Ubiquitin-like domain-containing protein

Overview
NameUbiquitin-like domain-containing protein
Smed IDSMED30017409
Length (bp)603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-like domain-containing protein (SMED30017409) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-like domain-containing protein (SMED30017409) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-like domain-containing protein (SMED30017409) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-like domain-containing protein (SMED30017409) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017409

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30017409 dd_Smed_v4_8353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017409 dd_Smed_v4_8353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: UBL5 (ubiquitin like 5 [Source:HGNC Symbol;Acc:HGNC:13736])

HSP 1 Score: 134.035 bits (336), Expect = 1.320e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: UBL5 (ubiquitin like 5 [Source:HGNC Symbol;Acc:HGNC:13736])

HSP 1 Score: 134.035 bits (336), Expect = 1.320e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: UBL5 (ubiquitin like 5 [Source:HGNC Symbol;Acc:HGNC:13736])

HSP 1 Score: 134.035 bits (336), Expect = 1.320e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Celegans
Match: ubl-5 (Ubiquitin-like protein 5 [Source:UniProtKB/Swiss-Prot;Acc:P91302])

HSP 1 Score: 139.043 bits (349), Expect = 5.775e-43
Identity = 65/73 (89.04%), Postives = 70/73 (95.89%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEITVNDRLGKKVR+KCNPSDTIGDLKKLIAAQTGTR+EKI+LKKWYTI+KDHITL DYEIH+G N ELYYQ
Sbjct:    1 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Fly
Match: ubl (gene:FBgn0022224 transcript:FBtr0086211)

HSP 1 Score: 136.732 bits (343), Expect = 5.751e-42
Identity = 65/73 (89.04%), Postives = 68/73 (93.15%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEIT NDRLGKKVRVKCNP DTIGDLKKLIAAQTGT++EKI+LKKWYTIFKD I L DYEIHDGMNLELYYQ
Sbjct:    1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Xenopus
Match: ubl5 (ubiquitin like 5 [Source:NCBI gene;Acc:100124317])

HSP 1 Score: 132.494 bits (332), Expect = 5.072e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTI DLKKLIAAQTGTR++KI+LKKWYTIFKDH+TL DYEIHDGMNLELYYQ
Sbjct:    2 MIEVVCNDRLGKKVRVKCNSDDTIKDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLCDYEIHDGMNLELYYQ 74          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Ubl5 (ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:1913427])

HSP 1 Score: 134.035 bits (336), Expect = 9.061e-41
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Ubl5 (ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:1913427])

HSP 1 Score: 134.035 bits (336), Expect = 9.061e-41
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Ubl5 (ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:1913427])

HSP 1 Score: 134.035 bits (336), Expect = 9.061e-41
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Ubl5 (ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:1913427])

HSP 1 Score: 134.035 bits (336), Expect = 9.061e-41
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Gm2001 (predicted gene 2001 [Source:MGI Symbol;Acc:MGI:3780171])

HSP 1 Score: 132.88 bits (333), Expect = 2.442e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KIILKKWYTI+KDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIILKKWYTIYKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P91302|UBL5_CAEEL (Ubiquitin-like protein 5 OS=Caenorhabditis elegans OX=6239 GN=ubl-5 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.346e-42
Identity = 65/73 (89.04%), Postives = 70/73 (95.89%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEITVNDRLGKKVR+KCNPSDTIGDLKKLIAAQTGTR+EKI+LKKWYTI+KDHITL DYEIH+G N ELYYQ
Sbjct:    1 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9V998|UBL5_DROME (Ubiquitin-like protein 5 OS=Drosophila melanogaster OX=7227 GN=ubl PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.765e-41
Identity = 65/73 (89.04%), Postives = 68/73 (93.15%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEIT NDRLGKKVRVKCNP DTIGDLKKLIAAQTGT++EKI+LKKWYTIFKD I L DYEIHDGMNLELYYQ
Sbjct:    1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q791B0|UBL5_PSAOB (Ubiquitin-like protein 5 OS=Psammomys obesus OX=48139 GN=UBL5 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.338e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EPV8|UBL5_MOUSE (Ubiquitin-like protein 5 OS=Mus musculus OX=10090 GN=Ubl5 PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.338e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6EGX7|UBL5_MESAU (Ubiquitin-like protein 5 OS=Mesocricetus auratus OX=10036 GN=UBL5 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.338e-40
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR+ KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A267DTG4 (Ubiquitin-like domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028742g1 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 5.018e-42
Identity = 67/73 (91.78%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEITVNDRLGKKVR+KCNPSDTIGDLKKLIAAQTGTR++KI+LKKWYTIFKDHI+L+DYEIHDGMNLELYYQ
Sbjct:    6 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHISLEDYEIHDGMNLELYYQ 78          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A267DQK0 (Ubiquitin-like domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029930g1 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 7.178e-42
Identity = 67/73 (91.78%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEITVNDRLGKKVR+KCNPSDTIGDLKKLIAAQTGTR++KI+LKKWYTIFKDHI+L+DYEIHDGMNLELYYQ
Sbjct:    1 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHISLEDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: R7UXU8 (Ubiquitin-like domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_165352 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.342e-41
Identity = 66/73 (90.41%), Postives = 71/73 (97.26%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEIT NDRLGKKVR+KCNP DTIGDLKKLI+AQTGTRYEKI+LKKWYTI+KDH+TLDDYEIHDGMNLELYYQ
Sbjct:    1 MIEITCNDRLGKKVRIKCNPDDTIGDLKKLISAQTGTRYEKIVLKKWYTIYKDHVTLDDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: Q4SMI6 (Chromosome 18 SCAF14547, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=UBL5 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 8.174e-41
Identity = 65/73 (89.04%), Postives = 70/73 (95.89%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCNP D+IGDLKKLIAAQTGTRY+KI+LKKWYTIFKDH+TLDDYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNPQDSIGDLKKLIAAQTGTRYDKIVLKKWYTIFKDHVTLDDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A3B4ASQ5 (Ubiquitin like 5 OS=Periophthalmus magnuspinnatus OX=409849 GN=UBL5 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.062e-40
Identity = 65/73 (89.04%), Postives = 70/73 (95.89%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCNP DTIGDLKKLIAAQTGTRY+KI+LKKWYTIFKDH++LDDYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRYDKIVLKKWYTIFKDHVSLDDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Cavefish
Match: UBL5 (ubiquitin like 5 [Source:NCBI gene;Acc:103047037])

HSP 1 Score: 137.887 bits (346), Expect = 3.853e-42
Identity = 63/75 (84.00%), Postives = 69/75 (92.00%), Query Frame = 1
Query:   82 NNMIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            + MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR++KI+LKKWYTIFKDH+TL DYEIHDGMNLELYYQ
Sbjct:   24 SEMIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDYEIHDGMNLELYYQ 98          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Cavefish
Match: UBL5 (ubiquitin like 5 [Source:NCBI gene;Acc:103047037])

HSP 1 Score: 136.346 bits (342), Expect = 8.592e-42
Identity = 63/73 (86.30%), Postives = 68/73 (93.15%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTR++KI+LKKWYTIFKDH+TL DYEIHDGMNLELYYQ
Sbjct:    1 MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDYEIHDGMNLELYYQ 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Yeast
Match: HUB1 (Ubiquitin-like protein modifier; promotes alternative splicing of SRC1 pre-mRNA; binds non-covalently to the HIND domain of Snu66, may function in modification of Sph1p and Hbt1p, functionally complemented by the human or S. pombe ortholog; mechanism of Hub1p adduct formation not yet clear [Source:SGD;Acc:S000007251])

HSP 1 Score: 100.138 bits (248), Expect = 1.621e-28
Identity = 44/72 (61.11%), Postives = 58/72 (80.56%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYY 303
            MIE+ VNDRLGKKVRVKC   D++GD KK+++ Q GT+  KI+L+K  ++ KDHI+L+DYE+HD  NLELYY
Sbjct:    1 MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYY 72          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKC2])

HSP 1 Score: 136.346 bits (342), Expect = 2.813e-42
Identity = 63/73 (86.30%), Postives = 70/73 (95.89%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEIT NDRLGKKVRVKCNP DTIGDLKKL+AAQTGT++E+I+LKKWYTIFKDHITL DYEI+DGMNLELYY+
Sbjct:    1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLVAAQTGTKWERIVLKKWYTIFKDHITLQDYEINDGMNLELYYK 73          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Medaka
Match: UBL5 (ubiquitin like 5 [Source:NCBI gene;Acc:101169173])

HSP 1 Score: 137.887 bits (346), Expect = 7.337e-42
Identity = 70/99 (70.71%), Postives = 77/99 (77.78%), Query Frame = 1
Query:   13 LCKYFQFVLITNIFHLFQYLITLN-NMIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            L + FQ V       + Q   T N  MIE+  NDRLGKKVRVKCN  DTIGDLKKLIAAQTGTRY+KI+LKKWYTIFKDH++L DYEIHDGMNLELYYQ
Sbjct:   25 LSRRFQLVK-----KIHQSWATFNYTMIEVICNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRYDKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ 118          
BLAST of Ubiquitin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000027082.1 (SMESG000027082.1)

HSP 1 Score: 144.05 bits (362), Expect = 5.566e-45
Identity = 69/73 (94.52%), Postives = 70/73 (95.89%), Query Frame = 1
Query:   88 MIEITVNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELYYQ 306
            MIEI  NDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWY I+KDHITLDDYEIHDGMNLELYYQ
Sbjct:    1 MIEIICNDRLGKKVRVKCNPSDTIGDLKKLIAAQTGTRYEKIILKKWYNIYKDHITLDDYEIHDGMNLELYYQ 73          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
UBL51.320e-4084.93ubiquitin like 5 [Source:HGNC Symbol;Acc:HGNC:1373... [more]
UBL51.320e-4084.93ubiquitin like 5 [Source:HGNC Symbol;Acc:HGNC:1373... [more]
UBL51.320e-4084.93ubiquitin like 5 [Source:HGNC Symbol;Acc:HGNC:1373... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubl-55.775e-4389.04Ubiquitin-like protein 5 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubl5.751e-4289.04gene:FBgn0022224 transcript:FBtr0086211[more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubl55.072e-4084.93ubiquitin like 5 [Source:NCBI gene;Acc:100124317][more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubl59.061e-4184.93ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:191342... [more]
Ubl59.061e-4184.93ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:191342... [more]
Ubl59.061e-4184.93ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:191342... [more]
Ubl59.061e-4184.93ubiquitin-like 5 [Source:MGI Symbol;Acc:MGI:191342... [more]
Gm20012.442e-4084.93predicted gene 2001 [Source:MGI Symbol;Acc:MGI:378... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91302|UBL5_CAEEL7.346e-4289.04Ubiquitin-like protein 5 OS=Caenorhabditis elegans... [more]
sp|Q9V998|UBL5_DROME5.765e-4189.04Ubiquitin-like protein 5 OS=Drosophila melanogaste... [more]
sp|Q791B0|UBL5_PSAOB6.338e-4084.93Ubiquitin-like protein 5 OS=Psammomys obesus OX=48... [more]
sp|Q9EPV8|UBL5_MOUSE6.338e-4084.93Ubiquitin-like protein 5 OS=Mus musculus OX=10090 ... [more]
sp|Q6EGX7|UBL5_MESAU6.338e-4084.93Ubiquitin-like protein 5 OS=Mesocricetus auratus O... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DTG45.018e-4291.78Ubiquitin-like domain-containing protein (Fragment... [more]
A0A267DQK07.178e-4291.78Ubiquitin-like domain-containing protein OS=Macros... [more]
R7UXU83.342e-4190.41Ubiquitin-like domain-containing protein OS=Capite... [more]
Q4SMI68.174e-4189.04Chromosome 18 SCAF14547, whole genome shotgun sequ... [more]
A0A3B4ASQ51.062e-4089.04Ubiquitin like 5 OS=Periophthalmus magnuspinnatus ... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
UBL53.853e-4284.00ubiquitin like 5 [Source:NCBI gene;Acc:103047037][more]
UBL58.592e-4286.30ubiquitin like 5 [Source:NCBI gene;Acc:103047037][more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HUB11.621e-2861.11Ubiquitin-like protein modifier; promotes alternat... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO358332.813e-4286.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
UBL57.337e-4270.71ubiquitin like 5 [Source:NCBI gene;Acc:101169173][more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000027082.15.566e-4594.52SMESG000027082.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017409 ID=SMED30017409|Name=Ubiquitin-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=603bp
ATAATTTTCACGCTTTGCAAATATTTTCAATTTGTTTTAATAACCAATAT
ATTTCATTTATTTCAATATTTAATAACTCTTAATAATATGATAGAAATAA
CGGTTAATGACCGTTTAGGGAAGAAAGTTAGAGTGAAATGTAATCCATCT
GACACTATTGGAGATTTAAAGAAACTTATTGCAGCTCAAACAGGTACTCG
CTATGAGAAAATTATTTTAAAAAAGTGGTACACGATTTTTAAGGATCATA
TTACTCTAGATGACTATGAAATCCACGATGGAATGAATTTGGAGTTATAT
TATCAGTAATGAATCGAATCAATTATTTTATGTTTATGATATGCCATTTA
TTGAAATACGGTTTTTATGCTTGAATTTGTATTTTTTGCAATTCTATGTA
TTTGATCTATGATTTTAACGAAATCTAAGTATGATTTGAATGATCCGAAA
TTTTTAAGAGGTAAAAGTGGATTTTAATTCGTTTCAATGTAAATGGAATC
TGTGAATTCGTTGTCTCTATTGATCTTTTCCATTTCATTTATCTTTATAT
CTGTATTATCATTAAATTATTTGTTTTATATTTACGATAAACATCTGCAA
TGC
back to top

protein sequence of SMED30017409-orf-1

>SMED30017409-orf-1 ID=SMED30017409-orf-1|Name=SMED30017409-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
IIFTLCKYFQFVLITNIFHLFQYLITLNNMIEITVNDRLGKKVRVKCNPS
DTIGDLKKLIAAQTGTRYEKIILKKWYTIFKDHITLDDYEIHDGMNLELY
YQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039732Hub1/Ubl5
IPR000626Ubiquitin-like_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0031386protein tag
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006464cellular protein modification process
GO:0010628positive regulation of gene expression
GO:0034514mitochondrial unfolded protein response
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0044798nuclear transcription factor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 23..102
e-value: 9.6E-32
score: 110.7
NoneNo IPR availableCDDcd01791Ubl_UBL5coord: 30..100
e-value: 3.85163E-50
score: 150.932
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 40..99
e-value: 5.1E-6
score: 26.2
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 31..102
score: 10.702
IPR039732Ubiquitin-like modifier Hub1/Ubl5PANTHERPTHR13042FAMILY NOT NAMEDcoord: 28..102
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 27..101