Transmembrane protein 81

Overview
NameTransmembrane protein 81
Smed IDSMED30017399
Length (bp)3124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 81 (SMED30017399) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 81 (SMED30017399) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 81 (SMED30017399) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 81 (SMED30017399) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017399

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017399SMESG000026648.1 SmedASXL_015570SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017399SMESG000026648.1 dd_Smed_v6_10248_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30017399SMESG000026648.1 OX_Smed_1.0.12810ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30017399SMESG000026648.1 Contig39605newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017399SMESG000026648.1 Contig39605uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
dorsal midlineSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017399SMESG000026648.1 dd_Smed_v4_10248_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 81 vs. Ensembl Human
Match: LMNTD1 (lamin tail domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26683])

HSP 1 Score: 81.6481 bits (200), Expect = 4.138e-16
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1793 LGQSPDYFDSMFKNPDKKDESKSMNTNDT--------------NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +G   DYF S+F +  KK  + S  T  T                +SL  +++ E+N  G +V++ NSS   +  IG ++++QN  G  +S++RF   +   A  T+T+W+ +++   HQPP+DF   +   + +S +  TILC  +GQA++W +  H
Sbjct:    2 IGDGEDYFLSLFGD-SKKLTAHSNYTQKTLKYFSMILEEVGQFTSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAASEA-KHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIH 157          
BLAST of Transmembrane protein 81 vs. Ensembl Human
Match: LMNTD1 (lamin tail domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26683])

HSP 1 Score: 82.0333 bits (201), Expect = 5.589e-16
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1793 LGQSPDYFDSMFKNPDKKDESKSMNTNDT--------------NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +G   DYF S+F +  KK  + S  T  T                +SL  +++ E+N  G +V++ NSS   +  IG ++++QN  G  +S++RF   +   A  T+T+W+ +++   HQPP+DF   +   + +S +  TILC  +GQA++W +  H
Sbjct:   36 IGDGEDYFLSLFGD-SKKLTAHSNYTQKTLKYFSMILEEVGQFTSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAASEA-KHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIH 191          
BLAST of Transmembrane protein 81 vs. Ensembl Human
Match: LMNTD1 (lamin tail domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26683])

HSP 1 Score: 82.4185 bits (202), Expect = 9.782e-16
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1793 LGQSPDYFDSMFKNPDKKDESKSMNTNDT--------------NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +G   DYF S+F +  KK  + S  T  T                +SL  +++ E+N  G +V++ NSS   +  IG ++++QN  G  +S++RF   +   A  T+T+W+ +++   HQPP+DF   +   + +S +  TILC  +GQA++W +  H
Sbjct:  120 IGDGEDYFLSLFGD-SKKLTAHSNYTQKTLKYFSMILEEVGQFTSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAASEA-KHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIH 275          
BLAST of Transmembrane protein 81 vs. Ensembl Human
Match: LMNTD1 (lamin tail domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26683])

HSP 1 Score: 81.6481 bits (200), Expect = 1.492e-15
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1793 LGQSPDYFDSMFKNPDKKDESKSMNTNDT--------------NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +G   DYF S+F +  KK  + S  T  T                +SL  +++ E+N  G +V++ NSS   +  IG ++++QN  G  +S++RF   +   A  T+T+W+ +++   HQPP+DF   +   + +S +  TILC  +GQA++W +  H
Sbjct:   99 IGDGEDYFLSLFGD-SKKLTAHSNYTQKTLKYFSMILEEVGQFTSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAASEA-KHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIH 254          
BLAST of Transmembrane protein 81 vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 80.1073 bits (196), Expect = 1.264e-14
Identity = 101/388 (26.03%), Postives = 185/388 (47.68%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISA---GEQEIISLNLMIKQ-MRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFYS----------ERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I +S  ++  E+  +KA+YE+++   + TLD +  ++  L+ EL   +     L  R    T K   L+   + L+ D+ A    ++  +S  L  K+ +  E  D+     KL   L E  AK    +E LR  D EN++  MK++++FQ + +SE+  E K + E  L        +ID  K R  ES+  D L ++R    ++ + +K E ++ YS          ER   L G    E+ +S    D+   L+ +L  ++K    KEA+L    + L R  + + + L++ +RE   +   +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   30 QEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKAR---NTKKEGDLIAAQARLK-DLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGE--AKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRL-------VEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS---LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKL------------ALDMEIHAYRKLLEGEEERLRL 389          

HSP 2 Score: 68.5514 bits (166), Expect = 4.502e-11
Identity = 32/100 (32.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQA 2200
            + V E++++GK+VR+ N S++ D  +G + IK+     P+  +RFP +    A   +TIW+       H PPTD        WG      T L NS+G+ 
Sbjct:  440 VAVEEVDEEGKFVRLRNKSNE-DQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGA-THSPPTDLVWKAQNTWGCGNSLRTALINSTGEG 537          
BLAST of Transmembrane protein 81 vs. Ensembl Celegans
Match: lmn-1 (Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443])

HSP 1 Score: 51.6026 bits (122), Expect = 2.770e-6
Identity = 32/121 (26.45%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1880 NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDP 2242
            N+ ++ P+ + E++++GK+VR+ N+S++ +  IGGY +   + G+  + F+F  R+K     + T+WS ++   +H PP + +  +   W      +  L +S G  +S I+     + DP
Sbjct:  440 NKETVGPVGIDEVDEEGKWVRVANNSEE-EQSIGGYKLV-VKAGNKEASFQFSSRMKLAPHASATVWS-ADAGAVHHPP-EVYVMKKQQWPIGDNPSARLEDSEGDTVSSITVEFSESSDP 556          
BLAST of Transmembrane protein 81 vs. Ensembl Celegans
Match: lmn-1 (Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443])

HSP 1 Score: 51.6026 bits (122), Expect = 2.770e-6
Identity = 32/121 (26.45%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1880 NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDP 2242
            N+ ++ P+ + E++++GK+VR+ N+S++ +  IGGY +   + G+  + F+F  R+K     + T+WS ++   +H PP + +  +   W      +  L +S G  +S I+     + DP
Sbjct:  440 NKETVGPVGIDEVDEEGKWVRVANNSEE-EQSIGGYKLV-VKAGNKEASFQFSSRMKLAPHASATVWS-ADAGAVHHPP-EVYVMKKQQWPIGDNPSARLEDSEGDTVSSITVEFSESSDP 556          
BLAST of Transmembrane protein 81 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 55.8398 bits (133), Expect = 2.100e-7
Identity = 34/112 (30.36%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQ--NRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRI 2230
            +++ EI+ +GK+VR++N   +  A IGG+ +++  N  G P + ++F   V+      IT+WS       H+PP+     +   W S+    TIL NS G+A++ +    RI
Sbjct:  473 VEIKEIDPEGKFVRLFNKGSEEVA-IGGWQLQRLINEKG-PSTTYKFHRSVRIEPNGVITVWSADTKAS-HEPPSSLV-MKSQKWVSADNTRTILLNSEGEAVANLDRIKRI 580          
BLAST of Transmembrane protein 81 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 55.8398 bits (133), Expect = 2.100e-7
Identity = 34/112 (30.36%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQ--NRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRI 2230
            +++ EI+ +GK+VR++N   +  A IGG+ +++  N  G P + ++F   V+      IT+WS       H+PP+     +   W S+    TIL NS G+A++ +    RI
Sbjct:  473 VEIKEIDPEGKFVRLFNKGSEEVA-IGGWQLQRLINEKG-PSTTYKFHRSVRIEPNGVITVWSADTKAS-HEPPSSLV-MKSQKWVSADNTRTILLNSEGEAVANLDRIKRI 580          
BLAST of Transmembrane protein 81 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 55.8398 bits (133), Expect = 2.100e-7
Identity = 34/112 (30.36%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQ--NRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRI 2230
            +++ EI+ +GK+VR++N   +  A IGG+ +++  N  G P + ++F   V+      IT+WS       H+PP+     +   W S+    TIL NS G+A++ +    RI
Sbjct:  473 VEIKEIDPEGKFVRLFNKGSEEVA-IGGWQLQRLINEKG-PSTTYKFHRSVRIEPNGVITVWSADTKAS-HEPPSSLV-MKSQKWVSADNTRTILLNSEGEAVANLDRIKRI 580          
BLAST of Transmembrane protein 81 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0079100)

HSP 1 Score: 55.8398 bits (133), Expect = 2.100e-7
Identity = 34/112 (30.36%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQ--NRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRI 2230
            +++ EI+ +GK+VR++N   +  A IGG+ +++  N  G P + ++F   V+      IT+WS       H+PP+     +   W S+    TIL NS G+A++ +    RI
Sbjct:  473 VEIKEIDPEGKFVRLFNKGSEEVA-IGGWQLQRLINEKG-PSTTYKFHRSVRIEPNGVITVWSADTKAS-HEPPSSLV-MKSQKWVSADNTRTILLNSEGEAVANLDRIKRI 580          
BLAST of Transmembrane protein 81 vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 87.4261 bits (215), Expect = 4.048e-17
Identity = 95/384 (24.74%), Postives = 188/384 (48.96%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL+++N R   Y+  VR L+ E+  L + I +S T +  EL  +KA+YE+++   + TLD +  ++  L+ EL   + +   L  R   + +     L  L  L S +++ +  + +     + + +E  D+++   KL  +L  ++AK    +E LR  D EN+I  +K+++EFQ + +SE+  E K + E  +        +ID  + +  ES+  D L  +R    E+ + +K E ++ Y          +ER  +L G    E+    Q +   E ++ +L  ++K    +EA++    E L+R  +I  + L D ++E   + Q +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   27 QEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKRTLEVEVRDLKAQLAKLEGSL--NDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRV-------VEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEEL---QQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKL------------ALDMEISAYRKLLEGEEERLRL 386          

HSP 2 Score: 66.2402 bits (160), Expect = 1.529e-10
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 2
Query: 1907 VLEINKDGKYVRIWNSSDKYDAEIGGYMIK-QNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            V E++ +GK+VR+ N SD+ D  +G + +K Q   G P+ V++FP +    A  T+TIW+       H PP+D        WGS   F T L +SSG+ ++
Sbjct:  460 VDEVDLEGKFVRLNNKSDQ-DQSLGHWQVKRQIGSGTPI-VYKFPPKFNLKAGQTVTIWAAGAGGT-HSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Transmembrane protein 81 vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 87.4261 bits (215), Expect = 4.048e-17
Identity = 95/384 (24.74%), Postives = 188/384 (48.96%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL+++N R   Y+  VR L+ E+  L + I +S T +  EL  +KA+YE+++   + TLD +  ++  L+ EL   + +   L  R   + +     L  L  L S +++ +  + +     + + +E  D+++   KL  +L  ++AK    +E LR  D EN+I  +K+++EFQ + +SE+  E K + E  +        +ID  + +  ES+  D L  +R    E+ + +K E ++ Y          +ER  +L G    E+    Q +   E ++ +L  ++K    +EA++    E L+R  +I  + L D ++E   + Q +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   27 QEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKRTLEVEVRDLKAQLAKLEGSL--NDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRV-------VEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEEL---QQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKL------------ALDMEISAYRKLLEGEEERLRL 386          

HSP 2 Score: 66.2402 bits (160), Expect = 1.529e-10
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 2
Query: 1907 VLEINKDGKYVRIWNSSDKYDAEIGGYMIK-QNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            V E++ +GK+VR+ N SD+ D  +G + +K Q   G P+ V++FP +    A  T+TIW+       H PP+D        WGS   F T L +SSG+ ++
Sbjct:  460 VDEVDLEGKFVRLNNKSDQ-DQSLGHWQVKRQIGSGTPI-VYKFPPKFNLKAGQTVTIWAAGAGGT-HSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Transmembrane protein 81 vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 87.4261 bits (215), Expect = 4.048e-17
Identity = 95/384 (24.74%), Postives = 188/384 (48.96%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL+++N R   Y+  VR L+ E+  L + I +S T +  EL  +KA+YE+++   + TLD +  ++  L+ EL   + +   L  R   + +     L  L  L S +++ +  + +     + + +E  D+++   KL  +L  ++AK    +E LR  D EN+I  +K+++EFQ + +SE+  E K + E  +        +ID  + +  ES+  D L  +R    E+ + +K E ++ Y          +ER  +L G    E+    Q +   E ++ +L  ++K    +EA++    E L+R  +I  + L D ++E   + Q +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   27 QEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKRTLEVEVRDLKAQLAKLEGSL--NDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRV-------VEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEEL---QQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKL------------ALDMEISAYRKLLEGEEERLRL 386          

HSP 2 Score: 66.2402 bits (160), Expect = 1.529e-10
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 2
Query: 1907 VLEINKDGKYVRIWNSSDKYDAEIGGYMIK-QNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            V E++ +GK+VR+ N SD+ D  +G + +K Q   G P+ V++FP +    A  T+TIW+       H PP+D        WGS   F T L +SSG+ ++
Sbjct:  460 VDEVDLEGKFVRLNNKSDQ-DQSLGHWQVKRQIGSGTPI-VYKFPPKFNLKAGQTVTIWAAGAGGT-HSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Transmembrane protein 81 vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 86.2705 bits (212), Expect = 9.292e-17
Identity = 96/384 (25.00%), Postives = 188/384 (48.96%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL+++N R   Y+  VR L+ E+  L + I +S T +  EL  +KA+YE+++   + TLD +  ++  L+ EL   + +   L  R   + +     L  L  L S +++ +  + +     + + +E  D+++   KL  +L  ++AK    +E LR  D EN+I  +K+++EFQ + +SE+  E K + E       S   +ID  + +  ES+  D L  +R    E+ + +K E ++ Y          +ER  +L G    E+    Q +   E ++ +L  ++K    +EA++    E L+R  +I  + L D ++E   + Q +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   27 QEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKRTLEVEVRDLKAQLAKLEGSL--NDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYE-------SRVVEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEEL---QQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKL------------ALDMEISAYRKLLEGEEERLRL 386          

HSP 2 Score: 65.855 bits (159), Expect = 2.324e-10
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 2
Query: 1907 VLEINKDGKYVRIWNSSDKYDAEIGGYMIK-QNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            V E++ +GK+VR+ N SD+ D  +G + +K Q   G P+ V++FP +    A  T+TIW+       H PP+D        WGS   F T L +SSG+ ++
Sbjct:  460 VDEVDLEGKFVRLNNKSDQ-DQSLGHWQVKRQIGSGTPI-VYKFPPKFNLKAGQTVTIWAAGAGGT-HSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Transmembrane protein 81 vs. Ensembl Zebrafish
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 62.003 bits (149), Expect = 3.073e-9
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 1913 EINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQ 2197
            EI+ +GK V + N+SDK D  +G + +K+        V++F  +    A  T+T+WS ++  + H PP+D        WG+     T+L NSSG+
Sbjct:  444 EIDLEGKSVTLRNNSDK-DQSLGSWRLKRQIGDGEEIVYKFSPKFVLKAGQTVTVWS-ADAGMSHSPPSDLLWKSQSSWGTGENILTLLVNSSGE 536          
BLAST of Transmembrane protein 81 vs. Ensembl Xenopus
Match: mlana (melan-A [Source:Xenbase;Acc:XB-GENE-971951])

HSP 1 Score: 76.2554 bits (186), Expect = 9.158e-15
Identity = 37/103 (35.92%), Postives = 62/103 (60.19%), Query Frame = 2
Query: 1898 PLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            PLK++E+N  G +VRIWNSS     ++ GY++ Q    +PVSV+RFP  +  PA   +T+W+ ++  + H PPTD      L + ++ +  T+L   +GQ ++
Sbjct:   12 PLKIVEVNPFGHFVRIWNSSPFCHVDLSGYILWQLEGNYPVSVYRFPQNIFLPACQHVTVWASASK-VSHNPPTDLRWKGRLYFRTNPQCITVLSRPTGQPVA 113          
BLAST of Transmembrane protein 81 vs. Ensembl Xenopus
Match: mlana (melan-A [Source:Xenbase;Acc:XB-GENE-971951])

HSP 1 Score: 75.8702 bits (185), Expect = 1.351e-14
Identity = 37/103 (35.92%), Postives = 62/103 (60.19%), Query Frame = 2
Query: 1898 PLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            PLK++E+N  G +VRIWNSS     ++ GY++ Q    +PVSV+RFP  +  PA   +T+W+ ++  + H PPTD      L + ++ +  T+L   +GQ ++
Sbjct:   21 PLKIVEVNPFGHFVRIWNSSPFCHVDLSGYILWQLEGNYPVSVYRFPQNIFLPACQHVTVWASASK-VSHNPPTDLRWKGRLYFRTNPQCITVLSRPTGQPVA 122          
BLAST of Transmembrane protein 81 vs. Ensembl Xenopus
Match: srp14 (signal recognition particle 14kDa [Source:Xenbase;Acc:XB-GENE-489794])

HSP 1 Score: 62.003 bits (149), Expect = 4.897e-9
Identity = 33/96 (34.38%), Postives = 49/96 (51.04%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNS 2188
            + V E++ +GKYVR+ N S++ D  +G + IK+        V+RFP R+   A  T+TIW+ S     + PPTD        WG+     T L  S
Sbjct:  328 VSVEEVDPEGKYVRLRNKSNE-DQSLGNWQIKRQIGEETPIVYRFPPRLTLKAGQTVTIWA-SGAGATNNPPTDLVWKAQSSWGTGDSIRTALLTS 421          
BLAST of Transmembrane protein 81 vs. Ensembl Xenopus
Match: srp14 (signal recognition particle 14kDa [Source:Xenbase;Acc:XB-GENE-489794])

HSP 1 Score: 61.2326 bits (147), Expect = 5.487e-9
Identity = 33/96 (34.38%), Postives = 49/96 (51.04%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNS 2188
            + V E++ +GKYVR+ N S++ D  +G + IK+        V+RFP R+   A  T+TIW+ S     + PPTD        WG+     T L  S
Sbjct:  328 VSVEEVDPEGKYVRLRNKSNE-DQSLGNWQIKRQIGEETPIVYRFPPRLTLKAGQTVTIWA-SGAGATNNPPTDLVWKAQSSWGTGDSIRTALLTS 421          
BLAST of Transmembrane protein 81 vs. Ensembl Xenopus
Match: srp14 (signal recognition particle 14kDa [Source:Xenbase;Acc:XB-GENE-489794])

HSP 1 Score: 60.8474 bits (146), Expect = 8.079e-9
Identity = 33/96 (34.38%), Postives = 49/96 (51.04%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNS 2188
            + V E++ +GKYVR+ N S++ D  +G + IK+        V+RFP R+   A  T+TIW+ S     + PPTD        WG+     T L  S
Sbjct:  328 VSVEEVDPEGKYVRLRNKSNE-DQSLGNWQIKRQIGEETPIVYRFPPRLTLKAGQTVTIWA-SGAGATNNPPTDLVWKAQSSWGTGDSIRTALLTS 421          
BLAST of Transmembrane protein 81 vs. Ensembl Mouse
Match: Lmntd1 (lamin tail domain containing 1 [Source:MGI Symbol;Acc:MGI:1921321])

HSP 1 Score: 94.3597 bits (233), Expect = 9.299e-21
Identity = 44/113 (38.94%), Postives = 75/113 (66.37%), Query Frame = 2
Query: 1886 TSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +SL  +K+ E+N  G +VR+ NSS++ + EIG ++++QN  GH VS+++FPD +   A  T+T+W+ +++    QPPTDF   +   + SS + TTILC  +G+A++W +  H
Sbjct:   30 SSLGEIKIAEVNIKGLFVRLVNSSNEKEVEIGNHILQQNVNGHAVSLYQFPDNITLQANSTVTVWAAASE-AKPQPPTDFVWEEQSKFRSSPDCTTILCKPNGEAIAWYTPIH 141          
BLAST of Transmembrane protein 81 vs. Ensembl Mouse
Match: Lmntd1 (lamin tail domain containing 1 [Source:MGI Symbol;Acc:MGI:1921321])

HSP 1 Score: 96.2857 bits (238), Expect = 9.789e-21
Identity = 52/157 (33.12%), Postives = 89/157 (56.69%), Query Frame = 2
Query: 1793 LGQSPDYFDSMF--------KNPDKKDESKSMNT-----NDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
             G   DYF S+F          P  ++ S+ ++           +SL  +K+ E+N  G +VR+ NSS++ + EIG ++++QN  GH VS+++FPD +   A  T+T+W+ +++    QPPTDF   +   + SS + TTILC  +G+A++W +  H
Sbjct:   82 FGNGEDYFLSLFGESKKLTAHTPQAENVSEHLSVILEEVGQFTSSSLGEIKIAEVNIKGLFVRLVNSSNEKEVEIGNHILQQNVNGHAVSLYQFPDNITLQANSTVTVWAAASE-AKPQPPTDFVWEEQSKFRSSPDCTTILCKPNGEAIAWYTPIH 237          
BLAST of Transmembrane protein 81 vs. Ensembl Mouse
Match: Lmntd1 (lamin tail domain containing 1 [Source:MGI Symbol;Acc:MGI:1921321])

HSP 1 Score: 96.6709 bits (239), Expect = 1.442e-20
Identity = 52/157 (33.12%), Postives = 89/157 (56.69%), Query Frame = 2
Query: 1793 LGQSPDYFDSMF--------KNPDKKDESKSMNT-----NDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
             G   DYF S+F          P  ++ S+ ++           +SL  +K+ E+N  G +VR+ NSS++ + EIG ++++QN  GH VS+++FPD +   A  T+T+W+ +++    QPPTDF   +   + SS + TTILC  +G+A++W +  H
Sbjct:  132 FGNGEDYFLSLFGESKKLTAHTPQAENVSEHLSVILEEVGQFTSSSLGEIKIAEVNIKGLFVRLVNSSNEKEVEIGNHILQQNVNGHAVSLYQFPDNITLQANSTVTVWAAASE-AKPQPPTDFVWEEQSKFRSSPDCTTILCKPNGEAIAWYTPIH 287          
BLAST of Transmembrane protein 81 vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 77.0258 bits (188), Expect = 8.030e-14
Identity = 101/388 (26.03%), Postives = 185/388 (47.68%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISA---GEQEIISLNLMIKQ-MRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFYS----------ERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I +S  ++  E+  +KA+YE+++   + TLD +  ++  L+ EL   +     L  R    T K   LL   + L+ D+ A    ++  +S  L  K+ +  E  D+     KL   L E  AK    +E LR  D EN++  +K++++FQ + +SE+  E K + E  L        +ID  K R  ES+  D L ++R    ++ + +K E ++ YS          ER   L G    E+ +S    D+   L+ +L  ++K    KEA+L    + L R  + + + L++ +RE   +   +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   30 QEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKAR---NTKKEGDLLAAQARLK-DLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGE--AKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRL-------VEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS---LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKL------------ALDMEIHAYRKLLEGEEERLRL 389          

HSP 2 Score: 70.4774 bits (171), Expect = 8.201e-12
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            + V E++++GK+VR+ N S++ D  +G + I++     P+  +RFP +    A   +TIW+ S     H PPTD        WG  +   T L NS+G+ ++
Sbjct:  440 VAVEEVDEEGKFVRLRNKSNE-DQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWA-SGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVA 539          
BLAST of Transmembrane protein 81 vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 74.3294 bits (181), Expect = 4.281e-13
Identity = 101/388 (26.03%), Postives = 185/388 (47.68%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISA---GEQEIISLNLMIKQ-MRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFYS----------ERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I +S  ++  E+  +KA+YE+++   + TLD +  ++  L+ EL   +     L  R    T K   LL   + L+ D+ A    ++  +S  L  K+ +  E  D+     KL   L E  AK    +E LR  D EN++  +K++++FQ + +SE+  E K + E  L        +ID  K R  ES+  D L ++R    ++ + +K E ++ YS          ER   L G    E+ +S    D+   L+ +L  ++K    KEA+L    + L R  + + + L++ +RE   +   +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   30 QEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKAR---NTKKEGDLLAAQARLK-DLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGE--AKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRL-------VEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS---LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKL------------ALDMEIHAYRKLLEGEEERLRL 389          

HSP 2 Score: 70.8626 bits (172), Expect = 5.955e-12
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            + V E++++GK+VR+ N S++ D  +G + I++     P+  +RFP +    A   +TIW+ S     H PPTD        WG  +   T L NS+G+ ++
Sbjct:  440 VAVEEVDEEGKFVRLRNKSNE-DQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWA-SGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVA 539          
BLAST of Transmembrane protein 81 vs. UniProt/SwissProt
Match: sp|Q9D4C1|LMTD1_MOUSE (Lamin tail domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lmntd1 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.008e-19
Identity = 52/157 (33.12%), Postives = 89/157 (56.69%), Query Frame = 2
Query: 1793 LGQSPDYFDSMF--------KNPDKKDESKSMNT-----NDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
             G   DYF S+F          P  ++ S+ ++           +SL  +K+ E+N  G +VR+ NSS++ + EIG ++++QN  GH VS+++FPD +   A  T+T+W+ +++    QPPTDF   +   + SS + TTILC  +G+A++W +  H
Sbjct:  132 FGNGEDYFLSLFGESKKLTAHTPQAENVSEHLSVILEEVGQFTSSSLGEIKIAEVNIKGLFVRLVNSSNEKEVEIGNHILQQNVNGHAVSLYQFPDNITLQANSTVTVWAAASE-AKPQPPTDFVWEEQSKFRSSPDCTTILCKPNGEAIAWYTPIH 287          
BLAST of Transmembrane protein 81 vs. UniProt/SwissProt
Match: sp|Q4R899|LMTD1_MACFA (Lamin tail domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=LMNTD1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.741e-15
Identity = 48/158 (30.38%), Postives = 86/158 (54.43%), Query Frame = 2
Query: 1793 LGQSPDYFDSMFKNPDKKDESKSMNTNDT--------------NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +G   DYF S+F +  KK  + S +T  T                +SL  +++ E+N  G +V++ NSS   +  IG ++++QN  G  +S++RF   +   A+ T+T+W+ +++   HQPP+DF   +   + +S +  TILC  +GQA++W +  H
Sbjct:  110 IGDGEDYFLSLFGD-SKKLIAHSKHTQKTLKYFSMILEEVGQFTASSLGDIEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQASSTVTVWAAASEA-KHQPPSDFLWKEQDKFRTSPDCITILCKPNGQAIAWYTPIH 265          
BLAST of Transmembrane protein 81 vs. UniProt/SwissProt
Match: sp|Q8N9Z9|LMTD1_HUMAN (Lamin tail domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LMNTD1 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 7.163e-15
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1793 LGQSPDYFDSMFKNPDKKDESKSMNTNDT--------------NETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAH 2224
            +G   DYF S+F +  KK  + S  T  T                +SL  +++ E+N  G +V++ NSS   +  IG ++++QN  G  +S++RF   +   A  T+T+W+ +++   HQPP+DF   +   + +S +  TILC  +GQA++W +  H
Sbjct:   99 IGDGEDYFLSLFGD-SKKLTAHSNYTQKTLKYFSMILEEVGQFTSSSLGDVEIAEVNVKGLFVKLINSSLDKEMAIGDHILQQNVNGQTISLYRFLPNIVMQANSTVTVWAAASEA-KHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIH 254          
BLAST of Transmembrane protein 81 vs. UniProt/SwissProt
Match: sp|P02545|LMNA_HUMAN (Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.174e-13
Identity = 101/388 (26.03%), Postives = 185/388 (47.68%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISA---GEQEIISLNLMIKQ-MRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFYS----------ERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I +S  ++  E+  +KA+YE+++   + TLD +  ++  L+ EL   +     L  R    T K   L+   + L+ D+ A    ++  +S  L  K+ +  E  D+     KL   L E  AK    +E LR  D EN++  MK++++FQ + +SE+  E K + E  L        +ID  K R  ES+  D L ++R    ++ + +K E ++ YS          ER   L G    E+ +S    D+   L+ +L  ++K    KEA+L    + L R  + + + L++ +RE   +   +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   30 QEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKAR---NTKKEGDLIAAQARLK-DLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGE--AKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRL-------VEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS---LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKL------------ALDMEIHAYRKLLEGEEERLRL 389          

HSP 2 Score: 68.5514 bits (166), Expect = 2.073e-10
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            + V E++++GK+VR+ N S++ D  +G + IK+     P+  +RFP +    A   +TIW+       H PPTD        WG      T L NS+G+ ++
Sbjct:  440 VAVEEVDEEGKFVRLRNKSNE-DQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGA-THSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Transmembrane protein 81 vs. UniProt/SwissProt
Match: sp|P48679|LMNA_RAT (Prelamin-A/C OS=Rattus norvegicus OX=10116 GN=Lmna PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.213e-13
Identity = 101/388 (26.03%), Postives = 185/388 (47.68%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISA---GEQEIISLNLMIKQ-MRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFYS----------ERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I +S  ++  E+  +KA+YE+++   + TLD +  ++  L+ EL   +     L  R    T K   LL   + L+ D+ A    ++  +S  L  K+ +  E  D+     KL   L E  AK    +E LR  D EN++  +K++++FQ + +SE+  E K + E  L        +ID  K R  ES+  D L ++R    ++ + +K E ++ YS          ER   L G    E+ +S    D+   L+ +L  ++K    KEA+L    + L R  + + + L++ +RE   +   +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   30 QEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKAR---NTKKEGDLLAAQARLK-DLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGE--AKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRL-------VEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDS---LSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKL------------ALDMEIHAYRKLLEGEEERLRL 389          

HSP 2 Score: 69.707 bits (169), Expect = 9.352e-11
Identity = 32/102 (31.37%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            + V E++++GK+VR+ N S++ D  +G + IK+     P+  +RFP +    A   +TIW+ S     H PPTD        WG      T L N++G+ ++
Sbjct:  440 VAVEEVDEEGKFVRLRNKSNE-DQSMGNWQIKRQNGDDPLMTYRFPPKFTLKAGQVVTIWA-SGAGATHSPPTDLVWKAQNTWGCGTSLRTALINATGEEVA 539          
BLAST of Transmembrane protein 81 vs. TrEMBL
Match: A0A1I8J665 (LTD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010331g1 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.274e-58
Identity = 141/419 (33.65%), Postives = 221/419 (52.74%), Query Frame = 2
Query: 1553 DKNNALVLTTQMSVGPIEPFERP-------VGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKN-PDKKDESKSM-----NTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDP--LLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKL------PELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNN 2746
            D N A   +   +V P E ++ P       VGPV   SS           P  +N  G    +  S  D  +    S  S   S    G+  DYF+ +F++  D+ +E+ +M     +T+    +++  +K+LE+N +GK+VR+ NS++K +AE G + ++QN  GHP++VFRFP   K     T TIW+G N P   LHQPPTDF+  +   + +  E TT++C  SG++++W +  HR + D +   T     K   R+           P L  +      +P  L ++ T        HP      +++HP  +S R  + GNDNSS NRQ+R Q   +PD + G+PY G++ Q ++G+A+VMH Y  +++ S ++ NR P+VI RS +E P+ F KP SRF  G+ QVQSM+N+
Sbjct:  501 DLNEATAASADEAVSPNEGYDEPKTPRDKVVGPVLGGSSKG---------PGVSNAVGPLVGAGASG-DKEATPPRSGSSKRRSARNEGEGRDYFEELFEDIDDRMEEAGAMQPQPQDTSVMQSSAIGDIKILEVNPEGKFVRVLNSNEKTEAEFGNFAVQQNIGGHPIAVFRFPPHTKIKPNSTATIWAGCNPPTEALHQPPTDFYWREYDRFNTGPECTTVVCEPSGRSIAWTTPYHRYSKDAFLIVTPTASQKTSARDPSEDFDGLEGEPRLPQHRTLPREEPATLRREKTMPCYVSSRHPHAQPTCNSVHPRCDSPRTGLWGNDNSSVNRQSRSQMTRVPDRVPGEPYTGSSNQ-VMGSARVMH-YQASLRKSATIGNRAPDVILRSDLERPSPFSKPHSRFDDGMKQVQSMYNS 907          

HSP 2 Score: 210.69 bits (535), Expect = 2.121e-52
Identity = 124/372 (33.33%), Postives = 226/372 (60.75%), Query Frame = 2
Query:   68 DKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENL-----RDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHI---TTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIK 1159
            DK +L D+N+RF  YV  VR+L++E DL    +SI  LE+E+K ++ SYES+I +LK  ++I+  +K ++EK++++RKN E HLNDRL VE  K  + + E+S L+++I   + +I  LN+ + Q + +   ++ + E   R      A++LK + +L     +D  N++  +++K+ FQ+ F  E+  E+K + E YL ++  ++ K + ++ RE+ +PD L ++++TA  + + F+ +T+EFY   I  LQ QLE EI E+ +L+   E LNDK++  R +  EL + I  L ++  +  ++L  ++ ++   I  L+ K+K++Q  +    TE++Q    K   + S+R E++ ++ L+ EEE RL I+
Sbjct:    9 DKEELIDLNERFHFYVRRVRQLRDESDLETFYKSIATLEDEVKEVRKSYESEISKLKYAIEILNREKSEMEKDIIARKNMEAHLNDRLNVEVDKTQRYVTEISQLKNEIVDKDYQIRELNMNLNQAQYDNSGMKKDLETKTR-----LAEDLKRQLDLSKSEYKDTTNRLQIVEEKLSFQESFTEERMGELKRRIETYLMQIAELENKCELSEAREAAFPDQLRQVKETADTDLRKFQRDTEEFYKGSIQTLQEQLEEEIGENKKLQGEVERLNDKIVEYRNQVTELKSQITMLEQQKRVLSQSLESERHQNTYAINGLERKLKEVQQELQAKVTEMNQ----KQDVSASLRAELDAMRALIEEEETRLGIR 371          
BLAST of Transmembrane protein 81 vs. TrEMBL
Match: A0A267GCF0 (LTD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027493g1 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.134e-57
Identity = 140/419 (33.41%), Postives = 221/419 (52.74%), Query Frame = 2
Query: 1553 DKNNALVLTTQMSVGPIEPFERP-------VGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKN-PDKKDESKSM-----NTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDP--LLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKL------PELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNN 2746
            D N A   +   +V P + ++ P       VGPV   SS           P  +N  G    +  S  D  +    S  S   S    G+  DYF+ +F++  D+ +E+ +M     +T+    +++  +K+LE+N +GK+VR+ NS++K +AE G + ++QN  GHP++VFRFP   K     T TIW+G N P   LHQPPTDF+  +   + +  E TT++C  SG++++W +  HR + D +   T     K   R+           P+L  +      +P  L ++ T        HP      +++HP  +S R  + GNDNSS NRQ+R Q   +PD + G+PY G++ Q ++G A+VMH Y  +++ S ++ NR P+VI RS +E P+ F KP SRF  G+ QVQSM+N+
Sbjct:  502 DLNEATAASADEAVSPNDGYDEPKTPRDKVVGPVLGGSSKG---------PGVSNAVGPLVGAGASG-DKEATPPRSGSSKRRSARNEGEGRDYFEELFEDIDDRMEEAGAMQPQPQDTSVMQSSAIGDIKILEVNPEGKFVRVLNSNEKTEAEFGNFAVQQNIGGHPIAVFRFPPHTKIKPNSTATIWAGCNPPTEALHQPPTDFYWREYDRFNTGPECTTVVCEPSGRSIAWTTPYHRYSKDAFLIVTPTASQKTSARDPSEDFDGLEGEPKLPQHRTLPREEPATLRREKTMPCYVSSRHPHAQPTCNSVHPRCDSPRTGLWGNDNSSVNRQSRSQMTRVPDRVPGEPYTGSSNQ-VMGLARVMH-YQASLRKSATIGNRAPDVILRSDLERPSPFSKPHSRFDDGMKQVQSMYNS 908          

HSP 2 Score: 210.69 bits (535), Expect = 2.176e-52
Identity = 124/372 (33.33%), Postives = 226/372 (60.75%), Query Frame = 2
Query:   68 DKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENL-----RDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHI---TTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIK 1159
            DK +L D+N+RF  YV  VR+L++E DL    +SI  LE+E+K ++ SYES+I +LK  ++I+  +K ++EK++++RKN E HLNDRL VE  K  + + E+S L+++I   + +I  LN+ + Q + +   ++ + E   R      A++LK + +L     +D  N++  +++K+ FQ+ F  E+  E+K + E YL ++  ++ K + ++ RE+ +PD L ++++TA  + + F+ +T+EFY   I  LQ QLE EI E+ +L+   E LNDK++  R +  EL + I  L ++  +  ++L  ++ ++   I  L+ K+K++Q  +    TE++Q    K   + S+R E++ ++ L+ EEE RL I+
Sbjct:    9 DKEELIDLNERFHFYVRRVRQLRDESDLETFYKSIATLEDEVKEVRKSYESEISKLKYAIEILNREKSEMEKDIIARKNMEAHLNDRLNVEVDKTQRYVTEISQLKNEIVDKDYQIRELNMNLNQAQYDNSGMKKDLETKTR-----LAEDLKRQLDLSKSEYKDTTNRLQIVEEKLSFQESFTEERMGELKRRIETYLMQIAELENKCELSEAREAAFPDQLRQVKETADADLRKFQRDTEEFYKGSIQTLQEQLEEEIGENKKLQGEVERLNDKIVEYRNQVTELKSQITMLEQQKRVLSQSLESERHQNTYAISGLERKLKEVQQELQAKVTEMNQ----KQDVSASLRAELDAMRALIEEEETRLGIR 371          
BLAST of Transmembrane protein 81 vs. TrEMBL
Match: K1QKB9 (Intermediate filament tail domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10002687 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.274e-56
Identity = 131/352 (37.22%), Postives = 193/352 (54.83%), Query Frame = 2
Query: 1787 SGLGQSPDYFDSMFKN------------------------PDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAP---LLGKEKKRENPH----KLPELIPNNLATNIDPIYLI--KDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHN 2743
            + +GQ  DYFD MF++                         DK   S   + N    +++  +K+LE+N++GKYVR+ N   K +AE GG+MI+QN  GHPV+V+RFP R KFPA  T+T+W+GSNDP+LHQPP+D+   +   WG+  E TTILC  +GQA++W + AHR   + +   +     ++  +  +++ +     L E+  N      D +YL   K   + LT P  HP  ++P   IHP     R    GNDNSS NRQ+R Q    PDP+ GQPYAG+   + +G+A +  + P  I+ +  + N+  +V   S   PPN F  P  +F TGLDQ++S HN
Sbjct:  712 TSMGQGQDYFDEMFRDLTRETLYTAPPSPPPQKQQRSKSSMDKYQSSVYHDYNTATSSAVGDIKILEVNQEGKYVRLVNDG-KQEAEFGGHMIQQNVGGHPVAVYRFPPRTKFPANSTLTVWAGSNDPILHQPPSDYVWKEQQKWGTGPECTTILCKPNGQAIAWTTAAHRFTKNAFEEPSPASQQVVADDPVQDDANIETDSLTEMTVNINEPKPDSVYLKREKQQPNVLT-PQKHPHGTSPGKEIHPATSQPRPYTYGNDNSSVNRQSRSQTTR-PDPVNGQPYAGS--AQKMGSAPLKRYTPTNIRGNGCIVNKA-DVGKTSC--PPNHFMSPHVKFQTGLDQIRSQHN 1055          

HSP 2 Score: 108.997 bits (271), Expect = 3.090e-20
Identity = 82/370 (22.16%), Postives = 183/370 (49.46%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED----DLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKS 1162
            +++ +L  IN RF +Y+  VR L+ +     D +   +S  +LE+E+  LK+ YE               ++LD               N RL VE+ KN +L+ E++     I + E E+    +   +   +  ++  + EK++R ++    +  K +   ++ E +     QK++F++  ++++  E++ + E     ++S++ +I +    ++    +L ++R++A EE   FK E++E Y+  I  L+ Q+E++    ++L      +  +++ +R K   L   I+ LN +    E+ ++ ++ ++   + ++  K+K +Q+ +  ++ +A      + + ++ EI  +K LL EEEKRL + S
Sbjct:  233 QEREELQKINDRFTSYIQKVRHLREQSGQQADTTSFIKSTKILEDEVATLKSLYE---------------KELD---------------NVRLMVESEKNRRLMEEMNTSHKRIQSLESELSESKVNSGRPYDDINNLTRDSEKMIREIETLKRRYEKEQLMRQEAEEKAHLTSQKMDFENQVYNQQIKELRERLETANATILSLETRIRQYSKSDTSVSGLLQQVRESAEEEMMRFKIESEENYARNITALKTQMENDAKTIDRLNTEKSQILGQIVELRAKITSLEGQIQNLNHQKVSLEEMVAQERAQATEQVAAMSQKLKDVQEMLFVKMREASSSHDCH-MPLKAEISAMKALLEEEEKRLQVPS 571          
BLAST of Transmembrane protein 81 vs. TrEMBL
Match: A0A1S3JD43 (centrobin isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172050 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.748e-56
Identity = 144/397 (36.27%), Postives = 204/397 (51.39%), Query Frame = 2
Query: 1619 PVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKN--------------PDKKDESKSMNTNDTNETSLT-PLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRE---NPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIH-HPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYP---HTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHN 2743
            P  PV P  + P+P       P S++ R              S    +R   +   + LGQ  DYFD MF +               ++   S +     T+  S T PLK+LE+N++GKYVRI N+SD  D EIGGYMI+QN  GHPV+V+RFP R +  A+ T T+++G NDP+LHQPP  F   +   WGS  E TTILC  +GQA++W + AHR + + Y     P  G+    E     ++L +L  N  A   +P++L ++ T     P   HP      +  HP     R    GNDNSS +RQ+R Q+   PDP+ GQPYAG + +R +G+A +  + P    TI+ S  + N+   +       PP+ FQ    RF TGL Q+QS H+
Sbjct:  655 PAPPVMPEGTMPMPILGPVEGPVSSSARVQ------------SAPAGTRSRVHVVPTYLGQGKDYFDEMFNDLKRTTLQTRPRSSPAERPPYSSTFYDYTTSSCSATGPLKILEVNQEGKYVRIVNTSDSMDEEIGGYMIQQNVGGHPVAVYRFPPRTRHKASSTCTVYAGCNDPILHQPPQAFVWKEQERWGSGPECTTILCKPNGQAIAWTTAAHRFSKNAY-DDVQPGNGEYADSEVGKPANELTDLGYNVNAEKPEPVFLRREKTSPPLLPAQKHPHGDYTLNHTHPHHCQPRQLTYGNDNSSVDRQSRSQSAR-PDPIPGQPYAGASARR-MGSAPLRRYTPPNSATIRGSGGVANKAITLTPGVTSHPPSPFQTSHKRFNTGLQQIQSQHD 1036          

HSP 2 Score: 128.642 bits (322), Expect = 2.472e-26
Identity = 97/371 (26.15%), Postives = 190/371 (51.21%), Query Frame = 2
Query:   68 DKHDLTDINQRFLNYVSNVRKLKNED---DLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLER--GDIESNHEKLVRNLQESNAKNLKHEE---NLRDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            +K +L +IN RF NYV  VR ++++    + +    S+ +LEEE+  LK  YE ++ +L+  LD +  +K   + + +  ++    L D+L  ET KN  +  +++ L   I+  E E     L   +M L+R  GD+E      +  L+E+     ++E    N ++ E +I  ++ K++FQ    +++ ++++ + E     ++ ++ K+ E    ++   ++L K+R+TA  E   +K E++E +S  I  L+ Q++ +   +  +   N  ++ ++  +  K   L   IE L  + +  E  L  ++  S   IQ L+ K+++L D +  ++ +A   K    V ++ EIE  K LL EEEKRL +
Sbjct:  146 EKQELQNINDRFSNYVQMVRSIRDQSSQVESTAFLSSVQVLEEEVTKLKHMYEHELEKLRRHLDDVNHEKSHFQVQSVKNESVASQLQDQLHQETDKNKSMFDQMNVLHRTIAQKEHE-----LHEAKMALQRPLGDLEQLQRDYMNVLRENQDLKRRYERETINRQEAEEKIHTLQSKMDFQQQVSAQEMEDIRMRLESSANTILHLESKVRETGKTDNNLVEMLQKVRETAQAELDRYKMESEENFSRSITALKAQMDIDSRNTETISAENRRMHSEVDELTSKIRNLRGQIETLETQKKNLEDVLDQERHRSADHIQRLEKKLRELNDLLFQKMREANAAKDAQ-VPLKAEIEAFKTLLEEEEKRLRL 510          
BLAST of Transmembrane protein 81 vs. TrEMBL
Match: A0A210Q2G8 (Intermediate filament tail domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18101 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 4.825e-56
Identity = 154/440 (35.00%), Postives = 216/440 (49.09%), Query Frame = 2
Query: 1598 PIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKN---------------PDKKDESKSMNTNDTNETS----------------------LTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENP--------HKLPELIPNNLATNIDPIYLIKDTTDTLT-HPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYPHTI---------QPS---HSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHN 2743
            PI P  RPVGPV  + S P                     S  S+Q  I+       ++    + LGQ  DYFD MF++               P ++  + + +  +T+ +S                      +  +K+LE+N++GKYVR+ N S++ +AE GGYMI+QN  GHPV+V+RFP R KFP   TITIWSGSN+ +LHQPPTD+   +   WG+  E TTILC  +GQA++W + AHR   + +   T P    E+ +EN           L ++  N      DP+YL ++     T  P  HP   +P    HP     R    GNDNS+ NRQ+R Q+   PDP+ GQPYAG   Q+ +G+A +  F P+ +         Q S   +S  NR  E    S   PPN+F  P +RF  GL Q+QS HN
Sbjct:  732 PITP--RPVGPVVRVKSAP--------------------ASGHSNQGRIT-------ASGLVPASLGQGKDYFDEMFQDLTRETLYTQVRPKSSPTERQPTSTYHDYNTSTSSQSGSVEILERESPDNAAFTNSAIGDIKILEVNQEGKYVRLSNDSEQ-EAEFGGYMIQQNVGGHPVAVYRFPSRAKFPKQSTITIWSGSNEAILHQPPTDYVWKEQSKWGTGPECTTILCKPNGQAIAWTTAAHRFTRNAFE-DTRPNSDLEEYQENMEPGVNGDLESLTDMTVNINEPRSDPVYLRREKQAPPTLAPQKHPHGISPGRESHPHSGQARPLTYGNDNSTVNRQSRSQSTR-PDPVAGQPYAGAAAQK-MGSAPLRKFSPNQMTRGNTNMSKQSSFWNNSSRNRKTENERPS--TPPNSFMTPHNRFEMGLKQIQSQHN 1136          

HSP 2 Score: 108.227 bits (269), Expect = 6.561e-20
Identity = 85/370 (22.97%), Postives = 190/370 (51.35%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED---DLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENL--RDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESE---ITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRL 1150
            ++K +L  +N RF  YV  VR+L+ +    D S   ++   LE+E+  LK  YE ++  ++  LD +  +K     +          L DRL+VE  KN K+  +++  +  I A + E+    +   Q   +   ++ + + LVR  +  N K    +E L  ++ E++++ + +KIEF +  F+++ +E + +       ++S++ ++ +    ++  P+++ ++R+ A EE   +K  ++  ++  +  L+ Q++++   +  SN  ++ +E+L       + +   L   I+ L  + +  E+ L  ++  S   IQ ++ K +++QD +  ++ +A + +   ++ ++ EIE +K LL EEE+RL
Sbjct:  261 QEKEELQRLNDRFGAYVQRVRQLREQGGQIDSSAFLKTTKQLEDEVSNLKNLYEHELHNIRCQLDEVTKEKNLFHLQFNKSNQTAADLQDRLSVEVDKNRKITDDVNVCQRKIVALQAELEDARMSSSQPYEDINRLQRDMDNLVR--ENENYKRRYEKEQLVRQECEDKMSQLIKKIEFNEQVFNQQLNEARERLNISTATILSLEGRVRDLSKTDTTVPEMIRQVREAAEEELSQYKLNSENEFARNLNSLKVQMDNDAQTVERSN--REKSELLG-ATGEFKARITSLEGQIQMLEHQKKSAEEMLQQERYRSAEQIQVMEKKFREVQDLLIVKMREANVSRD-TSLPLKAEIEAMKVLLEEEERRL 624          
BLAST of Transmembrane protein 81 vs. Ensembl Cavefish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 72.7886 bits (177), Expect = 1.149e-12
Identity = 89/381 (23.36%), Postives = 188/381 (49.34%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHR--ESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESN-QLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I +S T +  E+  +KA+YE+++   + TLD +  ++  L+ EL   + +   L  R + + +     L  L  L + +++ +  + +     + + +E  D+++   KL  +L  ++AK    +E LR  D EN+I  +K+++EFQ + ++E+  E K + E  +        +ID  K +  ES+  D L ++R    E+ + +K E ++ Y          ++R  +L G    E+ ++  +L+  +  L+     +  +EA++    E L+R  ++  + L + +RE   + Q +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   27 QEKEDLCNLNDRLAVYIDKVRSLEAENAGLRLRITESETEISREMGGMKAAYETELADARKTLDSVAKERARLQLELSKVREDYKELKARNSKKEADLEAALARLKDLEALLNSKDASLTTALGEKRSLEVEVRDLKAQLAKLEGSL--NDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYNEELRESKRRHESRI-------VEIDSGKQQEFESKLADALTELRGQHEEQLRIYKEEIEKTYNAKLENARQSADRNSHLVGAAHEELQQTRVRLESMSAQLSQLQKQLAAREAKVRELEEALSRERDMMRRRLDEREREMSDMRQRMQQQLDEYQELLDIKL------------ALDMEISAYRKLLEGEEERLRL 386          

HSP 2 Score: 60.4622 bits (145), Expect = 7.881e-9
Identity = 30/103 (29.13%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIW-SGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            + V E++ +GK+VR+ N +D+ D  +G + +K+        +++FP +    A  ++TIW SG+     H PP+D        WGS   F T L +++G+ ++
Sbjct:  428 ITVDEVDLEGKFVRLSNKADQ-DQSLGHWQVKRQVGTSTPIIYKFPPKFTLKAGQSVTIWASGAGGT--HNPPSDLVWKTQNSWGSGDLFQTTLISANGEEMA 527          
BLAST of Transmembrane protein 81 vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 66.6254 bits (161), Expect = 1.042e-10
Identity = 103/406 (25.37%), Postives = 182/406 (44.83%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEEL----KILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELS-------CLRSDISAGEQEIISLNLMIKQMRLER--GDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRES-------------QWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQG---QLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIK-SGNQHNQIT 1186
            ++K DL  +N R  NY+  VR+L  E D S +   +   EE      + ++  YE+++   + TLD    ++  L+ E     +  C  + RL    S+N+K   ELS        L + +++ E +    NL+    RLE    D+ ++ + L   LQ  NAK   + E LR  D ENQI  ++++++FQ H   ++  EM+S+ E  L ++ S   K  E+K  E+             Q+ D L++      E  K    +  +F +     L G   +LES+  + + L+  N  L          EA +      L+R  +++ + LS   +E   + Q +Q ++++ Q                  + +  EI   +++L  EEKRLN+  S +QH+ I+
Sbjct:   33 QEKEDLRQLNDRLANYIERVRQL--ESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEY----SQLCEDHRRLV---SRNNKKEAELSNAVERWRSLEAALNSKEADYA--NLLAANRRLETDVADLRTHVDNLESALQ--NAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISNLQTQNSTL----------EARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQ------------SLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSIS 403          

HSP 2 Score: 56.9954 bits (136), Expect = 8.173e-8
Identity = 29/94 (30.85%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 1913 EINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSN--DPLLHQPPTDFFSPQPLIWGSSAEFTTILCNS 2188
            EI+  G ++++ N+SD  D  +GG+++++ + G P  VF+ P      A  T+TIWS     +P    PPTD        WG+ ++    L N+
Sbjct:  446 EIDLMGNFIKLRNNSD-TDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEP---NPPTDLVLSGLKTWGAVSDVLVSLFNT 535          
BLAST of Transmembrane protein 81 vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 66.2402 bits (160), Expect = 1.071e-10
Identity = 103/406 (25.37%), Postives = 182/406 (44.83%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEEL----KILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELS-------CLRSDISAGEQEIISLNLMIKQMRLER--GDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRES-------------QWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQG---QLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIK-SGNQHNQIT 1186
            ++K DL  +N R  NY+  VR+L  E D S +   +   EE      + ++  YE+++   + TLD    ++  L+ E     +  C  + RL    S+N+K   ELS        L + +++ E +    NL+    RLE    D+ ++ + L   LQ  NAK   + E LR  D ENQI  ++++++FQ H   ++  EM+S+ E  L ++ S   K  E+K  E+             Q+ D L++      E  K    +  +F +     L G   +LES+  + + L+  N  L          EA +      L+R  +++ + LS   +E   + Q +Q ++++ Q                  + +  EI   +++L  EEKRLN+  S +QH+ I+
Sbjct:   33 QEKEDLRQLNDRLANYIERVRQL--ESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEY----SQLCEDHRRLV---SRNNKKEAELSNAVERWRSLEAALNSKEADYA--NLLAANRRLETDVADLRTHVDNLESALQ--NAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISNLQTQNSTL----------EARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQ------------SLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSIS 403          

HSP 2 Score: 56.9954 bits (136), Expect = 8.043e-8
Identity = 29/94 (30.85%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 1913 EINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSN--DPLLHQPPTDFFSPQPLIWGSSAEFTTILCNS 2188
            EI+  G ++++ N+SD  D  +GG+++++ + G P  VF+ P      A  T+TIWS     +P    PPTD        WG+ ++    L N+
Sbjct:  446 EIDLMGNFIKLRNNSD-TDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEP---NPPTDLVLSGLKTWGAVSDVLVSLFNT 535          
BLAST of Transmembrane protein 81 vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 66.2402 bits (160), Expect = 1.371e-10
Identity = 103/406 (25.37%), Postives = 182/406 (44.83%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEEL----KILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELS-------CLRSDISAGEQEIISLNLMIKQMRLER--GDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRES-------------QWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQG---QLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIK-SGNQHNQIT 1186
            ++K DL  +N R  NY+  VR+L  E D S +   +   EE      + ++  YE+++   + TLD    ++  L+ E     +  C  + RL    S+N+K   ELS        L + +++ E +    NL+    RLE    D+ ++ + L   LQ  NAK   + E LR  D ENQI  ++++++FQ H   ++  EM+S+ E  L ++ S   K  E+K  E+             Q+ D L++      E  K    +  +F +     L G   +LES+  + + L+  N  L          EA +      L+R  +++ + LS   +E   + Q +Q ++++ Q                  + +  EI   +++L  EEKRLN+  S +QH+ I+
Sbjct:   33 QEKEDLRQLNDRLANYIERVRQL--ESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEY----SQLCEDHRRLV---SRNNKKEAELSNAVERWRSLEAALNSKEADYA--NLLAANRRLETDVADLRTHVDNLESALQ--NAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISNLQTQNSTL----------EARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQ------------SLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSIS 403          

HSP 2 Score: 56.9954 bits (136), Expect = 9.881e-8
Identity = 29/94 (30.85%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 1913 EINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSN--DPLLHQPPTDFFSPQPLIWGSSAEFTTILCNS 2188
            EI+  G ++++ N+SD  D  +GG+++++ + G P  VF+ P      A  T+TIWS     +P    PPTD        WG+ ++    L N+
Sbjct:  446 EIDLMGNFIKLRNNSD-TDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEP---NPPTDLVLSGLKTWGAVSDVLVSLFNT 535          
BLAST of Transmembrane protein 81 vs. Ensembl Cavefish
Match: lmnb2 (lamin B2 [Source:NCBI gene;Acc:103025469])

HSP 1 Score: 58.5362 bits (140), Expect = 2.575e-8
Identity = 31/100 (31.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query: 1907 VLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            V EI+ +GK V + N++DK D  +G + +K+        V++F  +    A  T+T+W+ ++  + H PP+D        WGS  E  T+L NS+G+ ++
Sbjct:  442 VEEIDLEGKSVTLKNNADK-DQSLGSWRLKRQIGEADEIVYKFSPKFVLKAGQTVTVWA-ADAGVAHSPPSDLLWKSQSSWGSGDETVTVLVNSNGEEVA 539          
BLAST of Transmembrane protein 81 vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 71.2478 bits (173), Expect = 3.203e-13
Identity = 33/99 (33.33%), Postives = 55/99 (55.56%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQ 2197
            + V EI+  G++V++ N S + D  +GG+ +K++  GH   V++F  R    A  +ITIW+G    + H PP D    Q   WGS  E   ++ N++G+
Sbjct:  229 IAVDEIDAGGRFVKLINDSQQ-DQAVGGWTVKRSIHGHADIVYKFTGRTIVKAGDSITIWAGGA-GVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGE 325          
BLAST of Transmembrane protein 81 vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 70.8626 bits (172), Expect = 4.678e-13
Identity = 33/100 (33.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWN-SSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQ 2197
            + V EI+  G++V++ N S  + D  +GG+ +K++  GH   V++F  R    A  +ITIW+G    + H PP D    Q   WGS  E   ++ N++G+
Sbjct:  250 IAVDEIDAGGRFVKLINDSQQEQDQAVGGWTVKRSIHGHADIVYKFTGRTIVKAGDSITIWAGGA-GVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGE 348          
BLAST of Transmembrane protein 81 vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 61.6178 bits (148), Expect = 7.022e-10
Identity = 35/136 (25.74%), Postives = 67/136 (49.26%), Query Frame = 2
Query: 1799 QSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            Q   + DSM         ++S  +   + ++   + + E++ +GK V + N+S+K D  +GG+++K+         ++F  R    A  T+TIW+ +N  + H PP+D        WG+  +  T L NS G+ ++
Sbjct:  418 QLEGFVDSM---------AQSQRSVSQHASASGSIGIKEVDMEGKSVTMVNNSEK-DQPLGGWVLKRQIEDQAEIAYKFSSRYVLKAGQTVTIWA-ANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVA 542          
BLAST of Transmembrane protein 81 vs. Ensembl Nematostella
Match: EDO39801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W1])

HSP 1 Score: 101.679 bits (252), Expect = 1.365e-25
Identity = 48/100 (48.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQA 2200
            +++LE+N DG YVR++N+S   D EIGGYMI+QN  G PV+VFRFP R +  A    T+WS  +    H PP+DF   +   WG+  E TTILC  +GQ 
Sbjct:    7 VRILEVNPDGNYVRLFNTSAHRDEEIGGYMIQQNVAGRPVTVFRFPPRTRLKALSHTTVWSAGSLS-RHNPPSDFLWKEQHKWGTGPECTTILCKPNGQV 105          
BLAST of Transmembrane protein 81 vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 70.0922 bits (170), Expect = 2.678e-12
Identity = 32/105 (30.48%), Postives = 56/105 (53.33%), Query Frame = 2
Query: 1898 PLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWI 2212
             ++  E + DGKY++I+NS +K D  +GG+ I++       SV++F  +    +   +T+WS       H+PP+D    Q   WGS  E  T L N+ G+ ++ +
Sbjct:  443 AIQFTEADPDGKYIKIYNSGEK-DEALGGWTIQRQVGTEDPSVYKFTPKYVLKSQSHVTVWSAQGGGT-HKPPSDLVFKQLPSWGSGNEARTALVNAGGEEMATL 545          

HSP 2 Score: 54.299 bits (129), Expect = 2.184e-7
Identity = 87/380 (22.89%), Postives = 170/380 (44.74%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNEDD--LSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGE-------QEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKS--KQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQA-RIGKSLNNVSIRGEIEFI--KRLLTEEEKRLNI 1156
            ++K +L  +N R   Y+  V+ L+ E+    S +  S   +E E+  +K+ YE+++   +  LD    +K   + E     N+     ++   E +   K   EL+ +R  +   E       QE ++L  ++++++   G+ E   + L        AK    +E L   D EN+   ++++  F+   + ++  +++S  K  E    +V  DYK       E    + L ++R+    + ++FK ET+  YS +   L+ Q E +     +L++ N  L+  +  +  +  +L      L  RV   +   + DK + +  I   +N+I +L+    T ID A R  + L  V +  ++E    ++LL  EE RL I
Sbjct:   39 QEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKAKQQIESSKNSNDAQEFKNKFDKEAAARKKAEKELNDVRKLLHDKENQLTRRNQEALNLESVLRELQ---GECEELKDAL------KAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYK----DKYEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELR----TSIDDALRDYEDLMGVKVALDMEITAYRKLLESEETRLEI 401          
BLAST of Transmembrane protein 81 vs. Ensembl Medaka
Match: ENSORLT00000011270.2 (lamin-A [Source:NCBI gene;Acc:101160250])

HSP 1 Score: 84.3445 bits (207), Expect = 2.817e-16
Identity = 93/382 (24.35%), Postives = 187/382 (48.95%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNEDD-LSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRK----KEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL+++N R   Y+  VR L+ E+  L + I +S T +  EL  LK +YE+++   + TLD +  ++  L+ EL   + +   L  R T + S  +  L  L  L + +++ +  + +     + + +E  D+++   KL   L   +A+    +E LR  D EN+I  +K+++EFQ +  SE+  E K + E    +MV M+    + +  ES+  + L ++R     + + +K E ++ Y          ++R  +L G    E+    Q++   E  + +L  ++K    +EA++    + L R  + T + L+D +RE   + Q +Q ++ + Q+ +  ++            ++  EI   ++LL  EE+RL +
Sbjct:   25 QEKEDLSNLNDRLAVYIDKVRSLEAENACLRVRITESETEVTRELTGLKNAYEAELADARKTLDSVAKERARLQLELGKLREDHKELKARNTKKESDLAAALQRLKDLEALMNSKDASLTTALGEKRNLEVENRDLKAQVSKLDTGL--GDARKQLQDEMLRRVDGENRIQTLKEELEFQKNLHSEELQETKRRHE---SRMVEMNN--GQQQDFESKLAEALVEMRSQHELQIQLYKEEIEKTYNAKLESARQSADRSSHLVGAAHEEL---QQIRTRLESTSAQLSQLQKQLAAREAKIRDLEDALTRERDSTRRLLADKEREMADMRQRMQQQLDEYQELLDVKL------------ALDMEICAYRKLLEGEEERLRL 384          

HSP 2 Score: 68.1662 bits (165), Expect = 3.338e-11
Identity = 35/103 (33.98%), Postives = 59/103 (57.28%), Query Frame = 2
Query: 1901 LKVLEINKDGKYVRIWNSSDKYDAEIGGYMIK-QNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            + V E++ DGKYVR+ N +D+ D  +G + ++ Q   G P+ +F+FP +    A   +TIW+ SN    H PP+D        WG+  +F T L ++SG+ ++
Sbjct:  448 VTVDEVDLDGKYVRLSNKADE-DQNLGSWQVRRQVGSGTPI-LFKFPAKFTLKAGQRVTIWA-SNAGGSHNPPSDLVWKSQPSWGTGDQFQTTLISASGEEMA 547          
BLAST of Transmembrane protein 81 vs. Ensembl Medaka
Match: lmna (lamin A/C [Source:NCBI gene;Acc:101162240])

HSP 1 Score: 70.0922 bits (170), Expect = 7.569e-12
Identity = 34/99 (34.34%), Postives = 56/99 (56.57%), Query Frame = 2
Query: 1913 EINKDGKYVRIWNSSDKYDAEIGGYMIK-QNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALS 2206
            E++ +GK++R+ N SD+ D  +G + +K Q   G+PV+ ++FP +    A  T+TIW+ S     H PPTD        WG+      IL +SSG+ ++
Sbjct:  460 EVDLEGKFIRLSNKSDE-DQSLGSWQVKAQVGDGNPVT-YKFPSKFSLKAGATVTIWAASGGGT-HNPPTDLVWKNQNSWGTGDSLEIILVSSSGEEMA 555          

HSP 2 Score: 65.0846 bits (157), Expect = 2.782e-10
Identity = 87/382 (22.77%), Postives = 180/382 (47.12%), Query Frame = 2
Query:   65 EDKHDLTDINQRFLNYVSNVRKLKNED-DLSI-INQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLR--DYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFY----------SERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKK----EAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNI 1156
            ++K DL ++N R   Y+  VR L+ E+  L + I++S +++  +L  +KA+YE+++   +  LD +  +K  L+ +L   +     L  R T +       L  L  L + +++ +  + +     + +  E  D+++   KL  NL  ++A+    +E L+  D EN++  +K+++EFQ + ++E+  E K + E    +MV +D      +  E++    L ++R    E+   +K E ++ Y          +ER  +L G    E+    Q +   E L  ++  ++K+    EA++    E L+R  ++  + L D  RE       +Q +++  Q+ +  ++            ++  EI   + LL  EE+RL +
Sbjct:   22 QEKEDLCNLNDRLAVYIDKVRSLEAENAGLRLRISESESLVTRDLSGIKAAYENELADARHALDQVAKEKARLQLDLGKIREEHKELKARNTKKELDLEAALARLRDLEALLNSKDAALATALGEKRNLEAEVKDLKAQLAKLDMNL--ADARKQLQDEMLKRVDAENRLQTVKEELEFQKNIYNEETRESKRRSE---SRMVEID--CSRQQEFENKLAAALVELRAQHEEQVSIYKEELEKTYNSRLENARHSAERTTHLVGAAHEEL---QQTRSRLEGLTLQMTQLQKQLSASEAKVRELEEALSRERDLMRRRLEDKDREMAENRARMQQQLEDYQELLDIKL------------ALDMEISHYRTLLEGEEERLRL 381          
BLAST of Transmembrane protein 81 vs. Planmine SMEST
Match: SMESG000026648.1 (SMESG000026648.1)

HSP 1 Score: 1857.42 bits (4810), Expect = 0.000e+0
Identity = 907/915 (99.13%), Postives = 913/915 (99.78%), Query Frame = 2
Query:   50 MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEINREILQRSSNIDMVDAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDENIPLDSDSLNRNFTDGDGYYPQEKMNSCMXXXXXXXXXXXCDQNNTDQFWSDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNLYHSRMFNTETNPSVN 2794
            MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQI QLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRDYENQ+TCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKI+EAKHRESQWPDILDKIRKTAAEEYKAFKAETD+FYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEINREILQRSSNIDM DAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDEN+PLDSDSLNRNFTDGDGYYPQEKMNSCMNEIEENPIPENCDQNNTDQFWSDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTN+QRLLG+AKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNLYHSRMFNTETNPSVN
Sbjct:    1 MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQISQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRDYENQMTCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIEEAKHRESQWPDILDKIRKTAAEEYKAFKAETDDFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEINREILQRSSNIDMADAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDENMPLDSDSLNRNFTDGDGYYPQEKMNSCMNEIEENPIPENCDQNNTDQFWSDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNMQRLLGSAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNLYHSRMFNTETNPSVN 915          
BLAST of Transmembrane protein 81 vs. Planmine SMEST
Match: SMESG000026648.1 (SMESG000026648.1)

HSP 1 Score: 1664.43 bits (4309), Expect = 0.000e+0
Identity = 836/915 (91.37%), Postives = 842/915 (92.02%), Query Frame = 2
Query:   50 MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYLEKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERIGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEINREILQRSSNIDMVDAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDENIPLDSDSLNRNFTDGDGYYPQEKMNSCMXXXXXXXXXXXCDQNNTDQFWSDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNLYHSRMFNTETNPSVN 2794
            MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQI QLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRD                                Y  +M  M  KI+   H                             F+SE IGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEINREILQRSSNIDM DAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDEN+PLDSDSLNRNFTDGDGYYPQEKMNSCMNEIEENPIPENCDQNNTDQFWSDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTN+QRLLG+AKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNLYHSRMFNTETNPSVN
Sbjct:    1 MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKILKASYESQISQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSKNSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNLQESNAKNLKHEENLRD--------------------------------YENQMTCMKQKIEFQDH-----------------------------FFSE-IGYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVEITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIRGEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEINREILQRSSNIDMADAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDENMPLDSDSLNRNFTDGDGYYPQEKMNSCMNEIEENPIPENCDQNNTDQFWSDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANLRGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKDESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQNRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIWGSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPHKLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESYRGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNMQRLLGSAKVMHFYPHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNLYHSRMFNTETNPSVN 853          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 81 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMNTD14.138e-1630.38lamin tail domain containing 1 [Source:HGNC Symbol... [more]
LMNTD15.589e-1630.38lamin tail domain containing 1 [Source:HGNC Symbol... [more]
LMNTD19.782e-1630.38lamin tail domain containing 1 [Source:HGNC Symbol... [more]
LMNTD11.492e-1530.38lamin tail domain containing 1 [Source:HGNC Symbol... [more]
LMNA1.264e-1426.03lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lmn-12.770e-626.45Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443][more]
lmn-12.770e-626.45Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443][more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lam2.100e-730.36gene:FBgn0002525 transcript:FBtr0346460[more]
Lam2.100e-730.36gene:FBgn0002525 transcript:FBtr0307059[more]
Lam2.100e-730.36gene:FBgn0002525 transcript:FBtr0307058[more]
Lam2.100e-730.36gene:FBgn0002525 transcript:FBtr0079100[more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmna4.048e-1724.74lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna4.048e-1724.74lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna4.048e-1724.74lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna9.292e-1725.00lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmnb23.073e-932.63lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlana9.158e-1535.92melan-A [Source:Xenbase;Acc:XB-GENE-971951][more]
mlana1.351e-1435.92melan-A [Source:Xenbase;Acc:XB-GENE-971951][more]
srp144.897e-934.38signal recognition particle 14kDa [Source:Xenbase;... [more]
srp145.487e-934.38signal recognition particle 14kDa [Source:Xenbase;... [more]
srp148.079e-934.38signal recognition particle 14kDa [Source:Xenbase;... [more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmntd19.299e-2138.94lamin tail domain containing 1 [Source:MGI Symbol;... [more]
Lmntd19.789e-2133.12lamin tail domain containing 1 [Source:MGI Symbol;... [more]
Lmntd11.442e-2033.12lamin tail domain containing 1 [Source:MGI Symbol;... [more]
Lmna8.030e-1426.03lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
Lmna4.281e-1326.03lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
back to top
BLAST of Transmembrane protein 81 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D4C1|LMTD1_MOUSE1.008e-1933.12Lamin tail domain-containing protein 1 OS=Mus musc... [more]
sp|Q4R899|LMTD1_MACFA1.741e-1530.38Lamin tail domain-containing protein 1 OS=Macaca f... [more]
sp|Q8N9Z9|LMTD1_HUMAN7.163e-1530.38Lamin tail domain-containing protein 1 OS=Homo sap... [more]
sp|P02545|LMNA_HUMAN1.174e-1326.03Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 ... [more]
sp|P48679|LMNA_RAT3.213e-1326.03Prelamin-A/C OS=Rattus norvegicus OX=10116 GN=Lmna... [more]
back to top
BLAST of Transmembrane protein 81 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J6651.274e-5833.65LTD domain-containing protein OS=Macrostomum ligna... [more]
A0A267GCF01.134e-5733.41LTD domain-containing protein OS=Macrostomum ligna... [more]
K1QKB91.274e-5637.22Intermediate filament tail domain-containing prote... [more]
A0A1S3JD431.748e-5636.27centrobin isoform X1 OS=Lingula unguis OX=7574 GN=... [more]
A0A210Q2G84.825e-5635.00Intermediate filament tail domain-containing prote... [more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmna1.149e-1223.36lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmnl31.042e-1025.37lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl31.071e-1025.37lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl31.371e-1025.37lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnb22.575e-831.00lamin B2 [Source:NCBI gene;Acc:103025469][more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lmnb23.203e-1333.33lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmnb24.678e-1333.00lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmnb27.022e-1025.74lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO398011.365e-2548.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372252.678e-1230.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 81 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000011270.22.817e-1624.35lamin-A [Source:NCBI gene;Acc:101160250][more]
lmna7.569e-1234.34lamin A/C [Source:NCBI gene;Acc:101162240][more]
back to top
BLAST of Transmembrane protein 81 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026648.10.000e+099.13SMESG000026648.1[more]
SMESG000026648.10.000e+091.37SMESG000026648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017399 ID=SMED30017399|Name=Transmembrane protein 81|organism=Schmidtea mediterranea sexual|type=transcript|length=3124bp
AAATATTTGAAAATTATAAACTACCAGATTTATTAAAATTGTATTAGAAA
TGTCTATTAGTAAAGAAGACAAGCATGATTTAACAGATATTAATCAACGA
TTTTTAAACTATGTTAGCAATGTTAGGAAACTCAAAAACGAGGATGATTT
ATCCATTATAAATCAAAGCATTACAATGTTGGAAGAAGAATTAAAAATCT
TAAAGGCATCTTATGAATCTCAAATTTGTCAATTAAAAACCACATTGGAC
ATTATCGTCACTCAGAAACTTGATTTGGAGAAAGAACTTTTATCAAGGAA
GAATAATGAATGCCATTTAAATGACAGATTAACAGTCGAAACTAGCAAAA
ATTCGAAATTATTACATGAATTGAGCTGTTTACGGTCGGATATCAGCGCA
GGGGAGCAAGAGATAATTTCCCTCAATTTAATGATAAAGCAAATGCGACT
TGAAAGGGGTGACATCGAAAGCAACCACGAAAAATTGGTTCGAAATTTAC
AAGAGAGCAATGCCAAGAATTTGAAGCATGAAGAAAATCTTCGAGATTAT
GAGAATCAAATAACTTGCATGAAACAGAAAATTGAATTCCAGGATCATTT
TTTCTCAGAGAAATTCGATGAGATGAAATCGAAGCAAGAGGAATACCTGG
AGAAAATGGTAAGTATGGATTATAAAATAGACGAAGCCAAACATCGTGAA
TCTCAATGGCCGGATATTCTTGATAAAATCCGCAAAACCGCCGCCGAAGA
ATATAAAGCGTTTAAAGCCGAAACTGACGAGTTTTACAGTGAAAGGATTG
GCTACTTGCAGGGGCAATTGGAATCAGAAATCACGGAAAGCAATCAGCTA
AAGGATAACAACGAAGTTCTAAATGACAAATTATTGTCAATGCGAAAGAA
AGAAGCGGAATTGAATACAACGATCGAGTGTTTGAACAGGCGCGTGGAAA
TTACAGAGAAAGCATTATCCGATGACAAACGGGAATCAGAGAGAGTCATC
CAATCGCTGCAGAACAAAATCAAACAATTACAAGATCACATTACCACAGA
GATTGACCAAGCTCGCATTGGAAAATCCTTGAATAACGTATCAATACGTG
GAGAAATCGAGTTCATCAAGAGGTTATTGACTGAAGAGGAAAAAAGACTC
AACATCAAATCCGGCAATCAACACAATCAAATAACAAATGATTTCGACAA
TAAAGAAAACATAAATCGCTTTCAAGTTCACGATTCCGAAGCGGAAATAA
ATCGAGAAATCCTTCAACGGAGTTCAAATATTGACATGGTAGATGCCAAA
GACAAAATCGAGTTCAATTACTTTACTGATTACCAGAGCGAAGACGAAGG
AGAGGCGAGAAACAACAGTCGGTTTTTTAATAATATTTCAACTGACGAAA
ATATACCGCTTGATTCTGATTCGTTGAATCGAAATTTTACCGACGGTGAT
GGATATTATCCCCAGGAGAAAATGAACAGCTGCATGAATGAAATCGAAGA
AAACCCGATTCCAGAGAATTGCGATCAGAATAACACGGATCAGTTCTGGA
GTGATAAAAACAACGCATTGGTATTAACAACTCAAATGTCTGTTGGTCCA
ATTGAACCGTTTGAACGGCCTGTCGGTCCAGTGCGGCCGATCTCATCTAC
TCCGCTACCACAGAATGAGCGGCCTCCCAGACCATTTTCAGCCAATTTAA
GGGGAACACGTACAAAATCATGCGTCTCACATCAGGATTCAATCAGTAAG
GACTGTCACAGTCGTTGCTCTAATAATTTCTCTGATTCCGGTCTCGGTCA
AAGTCCCGACTATTTCGATAGTATGTTTAAAAACCCCGATAAAAAAGACG
AATCAAAATCTATGAACACAAATGATACGAATGAGACGAGCTTGACTCCC
CTGAAGGTGCTGGAAATCAACAAGGACGGTAAATATGTGCGTATCTGGAA
TTCCAGTGATAAATATGACGCAGAGATCGGCGGCTATATGATCAAGCAGA
ATCGATTTGGTCATCCAGTTTCCGTGTTTCGGTTCCCGGACCGAGTCAAA
TTCCCAGCTACTTGTACAATAACAATTTGGTCTGGCTCAAATGATCCTCT
GTTGCATCAGCCACCAACTGATTTCTTCAGTCCGCAACCATTGATTTGGG
GTTCCAGCGCCGAGTTCACCACGATTCTCTGTAATTCCTCGGGCCAGGCA
TTATCATGGATATCGACTGCCCACAGAATAAACCCTGATCCGTATCGAGC
AAAAACTGCTCCATTGTTGGGAAAGGAAAAGAAACGAGAAAATCCCCACA
AACTTCCTGAGCTGATTCCGAATAATCTGGCAACAAACATTGATCCGATT
TATCTGATCAAGGACACAACGGATACGCTGACGCATCCGATTCACCATCC
GTTTACATCGACACCGAAATCAGCGATCCATCCATGCAGGGAAAGTTATC
GTGGGAAAATAAACGGCAACGACAACAGTTCATTCAATCGTCAAACGCGC
CAACAGAATGATAACATACCGGATCCTATGATTGGCCAGCCTTACGCTGG
CACCAATGTGCAACGGTTGCTCGGCAATGCAAAGGTGATGCATTTCTATC
CCCATACTATACAGCCGAGTCACAGCTTGAACAATCGAACACCAGAAGTG
ATATTCCGATCTTATGTAGAGCCACCAAATGCCTTTCAAAAGCCTCAGTC
ACGGTTCATAACCGGCCTGGATCAAGTGCAAAGTATGCACAACAATCTCT
ACCATTCGCGAATGTTCAACACTGAAACCAACCCATCTGTCAATTGAAAT
ATGTTCCAATGCGGCTCTTGCGTTGACGCACGCATTCGTGAATGTGTATG
TGTGTGTTTGTGTAATTATCTTTTTTTTCTATGCGACATATTGAGATCGA
TAGATCGATAGTGACATTATTATACACTGTGATCTTTTTACTTCTATTTC
TTTACCTAGCCAATGAGTAACTATGACTGTTGAGATCGTGATTAACTGTG
TTACCTTCATTATTTTCTATTGATCTAGATGCTTATTTGCTTATTCATAA
GGTCTATTTTAGGTGTATTCTTTTCAATGGAGATCAGTGTAGCAGAGATA
ATAAACATGACAATAACAGATCGG
back to top

protein sequence of SMED30017399-orf-1

>SMED30017399-orf-1 ID=SMED30017399-orf-1|Name=SMED30017399-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=916bp
MSISKEDKHDLTDINQRFLNYVSNVRKLKNEDDLSIINQSITMLEEELKI
LKASYESQICQLKTTLDIIVTQKLDLEKELLSRKNNECHLNDRLTVETSK
NSKLLHELSCLRSDISAGEQEIISLNLMIKQMRLERGDIESNHEKLVRNL
QESNAKNLKHEENLRDYENQITCMKQKIEFQDHFFSEKFDEMKSKQEEYL
EKMVSMDYKIDEAKHRESQWPDILDKIRKTAAEEYKAFKAETDEFYSERI
GYLQGQLESEITESNQLKDNNEVLNDKLLSMRKKEAELNTTIECLNRRVE
ITEKALSDDKRESERVIQSLQNKIKQLQDHITTEIDQARIGKSLNNVSIR
GEIEFIKRLLTEEEKRLNIKSGNQHNQITNDFDNKENINRFQVHDSEAEI
NREILQRSSNIDMVDAKDKIEFNYFTDYQSEDEGEARNNSRFFNNISTDE
NIPLDSDSLNRNFTDGDGYYPQEKMNSCMNEIEENPIPENCDQNNTDQFW
SDKNNALVLTTQMSVGPIEPFERPVGPVRPISSTPLPQNERPPRPFSANL
RGTRTKSCVSHQDSISKDCHSRCSNNFSDSGLGQSPDYFDSMFKNPDKKD
ESKSMNTNDTNETSLTPLKVLEINKDGKYVRIWNSSDKYDAEIGGYMIKQ
NRFGHPVSVFRFPDRVKFPATCTITIWSGSNDPLLHQPPTDFFSPQPLIW
GSSAEFTTILCNSSGQALSWISTAHRINPDPYRAKTAPLLGKEKKRENPH
KLPELIPNNLATNIDPIYLIKDTTDTLTHPIHHPFTSTPKSAIHPCRESY
RGKINGNDNSSFNRQTRQQNDNIPDPMIGQPYAGTNVQRLLGNAKVMHFY
PHTIQPSHSLNNRTPEVIFRSYVEPPNAFQKPQSRFITGLDQVQSMHNNL
YHSRMFNTETNPSVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005737cytoplasm
GO:0005882intermediate filament
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000032dorsal midline
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036415Lamin_tail_dom_sf
IPR042840LMNTD1
IPR001322Lamin_tail_dom
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005198structural molecule activity
Vocabulary: biological process
TermDefinition
GO:0008283cell proliferation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 41..61
NoneNo IPR availableCOILSCoilCoilcoord: 143..177
NoneNo IPR availableCOILSCoilCoilcoord: 257..284
NoneNo IPR availableCOILSCoilCoilcoord: 292..337
IPR036415Lamin tail domain superfamilyGENE3DG3DSA:2.60.40.1260coord: 586..727
e-value: 1.2E-26
score: 95.0
IPR036415Lamin tail domain superfamilySUPERFAMILYSSF74853Lamin A/C globular tail domaincoord: 612..722
IPR042840Lamin tail domain-containing protein 1PANTHERPTHR47012FAMILY NOT NAMEDcoord: 415..822
IPR001322Lamin tail domainPROSITEPS51841LTDcoord: 606..729
score: 14.335