIGTQRFINDVSTGVEISDSGK VI LQAGSNKGATQAGMRIGTQRFINDVS G+EISD GKNVI
Sbjct:  229 TGMSMGAVRHIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVI 335          

HSP 4 Score: 123.25 bits (308), Expect = 6.569e-34
Identity = 72/129 (55.81%), Postives = 79/129 (61.24%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKT---------------------------------------VIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            E     +G+IGLQAGSNKGA+Q+GMRIGTQRFINDVSTGVEISD GK+                                       VI LQAGSNK A+Q GMRIGTQRFINDVS G+EISD GKNVI
Sbjct:  167 EQLRSGQGIIGLQAGSNKGASQSGMRIGTQRFINDVSTGVEISDEGKSVIGLQAGSNKFASQTGMSMGAVRHIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVI 295          

HSP 5 Score: 98.2117 bits (243), Expect = 4.272e-25
Identity = 53/88 (60.23%), Postives = 63/88 (71.59%), Query Frame = 1
Query:   25 RHIADIRCN-EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGA--TQAGMRIGTQRFINDV 279
            R I D+    E+ D+ K VIGLQAGSNKGATQAGMRIGTQRFIND+ TGVE+SD GK +I LQ G ++    +Q+GM  G QR I D 
Sbjct:  554 RFINDVSNGIEISDEGKNVIGLQAGSNKGATQAGMRIGTQRFINDIQTGVEMSDKGKNIIGLQMGPDQSQVDSQSGMSFGAQRHITDT 641          
BLAST of Calponin-like protein vs. Planmine SMEST
Match: SMESG000057600.1 (SMESG000057600.1)

HSP 1 Score: 204.142 bits (518), Expect = 8.897e-64
Identity = 103/107 (96.26%), Postives = 105/107 (98.13%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            TG+SM AVRHIADIRC+EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVI LQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI
Sbjct:  460 TGMSMGAVRHIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIGLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 566          

HSP 2 Score: 196.823 bits (499), Expect = 4.608e-61
Identity = 99/107 (92.52%), Postives = 102/107 (95.33%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            TG+SM AVRHIADIRC+EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGK VI LQAGSNKGATQAGMRIGTQRFINDVS G+EISD GKNVI
Sbjct:  341 TGMSMGAVRHIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVI 447          

HSP 3 Score: 187.578 bits (475), Expect = 1.374e-57
Identity = 95/107 (88.79%), Postives = 99/107 (92.52%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            TG+SM AVRHIADIRC+EMCD AKGVIGLQAGSNK A+Q GMRIGTQRFINDVSTGVEISDSGK VI LQAGSNKGATQAGMRIGTQRFINDVS G+EISD GKNVI
Sbjct:  222 TGMSMGAVRHIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVI 328          

HSP 4 Score: 122.865 bits (307), Expect = 7.540e-34
Identity = 72/129 (55.81%), Postives = 79/129 (61.24%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKT---------------------------------------VIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            E     +G+IGLQAGSNKGA+Q+GMRIGTQRFINDVSTGVEISD GK+                                       VI LQAGSNK A+Q GMRIGTQRFINDVS G+EISD GKNVI
Sbjct:  160 EQLRSGQGIIGLQAGSNKGASQSGMRIGTQRFINDVSTGVEISDEGKSVIGLQAGSNKFASQTGMSMGAVRHIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVI 288          

HSP 5 Score: 98.2117 bits (243), Expect = 4.695e-25
Identity = 53/88 (60.23%), Postives = 63/88 (71.59%), Query Frame = 1
Query:   25 RHIADIRCN-EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGA--TQAGMRIGTQRFINDV 279
            R I D+    E+ D+ K VIGLQAGSNKGATQAGMRIGTQRFIND+ TGVE+SD GK +I LQ G ++    +Q+GM  G QR I D 
Sbjct:  547 RFINDVSNGIEISDEGKNVIGLQAGSNKGATQAGMRIGTQRFINDIQTGVEMSDKGKNIIGLQMGPDQSQVDSQSGMSFGAQRHITDT 634          
BLAST of Calponin-like protein vs. Planmine SMEST
Match: SMESG000057599.1 (SMESG000057599.1)

HSP 1 Score: 161.384 bits (407), Expect = 8.698e-50
Identity = 88/146 (60.27%), Postives = 99/146 (67.81%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKT---------------------------------------VIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            +G+SM AVRHIADIRC+EM D+AKGVIGLQAGSNKGATQAGMRIG QRFINDVS+G+E+SD GKT                                       VI LQAGSNKGA+QAGMRIGTQRFINDV+ G+E+SDEGK  I
Sbjct:  189 SGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCIGLQAGSNKGASQTGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTI 334          

HSP 2 Score: 137.117 bits (344), Expect = 1.954e-40
Identity = 69/94 (73.40%), Postives = 78/94 (82.98%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGA--TQAGMRIGTQRFIND 276
            TG+SM AVRHIADIRC+EM D+AKGVIGLQAGSNKGA+QAGMRIGTQRFINDV+TGVE+SD GKT I LQ G +K    +Q+GM  G QR I D
Sbjct:  268 TGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTIGLQMGPDKSKVDSQSGMSFGAQRHITD 361          

HSP 3 Score: 111.309 bits (277), Expect = 1.751e-30
Identity = 59/90 (65.56%), Postives = 70/90 (77.78%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            E    ++G+IGLQAGSNKGA+Q+GM +G  R I D+    E+SD  K VI LQAGSNKGATQAGMRIG QRFINDVS+G+E+SDEGK  I
Sbjct:  167 EQLRSSQGIIGLQAGSNKGASQSGMSMGAVRHIADIRCD-EMSDEAKGVIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCI 255          
BLAST of Calponin-like protein vs. Planmine SMEST
Match: SMESG000057599.1 (SMESG000057599.1)

HSP 1 Score: 137.502 bits (345), Expect = 6.527e-41
Identity = 69/94 (73.40%), Postives = 78/94 (82.98%), Query Frame = 1
Query:    1 TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGA--TQAGMRIGTQRFIND 276
            TG+SM AVRHIADIRC+EM D+AKGVIGLQAGSNKGA+QAGMRIGTQRFINDV+TGVE+SD GKT I LQ G +K    +Q+GM  G QR I D
Sbjct:  229 TGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTIGLQMGPDKSKVDSQSGMSFGAQRHITD 322          

HSP 2 Score: 124.405 bits (311), Expect = 9.672e-36
Identity = 70/129 (54.26%), Postives = 80/129 (62.02%), Query Frame = 1
Query:   52 EMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKT---------------------------------------VIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            E    ++G+IGLQAGSNKGATQAGMRIG QRFINDVS+G+E+SD GKT                                       VI LQAGSNKGA+QAGMRIGTQRFINDV+ G+E+SDEGK  I
Sbjct:  167 EQLRSSQGIIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCIGLQAGSNKGASQTGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTI 295          
BLAST of Calponin-like protein vs. Planmine SMEST
Match: SMESG000067773.1 (SMESG000067773.1)

HSP 1 Score: 103.605 bits (257), Expect = 1.402e-27
Identity = 54/106 (50.94%), Postives = 71/106 (66.98%), Query Frame = 1
Query:    4 GISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVI 321
            G+S+ AVRHIADIRC   C +A  +I LQ GSN+GA+Q GM IG  R ++D+    E +   ++VI LQ G+N GA Q GMRIGTQR I D+S GIE +    N++
Sbjct:  229 GMSIGAVRHIADIRCESNCPEAASIINLQYGSNQGASQKGMVIGGVRHVSDIKCA-ESNKEAQSVISLQYGTNLGANQTGMRIGTQRHITDISCGIEPNKMSSNMV 333          

HSP 2 Score: 86.2705 bits (212), Expect = 3.888e-21
Identity = 43/87 (49.43%), Postives = 57/87 (65.52%), Query Frame = 1
Query:   22 VRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSN--KGATQAGMRIGTQRFIND 276
            VRH++DI+C E   +A+ VI LQ G+N GA Q GMRIGTQR I D+S G+E +     ++ LQ G +  + A Q+GM  G QR IND
Sbjct:  274 VRHVSDIKCAESNKEAQSVISLQYGTNLGANQTGMRIGTQRHITDISCGIEPNKMSSNMVSLQMGPSMKEVANQSGMSFGAQRHIND 360          

HSP 3 Score: 62.7734 bits (151), Expect = 1.140e-12
Identity = 34/70 (48.57%), Postives = 48/70 (68.57%), Query Frame = 1
Query:   70 KGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDV 279
            +G+I LQ+G+NK A+Q+GM  G  R I D+    +++DSGK +I LQ G+NK A+Q GM IG  R I D+
Sbjct:  173 EGIINLQSGTNKFASQSGMSFGGVRHIADIRCD-DLNDSGKGIIGLQMGTNKYASQKGMSIGAVRHIADI 241          
The following BLAST results are available for this feature:
BLAST of Calponin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNN18.154e-1042.68calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN11.347e-942.68calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN11.347e-942.68calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN11.866e-942.68calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN33.437e-949.30calponin 3 [Source:HGNC Symbol;Acc:HGNC:2157][more]
back to top
BLAST of Calponin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clik-16.206e-642.65CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;A... [more]
clik-16.206e-642.65CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Calponin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnn1b1.228e-1143.02calponin 1, basic, smooth muscle, b [Source:ZFIN;A... [more]
cnn3a2.487e-1148.72calponin 3, acidic a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
cnn21.547e-1046.15calponin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-542][more]
cnn3b4.403e-1047.44calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050... [more]
cnn3b4.410e-1047.44calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050... [more]
back to top
BLAST of Calponin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnn12.129e-1046.15calponin 1, basic, smooth muscle [Source:NCBI gene... [more]
slc5a8.14.864e-1044.32solute carrier family 5 member 8, gene 1 [Source:X... [more]
tfdp12.165e-949.30transcription factor Dp-1 [Source:Xenbase;Acc:XB-G... [more]
tfdp12.926e-949.30transcription factor Dp-1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Calponin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnn15.157e-1041.86calponin 1 [Source:MGI Symbol;Acc:MGI:104979][more]
Cnn15.638e-1041.86calponin 1 [Source:MGI Symbol;Acc:MGI:104979][more]
Cnn31.103e-949.30calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919... [more]
Cnn32.944e-949.30calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919... [more]
Cnn32.180e-848.61calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919... [more]
back to top
BLAST of Calponin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26932|CNN1_CHICK6.761e-1045.45Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 S... [more]
sp|Q7YRL2|CNN1_SHEEP3.791e-941.86Calponin-1 OS=Ovis aries OX=9940 GN=CNN1 PE=2 SV=1[more]
sp|Q2HJ38|CNN1_BOVIN3.867e-941.86Calponin-1 OS=Bos taurus OX=9913 GN=CNN1 PE=2 SV=1[more]
sp|Q08092|CNN1_PIG3.905e-941.86Calponin-1 OS=Sus scrofa OX=9823 GN=CNN1 PE=2 SV=1[more]
sp|Q08091|CNN1_MOUSE3.944e-941.86Calponin-1 OS=Mus musculus OX=10090 GN=Cnn1 PE=1 S... [more]
back to top
BLAST of Calponin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QT632.567e-2756.60Transgelin OS=Mesocestoides corti OX=53468 GN=MCOS... [more]
A0A5K3FFN32.619e-2756.60Transgelin OS=Mesocestoides corti OX=53468 PE=4 SV... [more]
W6USP83.708e-2655.66Calponin OV9M OS=Echinococcus granulosus OX=6210 G... [more]
A0A0R3T7M55.271e-2654.21Transgelin OS=Rodentolepis nana OX=102285 GN=HNAJ_... [more]
A0A183SYR39.348e-2655.14Transgelin OS=Schistocephalus solidus OX=70667 GN=... [more]
back to top
BLAST of Calponin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnn3a1.929e-1043.16calponin 3 [Source:NCBI gene;Acc:103024651][more]
cnn1b3.717e-1041.86calponin 1 [Source:NCBI gene;Acc:103040806][more]
ENSAMXT00000006562.29.803e-1052.17calponin-3-like [Source:NCBI gene;Acc:103046041][more]
ENSAMXT00000037688.11.576e-952.17calponin-3-like [Source:NCBI gene;Acc:103046041][more]
cnn3a2.726e-946.51calponin 3 [Source:NCBI gene;Acc:103024651][more]
back to top
BLAST of Calponin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000007021.21.897e-1047.44calponin 2 [Source:NCBI gene;Acc:101165178][more]
cnn1b6.238e-1041.86calponin 1 [Source:NCBI gene;Acc:101163085][more]
cnn3b7.663e-1052.17calponin 3 [Source:NCBI gene;Acc:101163038][more]
back to top
BLAST of Calponin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057600.17.901e-6496.26SMESG000057600.1[more]
SMESG000057600.18.897e-6496.26SMESG000057600.1[more]
SMESG000057599.18.698e-5060.27SMESG000057599.1[more]
SMESG000057599.16.527e-4173.40SMESG000057599.1[more]
SMESG000067773.11.402e-2750.94SMESG000067773.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017416 ID=SMED30017416|Name=Calponin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=323bp
ACTGGAATTAGCATGTTAGCAGTCCGACATATTGCTGACATAAGATGCAA
TGAAATGTGTGATGATGCAAAAGGAGTCATTGGTTTGCAAGCTGGCTCCA
ATAAAGGTGCAACACAAGCCGGAATGAGAATTGGAACTCAGAGATTCATC
AATGACGTTTCAACTGGAGTGGAGATTAGTGATTCAGGAAAAACTGTTAT
TGATTTACAAGCTGGATCTAATAAAGGTGCAACCCAAGCAGGGATGAGAA
TTGGAACCCAAAGGTTTATTAATGATGTTTCAAATGGAATTGAAATTAGT
GATGAAGGAAAAAATGTTATTGG
back to top

protein sequence of SMED30017416-orf-1

>SMED30017416-orf-1 ID=SMED30017416-orf-1|Name=SMED30017416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
TGISMLAVRHIADIRCNEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFI
NDVSTGVEISDSGKTVIDLQAGSNKGATQAGMRIGTQRFINDVSNGIEIS
DEGKNVI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000557Calponin_repeat
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005516calmodulin binding
Vocabulary: biological process
TermDefinition
GO:0031032actomyosin structure organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000557Calponin repeatPFAMPF00402Calponincoord: 67..90
e-value: 3.9E-11
score: 42.4
coord: 27..50
e-value: 3.9E-11
score: 42.4
IPR000557Calponin repeatPROSITEPS01052CALPONIN_1coord: 67..85
IPR000557Calponin repeatPROSITEPS51122CALPONIN_2coord: 27..51
score: 10.222
IPR000557Calponin repeatPROSITEPS51122CALPONIN_2coord: 67..91
score: 10.222
NoneNo IPR availablePANTHERPTHR47385FAMILY NOT NAMEDcoord: 62..92
NoneNo IPR availablePANTHERPTHR47385:SF3coord: 17..52
NoneNo IPR availablePANTHERPTHR47385FAMILY NOT NAMEDcoord: 17..52
NoneNo IPR availablePANTHERPTHR47385:SF3coord: 62..92