triokinase/FMN cyclase

Overview
Nametriokinase/FMN cyclase
Smed IDSMED30017402
Length (bp)1941
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of triokinase/FMN cyclase (SMED30017402) t-SNE clustered cells

Violin plots show distribution of expression levels for triokinase/FMN cyclase (SMED30017402) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of triokinase/FMN cyclase (SMED30017402) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for triokinase/FMN cyclase (SMED30017402) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017402

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017402SMESG000008455.1 SMESG000008453.1 Contig960newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017402SMESG000008455.1 SMESG000008453.1 Contig960uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017402SMESG000025294.1 Contig960newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017402SMESG000025294.1 Contig960uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30017402SMESG000008455.1 SMESG000008453.1 SmedASXL_013558SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of triokinase/FMN cyclase vs. Ensembl Human
Match: TKFC (triokinase and FMN cyclase [Source:HGNC Symbol;Acc:HGNC:24552])

HSP 1 Score: 289.271 bits (739), Expect = 7.430e-89
Identity = 201/540 (37.22%), Postives = 307/540 (56.85%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSG-SVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLA-ASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPG 1809
            +LK +V LLSGGGSGHEP HAGF+GK ML+  + G +F SP   +IL AI  +      G LLIVKNYTGDR+NF +A E+AR  GI VE+VV+G+D+A      A GRRGL GT+LIHK+AGA+AE  + L+EI + VN + K   MGT+G+S S  SV   K      LS D  ELGLGIHGEAG+ R K  TA+ ++K M++H+T+    S V +  G  VV+++NNLG  + +EL ++A++ +  LE    V + R   G ++++L+M GIS+T+L V D+ +L+ +D   TA  W     N+++ +     +  V   +      S++       +     K  ALVL      L+  E +LN LD+  GDGDCGTT  R A A++++    + E         L +   ++  +  G S G L   F + + + ++   ++  W       ++ + + G A  GDRTMLD ++     L+ WK+   +  + V+ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPG
Sbjct:   44 SLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAK--AMGTLGVSLSSCSVPGSKPT--FELSADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGR-GVKIARALVGTFMSALEMPGISLTLLLV-DEPLLKLIDAETTAAAW----PNVAAVSITGRKRSRVAPAEPQEAPDSTA-------AGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEW----LKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQ-VLTKAVKSAEAAAEATKNMEAGAGRASYI-SSARL-EQPDPG 558          
BLAST of triokinase/FMN cyclase vs. Ensembl Human
Match: TKFC (triokinase and FMN cyclase [Source:HGNC Symbol;Acc:HGNC:24552])

HSP 1 Score: 271.937 bits (694), Expect = 1.013e-82
Identity = 187/499 (37.47%), Postives = 282/499 (56.51%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSG-SVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLA-ASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMV 1686
            +LK +V LLSGGGSGHEP HAGF+GK ML+  + G +F SP   +IL AI  +      G LLIVKNYTGDR+NF +A E+AR  GI VE+VV+G+D+A      A GRRGL GT+LIHK+AGA+AE  + L+EI + VN + K   MGT+G+S S  SV   K      LS D  ELGLGIHGEAG+ R K  TA+ ++K M++H+T+    S V +  G  VV+++NNLG  + +EL ++A++ +  LE    V + R   G ++++L+M GIS+T+L V D+ +L+ +D   TA  W     N+++ +     +  V   +      S++       +     K  ALVL      L+  E +LN LD+  GDGDCGTT  R A A++++    + E         L +   ++  +  G S G L   F + + + ++   ++  W       ++ + + G A  GDRTMLD ++     L+ WK+   +  +++
Sbjct:   43 SLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAK--AMGTLGVSLSSCSVPGSKPT--FELSADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGR-GVKIARALVGTFMSALEMPGISLTLLLV-DEPLLKLIDAETTAAAW----PNVAAVSITGRKRSRVAPAEPQEAPDSTA-------AGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEW----LKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVL 519          
BLAST of triokinase/FMN cyclase vs. Ensembl Human
Match: TKFC (triokinase and FMN cyclase [Source:HGNC Symbol;Acc:HGNC:24552])

HSP 1 Score: 122.094 bits (305), Expect = 1.201e-31
Identity = 69/120 (57.50%), Postives = 85/120 (70.83%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHK 573
            +LK +V LLSGGGSGHEP HAGF+GK ML+  + G +F SP   +IL AI  +      G LLIVKNYTGDR+NF +A E+AR  GI VE+VV+G+D+A      A GRRGL GT+LIHK
Sbjct:   44 SLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKA-GRRGLCGTVLIHK 162          
BLAST of triokinase/FMN cyclase vs. Ensembl Human
Match: TKFC (triokinase and FMN cyclase [Source:HGNC Symbol;Acc:HGNC:24552])

HSP 1 Score: 50.447 bits (119), Expect = 2.993e-6
Identity = 37/140 (26.43%), Postives = 68/140 (48.57%), Query Frame = 1
Query: 1282 LINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMV 1686
            L+  E +LN LD+  GDGDCGTT  R A A++++    + E         L +   ++  +  G S G L   F + + + ++   ++  W       ++ + + G A  GDRTMLD ++     L+ WK+   +  +++
Sbjct:   36 LLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEW----LKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVL 171          
BLAST of triokinase/FMN cyclase vs. Ensembl Celegans
Match: W02H5.8 (pep chromosome:WBcel235:V:2647037:2652712:-1 gene:WBGene00020962.1 transcript:W02H5.8.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W02H5.8)

HSP 1 Score: 282.722 bits (722), Expect = 1.069e-86
Identity = 198/547 (36.20%), Postives = 304/547 (55.58%), Query Frame = 1
Query:  259 HEPGHAGFVGKAMLSAAVLGGIFASPPA---NAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGIS-FSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSN------LEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENP---EAIWCDIFMDSV----QVISEVGGAKEGDRTM---LDVIFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKA 1839
            HEP  AG+VGK +L+AA+ G +FASPP+    A LEA        + G +L V NYTGDR+NF +AAER    G    +V + +D A +S N+  GRRGL G +L  KIAGAMA +  +L EI E    ++    MGT+G+S ++GS+  +   +   L DD  E+GLGIHGE G  R +F +A  ++  +++ L S K+E   + +G+K VV++NNLGS + +E+ ++   ++ Y E +  + + R + G Y+TSL  +G+SVTIL+  DDS+L+YLD P  APGWI  +          +++K V   D   I  SSS       +    +++N  Q + A V    D ++  E +LN+LD   GDGDCG+TF   A A++K   G     +  +   LL  LS I E  +GG+SG L +L F S +  + +     E I     ++++    + + + GGA+ GDRTM   LD +   LR   + ++E+ + +       S+K++  T       GRASY  +  + TK PD GA AI++ ++A
Sbjct:   58 HEPYAAGYVGKGLLTAAIAGNVFASPPSRNVQAALEA-----TRGEAGAILFVINYTGDRLNFGLAAERFNASGGTARVVTIADDVAIDSPNSKVGRRGLAGAVLTIKIAGAMAWEGKSLDEIYETSQKVVSS--MGTLGVSLYTGSLPGKNRET--ELPDDQIEVGLGIHGEPGKFRAQFGSANRIVHSLLDTLRS-KME---MREGEKFVVLVNNLGSVSQLEMNIVNGEVLRYFE-DHKIGITRFFSGIYMTSLDGHGVSVTILRA-DDSMLQYLDAPAAAPGWIPAL----------SVQKCV---DHQEISDSSSQGDLISEIPASGVTVN-AQLVEACVGGVVDAMLESEKHLNQLDAYAGDGDCGSTFAGAAEAIRKQTSGL----NYTHPETLLKQLSIIFEQTVGGTSGALYALMFSSAAQSFAQRSQRGEKIDRTSILEALDKANRAVQKYGGARVGDRTMVDGLDAMVEELRKGFSGNEESLDAIFEAAVKASEKAAKATASQTATVGRASYTSSEAQ-TK-PDAGATAISLWLRA 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Celegans
Match: W02H5.8 (pep chromosome:WBcel235:V:2647037:2652657:-1 gene:WBGene00020962.1 transcript:W02H5.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W02H5.8)

HSP 1 Score: 282.722 bits (722), Expect = 1.069e-86
Identity = 198/547 (36.20%), Postives = 304/547 (55.58%), Query Frame = 1
Query:  259 HEPGHAGFVGKAMLSAAVLGGIFASPPA---NAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGIS-FSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSN------LEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENP---EAIWCDIFMDSV----QVISEVGGAKEGDRTM---LDVIFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKA 1839
            HEP  AG+VGK +L+AA+ G +FASPP+    A LEA        + G +L V NYTGDR+NF +AAER    G    +V + +D A +S N+  GRRGL G +L  KIAGAMA +  +L EI E    ++    MGT+G+S ++GS+  +   +   L DD  E+GLGIHGE G  R +F +A  ++  +++ L S K+E   + +G+K VV++NNLGS + +E+ ++   ++ Y E +  + + R + G Y+TSL  +G+SVTIL+  DDS+L+YLD P  APGWI  +          +++K V   D   I  SSS       +    +++N  Q + A V    D ++  E +LN+LD   GDGDCG+TF   A A++K   G     +  +   LL  LS I E  +GG+SG L +L F S +  + +     E I     ++++    + + + GGA+ GDRTM   LD +   LR   + ++E+ + +       S+K++  T       GRASY  +  + TK PD GA AI++ ++A
Sbjct:   58 HEPYAAGYVGKGLLTAAIAGNVFASPPSRNVQAALEA-----TRGEAGAILFVINYTGDRLNFGLAAERFNASGGTARVVTIADDVAIDSPNSKVGRRGLAGAVLTIKIAGAMAWEGKSLDEIYETSQKVVSS--MGTLGVSLYTGSLPGKNRET--ELPDDQIEVGLGIHGEPGKFRAQFGSANRIVHSLLDTLRS-KME---MREGEKFVVLVNNLGSVSQLEMNIVNGEVLRYFE-DHKIGITRFFSGIYMTSLDGHGVSVTILRA-DDSMLQYLDAPAAAPGWIPAL----------SVQKCV---DHQEISDSSSQGDLISEIPASGVTVN-AQLVEACVGGVVDAMLESEKHLNQLDAYAGDGDCGSTFAGAAEAIRKQTSGL----NYTHPETLLKQLSIIFEQTVGGTSGALYALMFSSAAQSFAQRSQRGEKIDRTSILEALDKANRAVQKYGGARVGDRTMVDGLDAMVEELRKGFSGNEESLDAIFEAAVKASEKAAKATASQTATVGRASYTSSEAQ-TK-PDAGATAISLWLRA 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Zebrafish
Match: tkfc (triokinase/FMN cyclase [Source:ZFIN;Acc:ZDB-GENE-060929-652])

HSP 1 Score: 305.834 bits (782), Expect = 2.066e-95
Identity = 214/553 (38.70%), Postives = 316/553 (57.14%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAA-SDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPE-AIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPVLRCWK-------NSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
            ++K KV LLSGGGSGHEP HAGF+G+ MLS AV G +FASPP  ++L AI  +      GVLLIVKNYTGDR+NF IA E+AR  G+ V++V+V +D A    + A GRRGL GT+ IHK+AGA+AEK   L +I   +N   K   +GT+G+S S   +     +   L     ELGLGIHGE GI R K ++A+ V+K +INH+T +  +S + L  GDKVV+ +NNLG+ + +E+ +++ + I  LE+   V V R   G+++TSL+M G+S++++KV D+ +L   D   TAP W     N+S+ +        V   ++ L          D+ S      +  LVL A    L+ ++  LN LD+  GDGDCG+T    A A++++     +      +  LL++L+ +++ +MGGSSG L  LF  + +    +N + A W        + +   GGA+ GDRTMLD + P +   K         H    +  + E AD   +S   T  +  +AGRASYV +   LT+ PDPGA A+  I++A+
Sbjct:   45 SIKGKVALLSGGGSGHEPAHAGFIGEGMLSGAVAGSVFASPPPGSVLAAILTLWKGGASGVLLIVKNYTGDRLNFGIAVEQARSQGVPVDMVIVADDCAFAQPSKA-GRRGLCGTVFIHKLAGALAEKGCALGDIVARLNEATK--RIGTLGVSLSPCSVPGCLPT-FQLPPGEMELGLGIHGEPGIKRSKVDSADEVVKNIINHMTDSSNKSHLSLKSGDKVVLCVNNLGALSCLEIAVVSKAAIHCLEER-GVLVARVMSGSFMTSLEMAGMSLSLMKV-DEEMLRLFDAKTTAPAW----PNLSTSS--------VSGRNLFLEPAEKPAAASDKCSEGALSSVIRLVLEAICKILLQRQEELNALDRAAGDGDCGSTHALVANAIQEWL---QTSTIPGNLGQLLADLALLVQERMGGSSGALYCLFLSAAAPHLRQNCDGAAWAKALHAGTEAMKRYGGAEPGDRTMLDALCPAVEELKKLSTAPPGGHITVLQAAV-EKADSGAES---TRNLTARAGRASYVASE-HLTQ-PDPGAVAVAAILRAV 570          
BLAST of triokinase/FMN cyclase vs. Ensembl Xenopus
Match: TKFC (triokinase/FMN cyclase [Source:NCBI gene;Acc:779584])

HSP 1 Score: 299.286 bits (765), Expect = 9.024e-93
Identity = 209/553 (37.79%), Postives = 317/553 (57.32%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWID-TVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXX--XXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDV------IFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             +K KV LLSGGGSGHEP HAG+VG+ ML+ A+ G +F SPP  +I+ AI  +      GVLLIVKNYTGDR+NF +A ERAR  G  VE+VV+G+D A      A GRRGL GT++IHKIAGA+AE+  +LKEI   V +      +GT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K  +++ V+K M++H+T    +S V+L  GD V++V+NNLG  + +EL ++A+S +  LE    V + R   G+++T+L+M G+S+TI+K   + +L Y D   +AP W   + + ++ +T+       +F        T+    + D +S+  + ++   V  A    +  E  LN+LD+  GDGDCG+T  R A A++ +     S+    + + LL  LS ++  +MGG+SG L S  L   +   + +  P+A W     D ++ +   GGA+ GDRTMLD       +   LR       +T  + +      + +++D T  M   AGRASY+ ++  L + PDPGA A+  ++K I
Sbjct:   45 GVKGKVALLSGGGSGHEPAHAGYVGRGMLTGAIAGPVFTSPPVGSIVAAIRTVAQAGAEGVLLIVKNYTGDRLNFGLALERARGEGTKVEMVVIGDDCAFSLPKKA-GRRGLCGTVVIHKIAGALAEEGKSLKEILHIVESAAI--RIGTLGVSLSPCSVPGAGPT-FKLAPDELELGLGIHGEAGVRRDKMMSSDEVVKVMMDHMTDPSSQSRVELSPGDTVILVVNNLGGLSCLELQIVASSAVHCLEGR-GVQIQRAMVGSFMTALEMSGVSLTIMKCTPELLLLY-DSETSAPAWPRISRFPVTGQTR-------IFQCAPE--STTYEESKPDTMSVQVYSRVLGRVCLAL---LALEEELNDLDRAAGDGDCGSTHARAAHAIQNWM---NSQQVPSHPAKLLMALSQVLLEKMGGTSGALYSLFLTAAARPLQSMSGPQA-WASAMDDGIEAMKRFGGAEPGDRTMLDPLCAAAGVLQSLRTPGCDLMQTLSLAVQR----ATEAADSTRHMTAGAGRASYIGSS-SLNR-PDPGAVAVAAVLKGI 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Xenopus
Match: TKFC (triokinase/FMN cyclase [Source:NCBI gene;Acc:779584])

HSP 1 Score: 286.189 bits (731), Expect = 9.949e-88
Identity = 203/552 (36.78%), Postives = 305/552 (55.25%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXX--XXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDV------IFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             +K KV LLSGGGSGHEP HAG+VG+ ML+ A+ G +F SPP  +I+ AI  +      GVLLIVKNYTGDR+NF +A ERAR  G  VE+VV+G+D A      A GRRGL GT++IHKIAGA+AE+  +LKEI   +  +  P  +GT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K  +++ V+K M++H+T    +S V+L  GD V++V+NNLG  + +EL ++A+S +  LE    V + R   G+++T+L+M G+S+TI+K   + +L Y +  C+                   M   V  + + +                 + ++   V  A    +  E  LN+LD+  GDGDCG+T  R A A++ +     S+    + + LL  LS ++  +MGG+SG L S  L   +   + +  P+A W     D ++ +   GGA+ GDRTMLD       +   LR       +T  + +      + +++D T  M   AGRASY+ ++  L + PDPGA A+  ++K I
Sbjct:   77 GVKGKVALLSGGGSGHEPAHAGYVGRGMLTGAIAGPVFTSPPVGSIVAAIRTVAQAGAEGVLLIVKNYTGDRLNFGLALERARGEGTKVEMVVIGDDCAFSLPKKA-GRRGLCGTVVIHKIAGALAEEGKSLKEILHILLLVFTP--LGTLGVSLSPCSVPGAGPT-FKLAPDELELGLGIHGEAGVRRDKMMSSDEVVKVMMDHMTDPSSQSRVELSPGDTVILVVNNLGGLSCLELQIVASSAVHCLEGR-GVQIQRAMVGSFMTALEMSGVSLTIMKCTPELLLLYGNDICS-------------------MISCVLAMSVQV-----------------YSRVLGRVCLAL---LALEEELNDLDRAAGDGDCGSTHARAAHAIQNWM---NSQQVPSHPAKLLMALSQVLLEKMGGTSGALYSLFLTAAARPLQSMSGPQA-WASAMDDGIEAMKRFGGAEPGDRTMLDPLCAAAGVLQSLRTPGCDLMQTLSLAVQR----ATEAADSTRHMTAGAGRASYIGSS-SLNR-PDPGAVAVAAVLKGI 574          
BLAST of triokinase/FMN cyclase vs. Ensembl Xenopus
Match: TKFC (triokinase/FMN cyclase [Source:NCBI gene;Acc:779584])

HSP 1 Score: 269.626 bits (688), Expect = 1.068e-81
Identity = 197/553 (35.62%), Postives = 300/553 (54.25%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWID-TVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXX--XXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDV------IFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             +K KV LLSGGGSGHEP HAG+VG+ ML+ A+ G +F SPP  +I+ AI  +      GVLLIVKNYTGDR+NF +A ERAR  G  VE+VV+G+D A      A GRRGL GT++IHKIAGA+AE+  +LKEI   +  +  P  +GT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K  +++ V+K M++H+T    +S V+L  G  +   I+  G    I+                     R   G+++T+L+M G+S+TI+K   + +L Y D   +AP W   + + ++ +T+              + + +  +  ++E S  D +  T ++      L+  E  LN+LD+  GDGDCG+T  R A A++ +     S+    + + LL  LS ++  +MGG+SG L S  L   +   + +  P+A W     D ++ +   GGA+ GDRTMLD       +   LR       +T  + +      + +++D T  M   AGRASY+ ++  L + PDPGA A+  ++K I
Sbjct:   45 GVKGKVALLSGGGSGHEPAHAGYVGRGMLTGAIAGPVFTSPPVGSIVAAIRTVAQAGAEGVLLIVKNYTGDRLNFGLALERARGEGTKVEMVVIGDDCAFSLPKKA-GRRGLCGTVVIHKIAGALAEEGKSLKEILHILLLVFTP--LGTLGVSLSPCSVPGAGPT-FKLAPDELELGLGIHGEAGVRRDKMMSSDEVVKVMMDHMTDPSSQSRVELSPGQYLSACISIEGRGVQIQ---------------------RAMVGSFMTALEMSGVSLTIMKCTPELLLLY-DSETSAPAWPRISRFPVTGQTR--------------IFQCAPESTTYEE-SKPDSESHTRVLGRVCLALLALEEELNDLDRAAGDGDCGSTHARAAHAIQNWM---NSQQVPSHPAKLLMALSQVLLEKMGGTSGALYSLFLTAAARPLQSMSGPQA-WASAMDDGIEAMKRFGGAEPGDRTMLDPLCAAAGVLQSLRTPGCDLMQTLSLAVQR----ATEAADSTRHMTAGAGRASYIGSS-SLNR-PDPGAVAVAAVLKGI 546          
BLAST of triokinase/FMN cyclase vs. Ensembl Mouse
Match: Tkfc (triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI:2385084])

HSP 1 Score: 279.256 bits (713), Expect = 3.504e-85
Identity = 197/548 (35.95%), Postives = 296/548 (54.01%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT-SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVL-AASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             LK +V LLSGGGSGHEP HAGF+GK ML+  + G +FASPP  +IL AI  +      G LLIVKNYTGDR+NF +A E+A+  GI+VE+V+V +D+A      A GRRGL GT+LIHK+AGA+AE+ + L+EI + V+ I K   MGT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K    + ++  M++H+T ++ +  V +  G  VV+++NNLG  + +EL ++A++ I  LE    V V R   G ++++L+M G+S+T++ V D+ +L+ +D   TA  W        +K  +   K+      I    T          +     K  ALVL      LI  E +LN LD+  GDGDCG+T  R A A++ +     S  S   +         ++E   G S          +      +     W       ++ + + G A  GDRTMLD ++      + WK S   +   V+ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPGA A   I +AI
Sbjct:   44 TLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEEGMGLEEITKRVSVIAK--TMGTLGVSLSSCSVPGATHT-FELAADEIELGLGIHGEAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIADAAIRLLEGR-GVKVARALVGTFMSALEMPGVSLTLMLV-DEPVLKLIDAETTAKAWPHM-----AKVSVTGRKR------IRAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLS--RLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWK-SPGASLLPVLTKAVKSAEAAAEATKNMEAGAGRASYI-SSAQLDQ-PDPGAVAAAAIFRAI 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Mouse
Match: Tkfc (triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI:2385084])

HSP 1 Score: 279.256 bits (713), Expect = 3.504e-85
Identity = 197/548 (35.95%), Postives = 296/548 (54.01%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT-SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVL-AASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             LK +V LLSGGGSGHEP HAGF+GK ML+  + G +FASPP  +IL AI  +      G LLIVKNYTGDR+NF +A E+A+  GI+VE+V+V +D+A      A GRRGL GT+LIHK+AGA+AE+ + L+EI + V+ I K   MGT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K    + ++  M++H+T ++ +  V +  G  VV+++NNLG  + +EL ++A++ I  LE    V V R   G ++++L+M G+S+T++ V D+ +L+ +D   TA  W        +K  +   K+      I    T          +     K  ALVL      LI  E +LN LD+  GDGDCG+T  R A A++ +     S  S   +         ++E   G S          +      +     W       ++ + + G A  GDRTMLD ++      + WK S   +   V+ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPGA A   I +AI
Sbjct:   44 TLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEEGMGLEEITKRVSVIAK--TMGTLGVSLSSCSVPGATHT-FELAADEIELGLGIHGEAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIADAAIRLLEGR-GVKVARALVGTFMSALEMPGVSLTLMLV-DEPVLKLIDAETTAKAWPHM-----AKVSVTGRKR------IRAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLS--RLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWK-SPGASLLPVLTKAVKSAEAAAEATKNMEAGAGRASYI-SSAQLDQ-PDPGAVAAAAIFRAI 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Mouse
Match: Tkfc (triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI:2385084])

HSP 1 Score: 279.256 bits (713), Expect = 3.504e-85
Identity = 197/548 (35.95%), Postives = 296/548 (54.01%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT-SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVL-AASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             LK +V LLSGGGSGHEP HAGF+GK ML+  + G +FASPP  +IL AI  +      G LLIVKNYTGDR+NF +A E+A+  GI+VE+V+V +D+A      A GRRGL GT+LIHK+AGA+AE+ + L+EI + V+ I K   MGT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K    + ++  M++H+T ++ +  V +  G  VV+++NNLG  + +EL ++A++ I  LE    V V R   G ++++L+M G+S+T++ V D+ +L+ +D   TA  W        +K  +   K+      I    T          +     K  ALVL      LI  E +LN LD+  GDGDCG+T  R A A++ +     S  S   +         ++E   G S          +      +     W       ++ + + G A  GDRTMLD ++      + WK S   +   V+ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPGA A   I +AI
Sbjct:   44 TLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEEGMGLEEITKRVSVIAK--TMGTLGVSLSSCSVPGATHT-FELAADEIELGLGIHGEAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIADAAIRLLEGR-GVKVARALVGTFMSALEMPGVSLTLMLV-DEPVLKLIDAETTAKAWPHM-----AKVSVTGRKR------IRAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLS--RLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWK-SPGASLLPVLTKAVKSAEAAAEATKNMEAGAGRASYI-SSAQLDQ-PDPGAVAAAAIFRAI 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Mouse
Match: Tkfc (triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI:2385084])

HSP 1 Score: 260.381 bits (664), Expect = 1.423e-78
Identity = 177/487 (36.34%), Postives = 262/487 (53.80%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT-SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVL-AASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKN 1659
             LK +V LLSGGGSGHEP HAGF+GK ML+  + G +FASPP  +IL AI  +      G LLIVKNYTGDR+NF +A E+A+  GI+VE+V+V +D+A      A GRRGL GT+LIHK+AGA+AE+ + L+EI + V+ I K   MGT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K    + ++  M++H+T ++ +  V +  G  VV+++NNLG  + +EL ++A++ I  LE    V V R   G ++++L+M G+S+T++ V D+ +L+ +D   TA  W        +K  +   K+      I    T          +     K  ALVL      LI  E +LN LD+  GDGDCG+T  R A A++ +     S  S   +         ++E   G S          +      +     W       ++ + + G A  GDRTMLD ++      + WK+
Sbjct:   44 TLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEEGMGLEEITKRVSVIAK--TMGTLGVSLSSCSVPGATHT-FELAADEIELGLGIHGEAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIADAAIRLLEGR-GVKVARALVGTFMSALEMPGVSLTLMLV-DEPVLKLIDAETTAKAWPHM-----AKVSVTGRKR------IRAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLS--RLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWKS 511          
BLAST of triokinase/FMN cyclase vs. Ensembl Mouse
Match: Tkfc (triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI:2385084])

HSP 1 Score: 142.124 bits (357), Expect = 1.001e-38
Identity = 78/139 (56.12%), Postives = 101/139 (72.66%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFV 630
             LK +V LLSGGGSGHEP HAGF+GK ML+  + G +FASPP  +IL AI  +      G LLIVKNYTGDR+NF +A E+A+  GI+VE+V+V +D+A      A GRRGL GT+LIHK+AGA+AE+ + L+EI + V
Sbjct:   44 TLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEEGMGLEEITKRV 181          
BLAST of triokinase/FMN cyclase vs. UniProt/SwissProt
Match: sp|Q3LXA3|TKFC_HUMAN (Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC PE=1 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 3.568e-88
Identity = 201/540 (37.22%), Postives = 307/540 (56.85%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSG-SVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLA-ASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPG 1809
            +LK +V LLSGGGSGHEP HAGF+GK ML+  + G +F SP   +IL AI  +      G LLIVKNYTGDR+NF +A E+AR  GI VE+VV+G+D+A      A GRRGL GT+LIHK+AGA+AE  + L+EI + VN + K   MGT+G+S S  SV   K      LS D  ELGLGIHGEAG+ R K  TA+ ++K M++H+T+    S V +  G  VV+++NNLG  + +EL ++A++ +  LE    V + R   G ++++L+M GIS+T+L V D+ +L+ +D   TA  W     N+++ +     +  V   +      S++       +     K  ALVL      L+  E +LN LD+  GDGDCGTT  R A A++++    + E         L +   ++  +  G S G L   F + + + ++   ++  W       ++ + + G A  GDRTMLD ++     L+ WK+   +  + V+ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPG
Sbjct:   44 SLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAK--AMGTLGVSLSSCSVPGSKPT--FELSADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGR-GVKIARALVGTFMSALEMPGISLTLLLV-DEPLLKLIDAETTAAAW----PNVAAVSITGRKRSRVAPAEPQEAPDSTA-------AGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEW----LKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQ-VLTKAVKSAEAAAEATKNMEAGAGRASYI-SSARL-EQPDPG 558          
BLAST of triokinase/FMN cyclase vs. UniProt/SwissProt
Match: sp|F1RKQ4|TKFC_PIG (Triokinase/FMN cyclase OS=Sus scrofa OX=9823 GN=TKFC PE=1 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 1.239e-86
Identity = 192/538 (35.69%), Postives = 294/538 (54.65%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT-SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGW--IDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPG 1809
            +LK +V LLSGGGSGHEP HAGF+GK ML+  + G +F SP   +IL AI  +      G LLIVKNYTGDR+NF +A E+AR  GI VE+VVVG+D+A      A GRRGL GT+LIHK+AGA+AE  + L+EI   V+ + K   MGT+G+S S   +     +   LS D  ELGLGIHGEAG++R K  TA+ ++  M+NH+T S+ +  V +  G  VV+++NNLG  +++EL ++A++ + +LE    V + R   G ++++L+M G+S+T+L V D+ +L+ +D   TA  W  +  V     K       +     D      ++S            +++  ++      L+  E+ LN LD+  GDGDCGTT  R A A++ +     S        +L      ++E   G S          +      +   A W       ++ + + G A  GDRTMLD ++     L+ WK+       ++   L + ++ +++ T  M+  AGRASY+ ++ +L + PDPG
Sbjct:   44 SLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVVGDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEAGVGLEEITNRVSVVAK--AMGTLGVSLSSCSVPGSRPT-FELSADEVELGLGIHGEAGVLRIKMATADEIVAHMLNHMTDSSNVSHVPVQSGSSVVLMVNNLGGLSYLELGIIADAAVRFLEGR-GVKIARALVGTFMSALEMPGVSLTLLLV-DEPLLKLIDAETTAAAWPNVAKVSVTGRKRSRAAPAEPPEAPDATAAGGATS------------KQMVRVLERVCTTLLGLEDQLNALDRAAGDGDCGTTHSRAARAIQGWLK--ESPPPASPAQLLSKLSLLLLEKMGGSSGALYGLFLTAAAQPLKAKTDLAAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGANLLPVLTKALLENAEAAAEATKNMEAGAGRASYI-SSARLDQ-PDPG 559          
BLAST of triokinase/FMN cyclase vs. UniProt/SwissProt
Match: sp|Q58DK4|TKFC_BOVIN (Triokinase/FMN cyclase OS=Bos taurus OX=9913 GN=TKFC PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.875e-85
Identity = 200/540 (37.04%), Postives = 300/540 (55.56%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSG-SVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLA-ASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPG 1809
            +LK +V LLSGGGSGHEP HAGF+GK ML+  + G +F SP   +IL AI  +      G LLIVKNYTGDR+NF +A E+AR  GI VE+VVVG+D+A      A GRRGL GT+LIHK+AGA+AE  + L+EI + V+ + K   MGT+G+S S  SV   K      LS D  ELGLGIHGEAG+ R K  TA  ++  M++H+TS+   S V +  G  VV+++NNLG  + +EL ++A++ +  LE    V + R   G ++++L+M G+S+T+L V D+ +L+ +D   TA  W +      +K  +   K++       L    S+       +  +  K   LVL      L+  E +LN LD+  GDGDCGTT  R A A+     G + E         L +    +  +  G S G L   F + + + ++    +  W       ++ + + G A  GDRTMLD ++     L+ WK+      + ++ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPG
Sbjct:   44 SLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVVGDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEAGVGLEEITDRVSVVAK--AMGTLGVSLSSCSVPGSKPT--FELSADEVELGLGIHGEAGVRRIKMATANEIVALMLDHMTSSSNASHVPVPPGSSVVLMVNNLGGLSFLELGIIADAAVCSLE-GHGVKIARALVGTFMSALEMPGVSLTLLLV-DEPLLKLIDAETTASAWPNV-----AKVWVTGRKRSRAAPTEPLAAPDSTT------AAGEASKQMVLVLEWVCTTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIX----GWLKEGPPPASPAQLLSKLSFLLLEKMGGSSGALYGLFLTAAAQPLKAKTDLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGANMLQ-ILTKAVKSAEAAAEATKNMEAGAGRASYI-SSARLDQ-PDPG 558          
BLAST of triokinase/FMN cyclase vs. UniProt/SwissProt
Match: sp|Q8VC30|TKFC_MOUSE (Triokinase/FMN cyclase OS=Mus musculus OX=10090 GN=Tkfc PE=1 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.451e-84
Identity = 197/548 (35.95%), Postives = 296/548 (54.01%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT-SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVL-AASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             LK +V LLSGGGSGHEP HAGF+GK ML+  + G +FASPP  +IL AI  +      G LLIVKNYTGDR+NF +A E+A+  GI+VE+V+V +D+A      A GRRGL GT+LIHK+AGA+AE+ + L+EI + V+ I K   MGT+G+S S   +     +   L+ D  ELGLGIHGEAG+ R K    + ++  M++H+T ++ +  V +  G  VV+++NNLG  + +EL ++A++ I  LE    V V R   G ++++L+M G+S+T++ V D+ +L+ +D   TA  W        +K  +   K+      I    T          +     K  ALVL      LI  E +LN LD+  GDGDCG+T  R A A++ +     S  S   +         ++E   G S          +      +     W       ++ + + G A  GDRTMLD ++      + WK S   +   V+ +    ++ +++ T  M+  AGRASY+ ++ +L + PDPGA A   I +AI
Sbjct:   44 TLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKA-GRRGLCGTVLIHKVAGALAEEGMGLEEITKRVSVIAK--TMGTLGVSLSSCSVPGATHT-FELAADEIELGLGIHGEAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIADAAIRLLEGR-GVKVARALVGTFMSALEMPGVSLTLMLV-DEPVLKLIDAETTAKAWPHM-----AKVSVTGRKR------IRAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLS--RLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWK-SPGASLLPVLTKAVKSAEAAAEATKNMEAGAGRASYI-SSAQLDQ-PDPGAVAAAAIFRAI 569          
BLAST of triokinase/FMN cyclase vs. UniProt/SwissProt
Match: sp|O04059|DHBK_SOLLC (Putative 3,4-dihydroxy-2-butanone kinase OS=Solanum lycopersicum OX=4081 GN=DHBK PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 9.145e-82
Identity = 195/542 (35.98%), Postives = 301/542 (55.54%), Query Frame = 1
Query:  223 NKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISV-----LLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI-----WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPVLRCWK---NSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPG 1809
            +KV ++SGGGSGHEP HAGFVG+ ML+AA+ G +FASP  ++IL  I  +     C  LLIVKNYTGDR+NF +AAE+A+  G  VE+V+VG+D A        GRRGL GT+L+HK+AGA A   L L ++        +  ++GT+G++ S    S    +   L     ELGLGIHGE G      +  ++V+  ++  + S +   V + +G +VV++IN LG+T  +EL+++A   +  L+    ++V R Y G+++TSL M G S++++K  D +IL+ LD P  AP W      + ++      K  V     + I+   +    ++LS       TA + AA+ E++N  + LNE D ++GDGDCG+T  RGA A+         E+ KKY  +      ++ +   I   MGG+SG L S+F ++   K  EN E++     W D    ++  +S+ GGA  G RT+LD + P L   K   N+  +  +  I   A+ +   ++ T  M+ +AGR++YV  +I L   PDPG
Sbjct:   53 DKVAIISGGGSGHEPAHAGFVGEGMLTAAICGDVFASPNVDSILAGIRAVTGPMGC--LLIVKNYTGDRLNFGLAAEQAKSEGYKVEMVIVGDDCALPPPRGIAGRRGLAGTLLVHKVAGAAAACGLPLADVAAEAKRASE--MVGTMGVALS-VCTSPGQVTSDRLGPGKMELGLGIHGEPGAAVADLQPVDVVVSHVLKEILSPETNYVPITRGSRVVLLINGLGATPLMELMIIAGKAVPELQLEHGLAVDRVYTGSFMTSLDMAGFSISVMKA-DQAILDRLDAPTKAPNW-----PVGAEGNRPPAKIPVPLPPSHSIKIEKTLSRPEKLSPQGHILETA-IEAAATEVVNLRDNLNEWDNKVGDGDCGSTMFRGAVAIL--------EDMKKYYPLNDPAETVNEIGASIGRVMGGTSGILYSIFCKAAYAKLKENAESVVTAIHWADALEAAIAAVSKYGGASAGYRTLLDALIPALSALKERLNAGDDPADAFI-ISAEAASAGAESTKHMQAQAGRSTYVPGDI-LASVPDPG 572          
BLAST of triokinase/FMN cyclase vs. TrEMBL
Match: A0A1S3IBP5 (triokinase/FMN cyclase OS=Lingula unguis OX=7574 GN=LOC106162726 PE=4 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 4.635e-106
Identity = 232/554 (41.88%), Postives = 328/554 (59.21%), Query Frame = 1
Query:  223 NKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDT--VYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAA-SDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSK----KYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI-WCDIFMDSVQVISEVGGAKEGDRTMLDVIFP-----VLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             KV ++SGGGSGHEP H G+VG+ MLSAAV G +FASPP N+IL  I  +G  NK GVLL+VKNYTGDRINF +AAER +  GI V++VV+GED A  S +   GRRGL GTI +HK+AGA+AE+   L+EI        +   MGT+GI+ S   L  +  +   L +D  ELGLG+HGEAG+ R K  TA+  ++ MI H+T+    + + + KGDKV V++NNLG T+ +EL LMA  +I  +E N  V V R +CG+++TSL+M G+ VT++   +D   + LD   +APGW        ++++   E M     DL  ++I TS   L  D     D  KL   +L A  + LI+QE+ LN+LD + GDGDCG+T K GA  + KY     +E S      +   LL +L+ ++E  MGGSSG + SLF  + +     +  A  WC  F   +Q IS+ GGA+ GDRTMLD +       V     +S  + FE  +      +  ++++T     +AGRASYV  +++    PD GA A+++ +KAI
Sbjct:   52 GKVAVISGGGSGHEPAHPGYVGRGMLSAAVCGAVFASPPPNSILAGIRAVGKGNKGGVLLVVKNYTGDRINFGLAAERGKSEGIKVDMVVIGEDCALTSHDKTAGRRGLGGTIFLHKLAGALAEEGRPLEEIVRICTEATQN--MGTIGIALSPCSLPGQGPT-FQLGEDEMELGLGVHGEAGVKRMKLLTAKETVEAMIAHMTNKNSSTHLDINKGDKVAVLVNNLGGTSVLELTLMAGEVIRSIE-NKGVLVQRAFCGSFMTSLEMAGVIVTVMH-LNDVRAKCLDAATSAPGWSPPFLAPGMTNRETPERMPADDADLS-DMIVTSGEGLTVDA----DTGKLLYSILKAICETLISQESSLNQLDSQTGDGDCGSTLKAGAEGILKYL---GTETSPGLPVTHPQNLLLSLACLVERWMGGSSGAMYSLFVTAAAAVVAHDVSATGWCSAFQKGMQAISKYGGAEPGDRTMLDSMNAAYNTLVANLSSSSPIDAFEAAVKAAEQAAADTANMTA----RAGRASYVSKDLQ--TQPDAGAVAVSVWLKAI 586          
BLAST of triokinase/FMN cyclase vs. TrEMBL
Match: A0A3M6THH3 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00006505 PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.361e-104
Identity = 222/546 (40.66%), Postives = 311/546 (56.96%), Query Frame = 1
Query:  259 HEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLT---SAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDF----QKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYF-----IGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMV--IPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKA 1839
            HEP HAGFVGK ML+AAV G +F SPP  +IL AI  +G  N+ G LLIVKNYTGDR+NF  AAERA+  GI V++VVVGED A  S +   GRRGL GT+LIHKIAG++AE+  +L+EI +      +   MGT+G+S +   L     S +  SD+M ELGLGIHGE G+ R K E A+ V+K MI+H++   S     + L KGD+V +V+NNLG T+ +EL ++A + I YL +   V V R Y G+++TSL+M G+S+T+L   D + ++ LD   TAP W     ++S+ +    + K   ++ +N         E  E S        +K+ A++   ++ L   E+ LNELD   GDGDCGTT  RGA+A+KK        G    + +K    LL +L+ + E+ M G S G+    F +  T ++    A   W   +   VQ I   GGA+ GDRTMLD + P    L    +S  +  E V    E A++  +S   T  M  +AGR+SYV    K    PDPGA A+ +  +A
Sbjct:   68 HEPSHAGFVGKGMLTAAVAGAVFTSPPTKSILAAIRAVGLGNRGGTLLIVKNYTGDRLNFGFAAERAKAEGIKVDMVVVGEDCALTSKDKTAGRRGLCGTVLIHKIAGSLAEEGKSLEEISQVAKAAAQ--AMGTIGVSLAPCSLPGSLPSFVLGSDEM-ELGLGIHGEPGVKRVKLEKADQVVKTMIDHMSDVQSGATYKLSLKKGDRVALVVNNLGGTSVLELNIVARAAITYLTQGKEVKVDRVYVGSFMTSLEMAGVSITLLH-LDKTRVDCLDQSTTAPAW--PRVSVSTNSGFMRIDKQPLEIPMNAAE------EKKETSSEKLTALGEKVYAVISHVTNALNAAESNLNELDNLAGDGDCGTTLSRGASAIKKALGTQDAPGLPCNHPEK----LLLSLASLCEDHM-GGSSGVFYSLFLTSGTVHLRGDSAAKSWARAWEAGVQAIMRYGGAEPGDRTMLDALHPAGSTLISELDSGVDPLEAVEKAVEAAELGAQS---TSAMSARAGRSSYVSE--KHLNKPDPGALAVTVWFRA 591          
BLAST of triokinase/FMN cyclase vs. TrEMBL
Match: A0A2R2MMQ2 (triokinase/FMN cyclase-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC112041932 PE=4 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.498e-104
Identity = 232/554 (41.88%), Postives = 327/554 (59.03%), Query Frame = 1
Query:  223 NKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDT--VYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAA-SDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSK----KYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI-WCDIFMDSVQVISEVGGAKEGDRTMLDVIFP-----VLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
             KV ++SGGGSGHEP H G+VG+ MLSAAV G +FASPP N+IL  I  +G  NK GVLL+VKNYTGDRINF +AAER +  GI V++VV+GED A  S +   GRRGL GTI +HK+AGA+AE+   L+EI        +   MGT+GI+ S   L  +  +   L +D  ELGLG+HGEAG+ R K  TA+  ++ MI  +T+    + + + KGDKV V++NNLG T+ +EL LMA  +I  LE N  V V R +CG+++TSL+M G+ VT++   +D   + LD   +APGW        ++++   E M     DL  ++I TS   L  D     D  KL   +L A  + LI+QE+ LN+LD + GDGDCG+T K GA  + KY     +E S      +   LL +L+ ++E  MGGSSG + SLF  + +     +  A  WC  F   +Q IS+ GGA+ GDRTMLD +       V     +S  + FE  +      +  ++++T     +AGRASYV  +++    PD GA A+++ +KAI
Sbjct:   52 GKVAVISGGGSGHEPAHPGYVGRGMLSAAVCGAVFASPPPNSILAGIRAVGKGNKGGVLLVVKNYTGDRINFGLAAERGKSEGIKVDMVVIGEDCALTSHDKTAGRRGLGGTIFLHKLAGALAEEGRPLEEIVSICTEATQN--MGTIGIALSPCSLPGQGPT-FQLGEDEMELGLGVHGEAGVKRMKMLTAKETVEAMIALMTNKNSSTHLDINKGDKVAVLVNNLGGTSVLELTLMAGEVIRCLE-NKGVLVQRAFCGSFMTSLEMAGVIVTVMH-LNDVRAKCLDAATSAPGWSPPFLAPGMTNRETPERMPADDADLS-DMIVTSGEGLTVDA----DTGKLLYSILKAICETLISQESSLNQLDSQTGDGDCGSTLKAGAEGILKYL---GTETSPGLPVTHPQNLLLSLACLVERWMGGSSGAMYSLFVTAAAAVVAHDVSATGWCSAFQKGMQAISKYGGAEPGDRTMLDSMNAAYNTLVANLSSSSPIDAFETAVKAAEQAAADTANMTA----RAGRASYVSKDLQ--TQPDAGAVAVSVWLKAI 586          
BLAST of triokinase/FMN cyclase vs. TrEMBL
Match: A0A2B4T0J0 (Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (Cyclizing) OS=Stylophora pistillata OX=50429 GN=DAK PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 1.623e-102
Identity = 227/544 (41.73%), Postives = 304/544 (55.88%), Query Frame = 1
Query:  259 HEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES---VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISV-------LLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAI--WCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMV--IPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKA 1839
            HEP HAGFVGK ML+AAV G +F SPP  +IL AI  +G+ NK G LLIVKNYTGDR+NF  AAERA+  GI V++VVVGED A  S +   GRRGL GT+LIHKIAGA+AE+  +L+EI +      +   MGT+G+S +   L     S   L  D  ELGLGIHGE G+ R K +  + V+K MI+H+T  +  +   + L KGD + +V+NNLG T+ +EL ++A   I YL +   V V R Y G+ +TSL+M GIS+T+L   D +  + LD   TAP W      +S       M+     L++ +      N    E      +K+ A++   +D LI  E  LNELD   GDGDCGTT  RGA+A+KK         SK    +       LL +L+ + E+ MGGSSG   SLF  S  T ++    A   W   +   VQ I   GGA+ GDRTMLD + P    L    +S  +  E V    E A++  +S   T  M  +AGR+SYV +  K    PDPGA A+ +  +A
Sbjct:   68 HEPSHAGFVGKGMLTAAVAGAVFTSPPTKSILAAIRAVGHGNKGGTLLIVKNYTGDRLNFGFAAERAKAEGIKVDMVVVGEDCALTSKDKTAGRRGLCGTVLIHKIAGALAEEGKSLEEISQVAKATAQ--AMGTIGVSLAPCSLPGSLPS-FVLGIDEMELGLGIHGEPGVKRVKLDKVDQVVKTMIDHMTDVQGGATYKLSLKKGDSMALVVNNLGGTSVLELNIVARMAITYLTQGKEVKVDRVYVGSLMTSLEMAGISITLLH-LDKTRADCLDQSTTAPAW----PRVSVSRNSGCMRTDKQPLEVPMDAVEDKNEAPSEKLTALGEKVYAVISHVTDALIAAEGKLNELDNLAGDGDCGTTLSRGASAIKKVL------GSKDAPGLPCNQPEDLLLSLASLCEDHMGGSSGVFYSLFLMSG-TVHLRGDSAAKSWARAWEAGVQAIMRYGGAEPGDRTMLDALHPAGSTLISELDSGVDPLEAVEKAVEAAEVGAQS---TSAMSARAGRSSYVSD--KHLNKPDPGALAVAVWFRA 591          
BLAST of triokinase/FMN cyclase vs. TrEMBL
Match: C3ZQZ9 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_115040 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 2.584e-100
Identity = 215/539 (39.89%), Postives = 311/539 (57.70%), Query Frame = 1
Query:  223 NKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIR------TSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPE-AIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPVLRCWKN--SHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPG 1809
             KV LLSGGGSGHEP HAG++G  ML+ A+ G +F SPP   IL AI  +G  N  G LLIVKNYTGDR+NF ++ ERAR  G++V+++VVGED A  S +   GRRGL GT+ IHKIAGA+AE+  +L++I +  +       MGT+GIS S   +     S   L  D +ELGLGIHGEAG  R+K  +A+ ++  M++H+T+    + +K+ +G KV +++NNLG T+ +EL ++  + I+YLE    V++ R Y G+++TSL+M G+S+T+L   DD+++  LD   +AP W     ++S + +  +    V+      I+      TS   ++ D+      Q L  +V    D LI+ E  LN LD+  GDGDCG+T  RGA    K  +  +S         LL NL+ I+E  MGGSSG L SLF  + +     + + A WC      +Q I+  GGA+ GDRTMLD +           S   T    + +    ++ S+  T  M  +AGRASYV  + +LT+ PDPG
Sbjct:   52 GKVTLLSGGGSGHEPAHAGYIGAGMLTGAIAGSVFTSPPPADILAAIRAVGQGNPAGTLLIVKNYTGDRLNFGMSLERARSEGLHVDMLVVGEDCALTSHDKTAGRRGLAGTVFIHKIAGALAEQGRSLEDIVKVASQAASQ--MGTIGISLSPCSVPGSGPS-FQLQQDEFELGLGIHGEAGCRRQKMTSADEIVSAMLDHMTNPDNSTHLKIPQGSKVALMVNNLGGTSCLELGIVGRAAIQYLESRG-VAMQRVYTGSFMTSLEMAGVSLTVLH-LDDTLMACLDADTSAPAW---PRHLSDQDRTSD----VYIPAPQHIQAEEGGTTSGQTIQADQ-----AQLLEKVVQRVCDRLIDSEEQLNSLDRASGDGDCGSTMARGA----KEILTSLSRLPFSCPHALLLNLAAIVEKDMGGSSGALYSLFLTAAARPLQSDTQPAAWCAALHAGIQAITRYGGAEPGDRTMLDPLSAAHSTLSAALSSDRTALQALEKAVKAAEMSAHATASMPARAGRASYVSPD-QLTQ-PDPG 567          
BLAST of triokinase/FMN cyclase vs. Ensembl Cavefish
Match: tkfc (triokinase and FMN cyclase [Source:NCBI gene;Acc:103037716])

HSP 1 Score: 296.59 bits (758), Expect = 6.429e-92
Identity = 211/551 (38.29%), Postives = 309/551 (56.08%), Query Frame = 1
Query:  217 LKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIEN-PEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV------LRCWKNSHQETFEMVIPELADISQKSS-DLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
            LK KV LLSGGGSGHEP HAG+VG+ MLS AV G +FASPP  +IL AI  +      GVLL+VKNYTGDR+NF +AAE+AR  G++V++V+V +D A    + A GRRGL GT+ IHK+AGA+AE+   L  I   +    K   +GT+G+S S   +     S   L     ELGLGIHGE GI R K  +A+ V+K MI+H+T    +S + L  GD V++ +NNLG+ + +E+ +++ + I  L     V V R   G++++SL+M G+S+T+++V D+ IL   D   TAP W +    I S        + ++         S +      LS+     +  ++ +    L+ ++  LN LD+  GDGDCG+T    A A++ +     +        +LL+ L+ ++E +MGGSSG L SLF  + + K  E+   A W        + +   GGA+ GDRTMLD + P       L      H    +  + E A++  +S+ DLT     KAGRASY+ +  +LTK PDPGA A+  I +A+
Sbjct:   46 LKGKVALLSGGGSGHEPAHAGYVGRGMLSGAVAGSVFASPPPGSILAAIMTLWQSGVSGVLLLVKNYTGDRLNFGLAAEQARAQGVSVDMVIVADDCAFTQPSKA-GRRGLCGTVFIHKLAGALAEEGCALDVIVAQLTKAKKS--VGTLGVSLSPCSVPGCLPS-FQLPPGDMELGLGIHGEPGIKRSKMASADEVVKTMIDHMTDPSSQSHLPLKSGDTVILCVNNLGALSSLEMAVVSRAAINCLSGR-GVVVARVMSGSFMSSLEMAGVSLTLMRV-DEEILRLFDAKTTAPAWPNLSSVILS-------GRTMYVEPAERPAASETKPNQGPLSL----VIRPVLESVCKVLLQRQEELNALDRAAGDGDCGSTHALAANAIQDWM---QTSTVPGNPCLLLTALARLVEEKMGGSSGALYSLFLTAAAPKLRESWSGADWAKALQAGTEAMKRYGGAEPGDRTMLDALCPAVEELMKLLTAPGDHMAVLQAAV-EKAELGAESTRDLTA----KAGRASYIASE-RLTK-PDPGAVAVAAIFRAV 569          
BLAST of triokinase/FMN cyclase vs. Ensembl Cavefish
Match: tkfc (triokinase and FMN cyclase [Source:NCBI gene;Acc:103037716])

HSP 1 Score: 268.085 bits (684), Expect = 2.057e-81
Identity = 201/550 (36.55%), Postives = 291/550 (52.91%), Query Frame = 1
Query:  217 LKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIEN-PEAIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV------LRCWKNSHQETFEMVIPELADISQKSS-DLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
            LK KV LLSGGGSGHEP HAG+VG+ MLS AV G +FASPP  +IL AI  +      GVLL+VKNYTGDR+NF +AAE+AR  G++V++V+V +D A    + A GRRGL GT+ IHK+AGA+AE+   L  I   +    K   +GT+G+S S   +     S   L     ELGLGIHGE GI R K  +A+ V+K MI+H+T                    +  S +H+ L      ++          V R   G++++SL+M G+S+T+++V D+ IL   D   TAP W +    I S        + ++         S +      LS+     +  ++ +    L+ ++  LN LD+  GDGDCG+T    A A++ +     +        +LL+ L+ ++E +MGGSSG L SLF  + + K  E+   A W        + +   GGA+ GDRTMLD + P       L      H    +  + E A++  +S+ DLT     KAGRASY+ +  +LTK PDPGA A+  I +A+
Sbjct:   46 LKGKVALLSGGGSGHEPAHAGYVGRGMLSGAVAGSVFASPPPGSILAAIMTLWQSGVSGVLLLVKNYTGDRLNFGLAAEQARAQGVSVDMVIVADDCAFTQPSKA-GRRGLCGTVFIHKLAGALAEEGCALDVIVAQLTKAKK--SVGTLGVSLSPCSVPGCLPS-FQLPPGDMELGLGIHGEPGIKRSKMASADEVVKTMIDHMT--------------------DPSSQSHLPLKSAGRGVV----------VARVMSGSFMSSLEMAGVSLTLMRV-DEEILRLFDAKTTAPAWPNLSSVILS-------GRTMYVEPAERPAASETKPNQGPLSL----VIRPVLESVCKVLLQRQEELNALDRAAGDGDCGSTHALAANAIQDWM---QTSTVPGNPCLLLTALARLVEEKMGGSSGALYSLFLTAAAPKLRESWSGADWAKALQAGTEAMKRYGGAEPGDRTMLDALCPAVEELMKLLTAPGDHMAVLQAAV-EKAELGAESTRDLTA----KAGRASYIASE-RLTK-PDPGAVAVAAIFRAV 539          
BLAST of triokinase/FMN cyclase vs. Ensembl Sea Lamprey
Match: tkfc (triokinase/FMN cyclase [Source:ZFIN;Acc:ZDB-GENE-060929-652])

HSP 1 Score: 223.016 bits (567), Expect = 7.892e-65
Identity = 200/613 (32.63%), Postives = 305/613 (49.76%), Query Frame = 1
Query:  100 LIDNNDNAILQYAKTFSMFNSNVXXXXXXXXXXXXXXXNLKN-KVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGIS---FSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSI-LEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISV---LLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEAIWCDIFMDSVQVISEV-----GGAKEGDRTMLDVIFP------VLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAINMKK*SFKLHGY 1878
            L+++ ++ +L+  + F  F+  +  +     I+ +     +N +V ++SGGG+GHEP HAGFVG  MLSAAV G +FASP  +A+L A+  + +    GVLL+VKNY GDR+NF +AAERAR  G+ VE+VVV +D AT +      RRGL GT+L+HK+AGA+AE+   L E+        +  +   VG+S     G  L R       L     +LG+GIHGEAG  R     A  V++ MI        +  + L +G+ V +++NNLG T+H+EL ++A    E L     V V R Y G ++T+L M G+S+T++++  + I L  LD    AP W    +  SS   L +  +A  D        +                + A +    + L+  E+ LN+LD   GDGDCGT+  RGA A   +     ++      +V   LL  LS ++E  MGG+SG L SL   + +      P    C          +       GGA+ GDRTMLD ++       VL           E V+    D +   +  T +M  +AGRA + +      +  DPGA A+ + ++A++    S +  G+
Sbjct:    6 LLNSTESCVLESLRGFVGFHPTLRLLPGPHRIVLRWESVTRNGRVAVISGGGAGHEPAHAGFVGVGMLSAAVSGHVFASPAPSAVLAAVRALAHSGAMGVLLVVKNYAGDRLNFGVAAERARAEGVEVEMVVVADDCATPAIQRRLHRRGLCGTLLVHKVAGALAEQGRPLSEVAREARAAARATVTLAVGLSSCQVPGLALRRWSTP---LQAGEMDLGVGIHGEAGAERVALAPARDVVRIMIIRPVGCSAQGRLPLRRGEHVALMVNNLGGTSHLELGVIAREAAEQLGVRG-VVVERSYVGTFMTALAMAGVSLTVMRLDHEGIRLHCLDADTNAPSWPRASWTSSSLLSLSSAGRAYGDTCGGGYGGA---------------PVRAAMTEVCEALLALESELNDLDSGSGDGDCGTSHARGARASLHWLRHLRADPRTASATVPGHLLRGLSELLEEDMGGTSGALYSLMLSAAAGALGSAPRP--CPADWARAFAAAVRAVRRHGGARPGDRTMLDPLWAAHLELRVLLAGPTVGSNAIE-VLARAVDRATAQALATAQMGARAGRAGWARAGEAWGRV-DPGARAVEVALRAVSF---SLQAQGH 592          
BLAST of triokinase/FMN cyclase vs. Ensembl Yeast
Match: DAK1 (Dihydroxyacetone kinase; required for detoxification of dihydroxyacetone (DHA); involved in stress adaptation [Source:SGD;Acc:S000004535])

HSP 1 Score: 217.238 bits (552), Expect = 7.016e-63
Identity = 176/567 (31.04%), Postives = 288/567 (50.79%), Query Frame = 1
Query:  259 HEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTAT-ESSNTACGRRGLTGTILIHKIAGAMAEKNLN------LKEIKEFVNNILKPGIMGTVGISFSG-SVLSRKDASGLNLSDDMYELGLGIHGEAG--IVRKKFETAELVMKEMINHLTSAKLES---VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKV----------FDD--SILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMN-----DFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIE----NPEAIWCDIFMDSVQV----ISEVGGAKEGDRTMLDVIFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAIN 1845
            HEP HAGF+GK MLS AV+G IFASP    IL AI ++ N+N  GVLLIVKNYTGD ++F ++AERAR LGIN  + V+G+D A         GRR L GT+L+HKI GA AE+  +        ++ + +N+ L      T+G S     V  RK  S LN  +   ELG+GIH E G  ++     T +L+ K M+  L     +    VK  + D+VV+++NNLG  ++  +  + +   ++L++N++++  +   G  +TS    G S+T+L            F++  S+L+ L+    APGW                   + D +     + + +L H+E++       DF K    + + ++++I  E ++ ELD ++GDGDCG T   G   + +     + + SK  +S  ++ +S  IE  MGG+SGGL S+     S   I+      E +  +I   S+ +    + +   A++G  TM+D + P ++ +  S    F   +      +++ +  T   + K GRASYV ++   ++  DPGA  +   +K + 
Sbjct:   54 HEPTHAGFIGKGMLSGAVVGEIFASPSTKQILNAI-RLVNENASGVLLIVKNYTGDVLHFGLSAERARALGINCRVAVIGDDVAVGREKGGMVGRRALAGTVLVHKIVGAFAEEYSSKYGLDGTAKVAKIINDNLV-----TIGSSLDHCKVPGRKFESELN--EKQMELGMGIHNEPGVKVLDPIPSTEDLISKYMLPKLLDPNDKDRAFVKFDEDDEVVLLVNNLGGVSNFVISSITSKTTDFLKENYNITPVQTIAGTLMTSFNGNGFSITLLNATKATKALQSDFEEIKSVLDLLNAFTNAPGW------------------PIADFEKTSAPSVNDDLLHNEVTAKAVGTYDFDKFAEWMKSGAEQVIKSEPHITELDNQVGDGDCGYTLVAGVKGITEN----LDKLSKDSLSQAVAQISDFIEGSMGGTSGGLYSILLSGFSHGLIQVCKSKDEPVTKEIVAKSLGIALDTLYKYTKARKGSSTMIDALEPFVKEFTASKD--FNKAV----KAAEEGAKSTATFEAKFGRASYVGDS---SQVEDPGAVGLCEFLKGVQ 581          
BLAST of triokinase/FMN cyclase vs. Ensembl Yeast
Match: DAK2 (Dihydroxyacetone kinase; required for detoxification of dihydroxyacetone (DHA); involved in stress adaptation [Source:SGD;Acc:S000001841])

HSP 1 Score: 189.504 bits (480), Expect = 7.928e-53
Identity = 161/542 (29.70%), Postives = 268/542 (49.45%), Query Frame = 1
Query:  259 HEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTAT-ESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELV-MKEMINHLTSAKLES------VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTIL---KVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLS--NLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPEA-IWCDIFMDSVQV----ISEVGGAKEGDRTMLDVIFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTK------YPDPGA 1812
            HEP HAGFVG+  L A   G IFASP    I  AI  +  ++  G L+IVKNYTGD I+F +AAERA+  G+ VE+V VG+D +  +   +  GRRGL  T+L+HKIAGA A   L L E+ E   +++   +  T+  S     +       + L ++ YE+G+GIH E+G     ++++ L  + E+++ +    L+       VK    + VV+++NN+G  +++EL   A  I E L   + +   R   G ++T+L   G  +T++   K   D IL+Y D+P TA GW + +Y+ +   ++    +      +  +R      E       D+     ++LA   ++   E  +   D   GDGDCGTT   G  A+++     +  ++ +     L   +++Y++E+ MGG+SGGL S++  +L+    ++ +  +  + F  +  V    + +   A+ G RT++D + P +   K                 +   ++ T KM    GRASYV    +L K       PDPGA
Sbjct:   61 HEPTHAGFVGEGALDAIAAGAIFASPSTKQIYSAIKAV--ESPKGTLIIVKNYTGDIIHFGLAAERAKAAGMKVELVAVGDDVSVGKKKGSLVGRRGLGATVLVHKIAGAAASHGLELAEVAEVAQSVVDNSV--TIAASLDHCTVPGHKPEAI-LGENEYEIGMGIHNESGT----YKSSPLPSISELVSQMLPLLLDEDEDRSYVKFEPKEDVVLMVNNMGGMSNLELGYAAEVISEQLIDKYQIVPKRTITGAFITALNGPGFGITLMNASKAGGD-ILKYFDYPTTASGW-NQMYHSAKDWEVLAKGQVPTAPSLKTLRN-----EKGSGVKADYDTFAKILLAGIAKINEVEPKVTWYDTIAGDGDCGTTLVSGGEALEE----AIKNHTLRLEDAALGIEDIAYMVEDSMGGTSGGLYSIYLSALAQGVRDSGDKELTAETFKKASNVALDALYKYTRARPGYRTLIDALQPFVEALKAGKGPRAAAQ------AAYDGAEKTRKMDALVGRASYVAKE-ELRKLDSEGGLPDPGA 575          
BLAST of triokinase/FMN cyclase vs. Ensembl Nematostella
Match: EDO48638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ92])

HSP 1 Score: 105.145 bits (261), Expect = 2.438e-26
Identity = 62/164 (37.80%), Postives = 107/164 (65.24%), Query Frame = 1
Query:  571 KIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVK---LIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKV 1053
            +IAGA+AE+  +L+EI     + ++   MG++G+S +   +     S   L++D  ELGLGIHGE G+ R K   A+ V+K +I+H+T+   ++     L +GD + +VINNLG T+++EL ++A + I+YL ++  VSV R   G+ +TSL+M G+++T+L++
Sbjct:    8 QIAGALAEEGKSLEEITVTAKSAVQS--MGSMGVSLTPCSIPGFPPS-FTLANDEMELGLGIHGEPGVRRMKISNADDVVKTVIDHMTNVDTDAATKLLLKQGDHIALVINNLGGTSNLELNIVARAAIKYLVQSKGVSVDRVLMGSLMTSLEMAGVTLTLLQL 168          
BLAST of triokinase/FMN cyclase vs. Ensembl Medaka
Match: tkfc (triokinase and FMN cyclase [Source:NCBI gene;Acc:101174800])

HSP 1 Score: 290.426 bits (742), Expect = 1.544e-89
Identity = 210/549 (38.25%), Postives = 309/549 (56.28%), Query Frame = 1
Query:  214 NLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLES-VKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLSNLSYIIENQMXXXXXXXXXXXXXXXXTKYIENPE--AIWCDIFMDSVQVISEVGGAKEGDRTMLDVIFPV---LRCWKNSHQETFEMVIPELADISQKSSDLTMKMKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAI 1842
            +L+ KV L+SGGGSGHEP H G++G  MLSAAV G +FASPP  +IL AI  + N    GVLL+VKNYTGDR+NF +AAE+AR  G+ V++V+V +D A +  + A GRRGL GT+ IHK+AGA+AE+  +L+ I   V   LK GI GT+G+S S   +     S   L     ELGLGIHGE GI R K  +A+ V++ M++H+T+   +S + L  GD VV+ +NNLG+ + +E+ ++  + I  LE    V V R   G+++TSL+M G+S+++++  D  +L   D   +AP W     N+SS     + +  + +  +   R          LS    + L  +  A    L+ ++  LN LD+  GDGDCGTT  + A A +++  G +          LLS LS ++E +MGGSSG L SLF  + +    +     A W        Q +   GGA  GDRTMLD + PV   L     +     + V+      +   ++ T  M  +AGRASY+  + ++T  PDPGA A+  I++A+
Sbjct:   45 SLRGKVALVSGGGSGHEPAHGGYIGAGMLSAAVAGAVFASPPPASILAAILCMHNAGASGVLLVVKNYTGDRLNFGLAAEQARNQGVAVDMVIVADDCAFDLPSKA-GRRGLCGTVFIHKLAGALAEEGCSLEHIVSRVREALK-GI-GTLGVSLSPCSVPGCLPS-FQLPPGDMELGLGIHGEPGIKRSKVASADQVVETMLDHMTNPNSQSHLPLKAGDSVVLCVNNLGALSCLEMAVVTRAAIGCLESR-GVLVARAMSGSFMTSLEMAGVSLSLMRA-DGELLRLFDADTSAPAW----PNLSSACV--SGRGYITEPPVMQTRPQDDTQVEGPLSPLMRRALEKVCSA----LLEKQEELNSLDRASGDGDCGTTHAQAARAAQEWLQGHVVPGCPGR---LLSVLSGLVEEKMGGSSGALYSLFLTAAAGHVTQGQSDAAAWARAVHAGTQAMRRYGGADPGDRTMLDALCPVAEELMKLTTASPGGQKAVLRSAVQKASLGAEATRHMTARAGRASYIAAD-RVT-LPDPGAVAVTAILRAV 572          
BLAST of triokinase/FMN cyclase vs. Planmine SMEST
Match: SMESG000008453.1 (SMESG000008453.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 258/267 (96.63%), Postives = 261/267 (97.75%), Query Frame = 1
Query:  586 MAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYF 1386
            MAEKNLNLKEIKEFVN ILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDIN IRT SSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGAT + + +
Sbjct:    1 MAEKNLNLKEIKEFVNTILKPGIMGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINPIRTGSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATGLVQLY 267          
BLAST of triokinase/FMN cyclase vs. Planmine SMEST
Match: SMESG000008453.1 (SMESG000008453.1)

HSP 1 Score: 481.1 bits (1237), Expect = 2.013e-168
Identity = 236/244 (96.72%), Postives = 239/244 (97.95%), Query Frame = 1
Query:  655 MGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATAVKKYF 1386
            MGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDIN IRT SSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGAT + + +
Sbjct:    1 MGTVGISFSGSVLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTSAKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCRGYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSKTKLENMKKAVFDLDINPIRTGSSNLEHDELSMNDFQKLTALVLAASDELINQENYLNELDKEIGDGDCGTTFKRGATGLVQLY 244          
BLAST of triokinase/FMN cyclase vs. Planmine SMEST
Match: SMESG000008455.1 (SMESG000008455.1)

HSP 1 Score: 271.552 bits (693), Expect = 1.631e-86
Identity = 161/163 (98.77%), Postives = 161/163 (98.77%), Query Frame = 1
Query:   88 MNIHLIDNNDNAILQYAKTFSMFNSNVXXXXXXXXXXXXXXXNLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKI 576
            MNIHLIDNNDNAILQYAKTFSMFNSNVIQIIDRPIIIRKDIDNLKNKVVLLSGGGSGHEPGHAGFVGK MLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHK 
Sbjct:    1 MNIHLIDNNDNAILQYAKTFSMFNSNVIQIIDRPIIIRKDIDNLKNKVVLLSGGGSGHEPGHAGFVGKGMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKF 163          
BLAST of triokinase/FMN cyclase vs. Planmine SMEST
Match: SMESG000008455.1 (SMESG000008455.1)

HSP 1 Score: 272.322 bits (695), Expect = 6.687e-85
Identity = 161/163 (98.77%), Postives = 161/163 (98.77%), Query Frame = 1
Query:   88 MNIHLIDNNDNAILQYAKTFSMFNSNVXXXXXXXXXXXXXXXNLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKI 576
            MNIHLIDNNDNAILQYAKTFSMFNSNVIQIIDRPIIIRKDIDNLKNKVVLLSGGGSGHEPGHAGFVGK MLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHK 
Sbjct:    1 MNIHLIDNNDNAILQYAKTFSMFNSNVIQIIDRPIIIRKDIDNLKNKVVLLSGGGSGHEPGHAGFVGKGMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKF 163          
BLAST of triokinase/FMN cyclase vs. Planmine SMEST
Match: SMESG000008455.1 (SMESG000008455.1)

HSP 1 Score: 228.794 bits (582), Expect = 1.823e-70
Identity = 140/142 (98.59%), Postives = 140/142 (98.59%), Query Frame = 1
Query:  151 MFNSNVXXXXXXXXXXXXXXXNLKNKVVXXXXXXXXHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKI 576
            MFNSNVIQIIDRPIIIRKDIDNLKNKVVLLSGGGSGHEPGHAGFVGK MLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHK 
Sbjct:    1 MFNSNVIQIIDRPIIIRKDIDNLKNKVVLLSGGGSGHEPGHAGFVGKGMLSAAVLGGIFASPPANAILEAIFQIGNDNKCGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACGRRGLTGTILIHKF 142          
The following BLAST results are available for this feature:
BLAST of triokinase/FMN cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TKFC7.430e-8937.22triokinase and FMN cyclase [Source:HGNC Symbol;Acc... [more]
TKFC1.013e-8237.47triokinase and FMN cyclase [Source:HGNC Symbol;Acc... [more]
TKFC1.201e-3157.50triokinase and FMN cyclase [Source:HGNC Symbol;Acc... [more]
TKFC2.993e-626.43triokinase and FMN cyclase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
W02H5.81.069e-8636.20pep chromosome:WBcel235:V:2647037:2652712:-1 gene:... [more]
W02H5.81.069e-8636.20pep chromosome:WBcel235:V:2647037:2652657:-1 gene:... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tkfc2.066e-9538.70triokinase/FMN cyclase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TKFC9.024e-9337.79triokinase/FMN cyclase [Source:NCBI gene;Acc:77958... [more]
TKFC9.949e-8836.78triokinase/FMN cyclase [Source:NCBI gene;Acc:77958... [more]
TKFC1.068e-8135.62triokinase/FMN cyclase [Source:NCBI gene;Acc:77958... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tkfc3.504e-8535.95triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI... [more]
Tkfc3.504e-8535.95triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI... [more]
Tkfc3.504e-8535.95triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI... [more]
Tkfc1.423e-7836.34triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI... [more]
Tkfc1.001e-3856.12triokinase, FMN cyclase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of triokinase/FMN cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3LXA3|TKFC_HUMAN3.568e-8837.22Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=... [more]
sp|F1RKQ4|TKFC_PIG1.239e-8635.69Triokinase/FMN cyclase OS=Sus scrofa OX=9823 GN=TK... [more]
sp|Q58DK4|TKFC_BOVIN7.875e-8537.04Triokinase/FMN cyclase OS=Bos taurus OX=9913 GN=TK... [more]
sp|Q8VC30|TKFC_MOUSE2.451e-8435.95Triokinase/FMN cyclase OS=Mus musculus OX=10090 GN... [more]
sp|O04059|DHBK_SOLLC9.145e-8235.98Putative 3,4-dihydroxy-2-butanone kinase OS=Solanu... [more]
back to top
BLAST of triokinase/FMN cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IBP54.635e-10641.88triokinase/FMN cyclase OS=Lingula unguis OX=7574 G... [more]
A0A3M6THH31.361e-10440.66Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2R2MMQ21.498e-10441.88triokinase/FMN cyclase-like isoform X1 OS=Lingula ... [more]
A0A2B4T0J01.623e-10241.73Bifunctional ATP-dependent dihydroxyacetone kinase... [more]
C3ZQZ92.584e-10039.89Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tkfc6.429e-9238.29triokinase and FMN cyclase [Source:NCBI gene;Acc:1... [more]
tkfc2.057e-8136.55triokinase and FMN cyclase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tkfc7.892e-6532.63triokinase/FMN cyclase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DAK17.016e-6331.04Dihydroxyacetone kinase; required for detoxificati... [more]
DAK27.928e-5329.70Dihydroxyacetone kinase; required for detoxificati... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO486382.438e-2637.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tkfc1.544e-8938.25triokinase and FMN cyclase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of triokinase/FMN cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008453.10.000e+096.63SMESG000008453.1[more]
SMESG000008453.12.013e-16896.72SMESG000008453.1[more]
SMESG000008455.11.631e-8698.77SMESG000008455.1[more]
SMESG000008455.16.687e-8598.77SMESG000008455.1[more]
SMESG000008455.11.823e-7098.59SMESG000008455.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017402 ID=SMED30017402|Name=triokinase/FMN cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=1941bp
TTTAAATGAATTTATTCATTCTGTTAATATAAGTTATTACTGTCAAATTG
CTATTCTTTTACGTTTGATTTTAATAATTCCCGGACAATGAATATCCATT
TAATTGATAATAATGATAATGCAATTCTTCAATATGCTAAAACTTTTTCT
ATGTTTAACTCCAATGTTATTCAAATTATTGATAGACCAATAATAATTCG
TAAAGATATTGACAACCTTAAAAATAAAGTTGTATTGCTTAGTGGTGGGG
GAAGTGGGCATGAACCAGGGCACGCTGGATTCGTTGGAAAAGCAATGCTC
TCGGCGGCAGTGTTAGGAGGAATATTTGCTTCACCGCCAGCAAATGCTAT
TTTAGAAGCTATTTTTCAAATTGGAAATGATAATAAATGTGGCGTCTTAT
TAATCGTTAAAAACTATACAGGAGATCGTATTAATTTTAACATAGCAGCT
GAACGTGCTAGAAAATTGGGTATTAATGTCGAAATTGTTGTTGTTGGTGA
AGATACAGCAACAGAATCGTCGAATACCGCGTGTGGAAGAAGGGGCCTAA
CTGGAACTATATTAATTCATAAAATAGCAGGAGCTATGGCAGAAAAAAAC
TTGAATTTAAAAGAAATAAAAGAATTTGTAAATAATATTTTGAAACCAGG
CATAATGGGCACTGTGGGTATTAGTTTTAGTGGAAGTGTACTATCAAGAA
AAGATGCCAGTGGTTTGAACTTATCAGATGATATGTATGAATTGGGGTTG
GGAATACATGGAGAAGCAGGAATCGTTAGAAAAAAGTTTGAAACTGCTGA
ATTAGTAATGAAAGAAATGATAAATCATCTTACAAGTGCAAAATTAGAGA
GTGTAAAATTGATTAAAGGTGACAAAGTAGTCGTTGTTATTAATAACTTA
GGTTCCACCACACATATAGAGCTCATTTTAATGGCAAATTCCATTATTGA
ATATCTTGAAAAAAATTTTCACGTTTCCGTATGTAGAGGATATTGTGGGA
ATTACTTGACATCATTACAGATGTATGGTATCTCAGTGACTATTTTGAAG
GTTTTTGATGATTCAATTTTAGAATATCTAGATTTCCCTTGTACGGCTCC
TGGTTGGATTGATACTGTGTATAATATTTCTTCTAAAACTAAACTTGAAA
ACATGAAAAAAGCAGTTTTTGACTTGGATATAAATCTCATCCGTACAAGT
AGCTCGAATTTGGAGCATGATGAATTATCCATGAATGATTTTCAAAAATT
AACGGCCTTGGTTTTAGCTGCATCTGATGAGTTAATAAATCAGGAAAATT
ACTTGAATGAATTAGATAAAGAAATTGGAGATGGAGATTGTGGCACAACT
TTTAAAAGAGGAGCAACAGCTGTTAAGAAATATTTTATTGGATGTATGTC
GGAAAATTCTAAAAAATATATCTCGGTTCTTCTATCTAATTTGTCTTACA
TTATTGAAAATCAAATGGGCGGATCATCTGGAGGATTATTGAGCTTATTT
TTTGAATCTTTATCAACGAAATATATTGAAAATCCTGAAGCTATTTGGTG
TGATATTTTTATGGATTCTGTACAAGTAATCAGTGAAGTCGGTGGTGCTA
AAGAAGGAGATAGAACCATGTTGGATGTTATTTTTCCTGTATTAAGGTGT
TGGAAAAATAGTCATCAAGAAACCTTTGAAATGGTTATTCCAGAACTTGC
AGATATTTCACAAAAGTCCTCAGATTTGACAATGAAAATGAAACCTAAAG
CTGGGCGAGCAAGTTATGTCAAAAACAACATAAAATTGACAAAATATCCT
GACCCTGGAGCGGAGGCCATTAATATTATTGTAAAAGCTATTAATATGAA
GAAATAAAGTTTTAAGTTGCATGGTTACAAATATTTGTAAGTGTTTGTGC
ACTCCGCGATTTGATTTGAGTTTTAAATATATTTTTTTGTT
back to top

protein sequence of SMED30017402-orf-1

>SMED30017402-orf-1 ID=SMED30017402-orf-1|Name=SMED30017402-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
MNIHLIDNNDNAILQYAKTFSMFNSNVIQIIDRPIIIRKDIDNLKNKVVL
LSGGGSGHEPGHAGFVGKAMLSAAVLGGIFASPPANAILEAIFQIGNDNK
CGVLLIVKNYTGDRINFNIAAERARKLGINVEIVVVGEDTATESSNTACG
RRGLTGTILIHKIAGAMAEKNLNLKEIKEFVNNILKPGIMGTVGISFSGS
VLSRKDASGLNLSDDMYELGLGIHGEAGIVRKKFETAELVMKEMINHLTS
AKLESVKLIKGDKVVVVINNLGSTTHIELILMANSIIEYLEKNFHVSVCR
GYCGNYLTSLQMYGISVTILKVFDDSILEYLDFPCTAPGWIDTVYNISSK
TKLENMKKAVFDLDINLIRTSSSNLEHDELSMNDFQKLTALVLAASDELI
NQENYLNELDKEIGDGDCGTTFKRGATAVKKYFIGCMSENSKKYISVLLS
NLSYIIENQMGGSSGGLLSLFFESLSTKYIENPEAIWCDIFMDSVQVISE
VGGAKEGDRTMLDVIFPVLRCWKNSHQETFEMVIPELADISQKSSDLTMK
MKPKAGRASYVKNNIKLTKYPDPGAEAINIIVKAINMKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036117DhaL_dom_sf
IPR004007DhaL_dom
IPR004006DhaK_dom
Vocabulary: biological process
TermDefinition
GO:0006071glycerol metabolic process
GO:0016310phosphorylation
GO:0019563glycerol catabolic process
GO:0019588anaerobic glycerol catabolic process
GO:0097237cellular response to toxic substance
Vocabulary: molecular function
TermDefinition
GO:0004371glycerone kinase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0050354triokinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004007DhaL domainSMARTSM01120Dak2_2coord: 412..587
e-value: 8.2E-25
score: 98.4
IPR004007DhaL domainPFAMPF02734Dak2coord: 413..585
e-value: 7.1E-36
score: 123.7
IPR004007DhaL domainPROSITEPS51480DHALcoord: 386..587
score: 23.892
NoneNo IPR availableGENE3DG3DSA:3.30.1180.20coord: 190..347
e-value: 7.9E-41
score: 140.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.10440coord: 16..186
e-value: 3.8E-60
score: 204.1
NoneNo IPR availablePANTHERPTHR28629FAMILY NOT NAMEDcoord: 5..586
NoneNo IPR availablePANTHERPTHR28629:SF4TRIOKINASE/FMN CYCLASEcoord: 5..586
NoneNo IPR availableSUPERFAMILYSSF82549DAK1/DegV-likecoord: 16..340
IPR036117DhaL domain superfamilyGENE3DG3DSA:1.25.40.340coord: 382..589
e-value: 5.3E-48
score: 165.1
IPR036117DhaL domain superfamilySUPERFAMILYSSF101473DhaL-likecoord: 381..585
IPR004006DhaK domainPFAMPF02733Dak1coord: 24..338
e-value: 1.1E-97
score: 326.7
IPR004006DhaK domainPROSITEPS51481DHAKcoord: 8..340
score: 104.728