Ubiquitin-conjugating enzyme E2 J1

Overview
NameUbiquitin-conjugating enzyme E2 J1
Smed IDSMED30017397
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-conjugating enzyme E2 J1 (SMED30017397) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 J1 (SMED30017397) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-conjugating enzyme E2 J1 (SMED30017397) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 J1 (SMED30017397) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017397

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30017397SMESG000008271.1 dd_Smed_v4_2788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017397SMESG000008271.1 dd_Smed_v4_2788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017397SMESG000008271.1 dd_Smed_v4_2788_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Human
Match: UBE2J1 (ubiquitin conjugating enzyme E2 J1 [Source:HGNC Symbol;Acc:HGNC:17598])

HSP 1 Score: 278.87 bits (712), Expect = 2.113e-90
Identity = 130/185 (70.27%), Postives = 152/185 (82.16%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG----IKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PT+ +HA+PLEDNLFEWHFT+RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG     +   L+S +D+S AD  EAK LA QISF  E
Sbjct:    5 YNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQAD-QEAKELARQISFKAE 188          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Human
Match: UBE2J2 (ubiquitin conjugating enzyme E2 J2 [Source:HGNC Symbol;Acc:HGNC:19268])

HSP 1 Score: 130.568 bits (327), Expect = 4.415e-35
Identity = 60/145 (41.38%), Postives = 95/145 (65.52%), Query Frame = 3
Query:   39 RSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    8 RAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLAVQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Human
Match: UBE2J2 (ubiquitin conjugating enzyme E2 J2 [Source:HGNC Symbol;Acc:HGNC:19268])

HSP 1 Score: 130.568 bits (327), Expect = 3.035e-34
Identity = 60/145 (41.38%), Postives = 95/145 (65.52%), Query Frame = 3
Query:   39 RSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    8 RAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLAVQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Human
Match: UBE2J2 (ubiquitin conjugating enzyme E2 J2 [Source:HGNC Symbol;Acc:HGNC:19268])

HSP 1 Score: 130.568 bits (327), Expect = 3.035e-34
Identity = 60/145 (41.38%), Postives = 95/145 (65.52%), Query Frame = 3
Query:   39 RSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    8 RAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLAVQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Human
Match: UBE2J2 (ubiquitin conjugating enzyme E2 J2 [Source:HGNC Symbol;Acc:HGNC:19268])

HSP 1 Score: 119.398 bits (298), Expect = 4.429e-30
Identity = 60/161 (37.27%), Postives = 95/161 (59.01%), Query Frame = 3
Query:   39 RSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEW----------------HFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            R+P  A +RL ++   +  +P     A+PL  N+ EW                H+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    8 RAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWFKRFSWLSLLSSWDYRHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLAVQSLAF 165          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Celegans
Match: ubc-6 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:B1Q233])

HSP 1 Score: 264.233 bits (674), Expect = 4.083e-85
Identity = 118/191 (61.78%), Postives = 153/191 (80.10%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGI-KFVLRSLT-DASVADVNEAKNLASQISFTGEKARDKNNE 596
            YNT++  V+RLMKEA EL +PTE++HA+P+EDNLFEWHFTIRG + TD++GGIYHGRI+ PA+YPMKPPN++L+TP+GRFE+N+K+CLSISGYHPETW PSWSIRTALLA+IGF+P+   GA+GSLDYPP+ER++LAK S ++ C +CG + K  L  +T D  +    EAK LA+Q+ F  E    K  E
Sbjct:    5 YNTKNAGVRRLMKEAMELRQPTEMYHAQPMEDNLFEWHFTIRGTLGTDFEGGIYHGRIIFPADYPMKPPNLILLTPNGRFELNKKVCLSISGYHPETWLPSWSIRTALLALIGFLPSTPGGALGSLDYPPKERQRLAKLSCEWKCKECGCVMKTALLPITEDGQLKQTEEAKTLAAQLKFQDESVVKKEVE 195          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Celegans
Match: ubc-6 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:B1Q233])

HSP 1 Score: 249.595 bits (636), Expect = 1.177e-79
Identity = 112/180 (62.22%), Postives = 144/180 (80.00%), Query Frame = 3
Query:   63 MKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGI-KFVLRSLT-DASVADVNEAKNLASQISFTGEKARDKNNE 596
            MKEA EL +PTE++HA+P+EDNLFEWHFTIRG + TD++GGIYHGRI+ PA+YPMKPPN++L+TP+GRFE+N+K+CLSISGYHPETW PSWSIRTALLA+IGF+P+   GA+GSLDYPP+ER++LAK S ++ C +CG + K  L  +T D  +    EAK LA+Q+ F  E    K  E
Sbjct:    1 MKEAMELRQPTEMYHAQPMEDNLFEWHFTIRGTLGTDFEGGIYHGRIIFPADYPMKPPNLILLTPNGRFELNKKVCLSISGYHPETWLPSWSIRTALLALIGFLPSTPGGALGSLDYPPKERQRLAKLSCEWKCKECGCVMKTALLPITEDGQLKQTEEAKTLAAQLKFQDESVVKKEVE 180          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Celegans
Match: ubc-6 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:B1Q233])

HSP 1 Score: 249.595 bits (636), Expect = 1.177e-79
Identity = 112/180 (62.22%), Postives = 144/180 (80.00%), Query Frame = 3
Query:   63 MKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGI-KFVLRSLT-DASVADVNEAKNLASQISFTGEKARDKNNE 596
            MKEA EL +PTE++HA+P+EDNLFEWHFTIRG + TD++GGIYHGRI+ PA+YPMKPPN++L+TP+GRFE+N+K+CLSISGYHPETW PSWSIRTALLA+IGF+P+   GA+GSLDYPP+ER++LAK S ++ C +CG + K  L  +T D  +    EAK LA+Q+ F  E    K  E
Sbjct:    1 MKEAMELRQPTEMYHAQPMEDNLFEWHFTIRGTLGTDFEGGIYHGRIIFPADYPMKPPNLILLTPNGRFELNKKVCLSISGYHPETWLPSWSIRTALLALIGFLPSTPGGALGSLDYPPKERQRLAKLSCEWKCKECGCVMKTALLPITEDGQLKQTEEAKTLAAQLKFQDESVVKKEVE 180          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Celegans
Match: ubc-26 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:A0A2K5ATR7])

HSP 1 Score: 134.806 bits (338), Expect = 4.524e-37
Identity = 63/146 (43.15%), Postives = 91/146 (62.33%), Query Frame = 3
Query:   24 MSYNTRSPAVKRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDF 458
            M+    + A++RL K+ Q L  EP     A PLE N+ EW + I G   T Y+GGIY G++L P ++P KPP IL++TP+GRF+ N ++CLSIS YHP+TW P+W++ T +  ++ FM       +GSL     ER+ LAK S  +
Sbjct:    1 MTSGVSTVALQRLKKDYQRLLKEPVPFMKAAPLETNILEWRYIIIGAPKTPYEGGIYMGKLLFPKDFPFKPPAILMLTPNGRFQTNTRLCLSISDYHPDTWNPAWTVSTIITGLMSFM-NDNQPTLGSLVTSESERKLLAKKSKQW 145          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Celegans
Match: ubc-26 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:A0A2K5ATR7])

HSP 1 Score: 134.806 bits (338), Expect = 4.524e-37
Identity = 63/146 (43.15%), Postives = 91/146 (62.33%), Query Frame = 3
Query:   24 MSYNTRSPAVKRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDF 458
            M+    + A++RL K+ Q L  EP     A PLE N+ EW + I G   T Y+GGIY G++L P ++P KPP IL++TP+GRF+ N ++CLSIS YHP+TW P+W++ T +  ++ FM       +GSL     ER+ LAK S  +
Sbjct:    1 MTSGVSTVALQRLKKDYQRLLKEPVPFMKAAPLETNILEWRYIIIGAPKTPYEGGIYMGKLLFPKDFPFKPPAILMLTPNGRFQTNTRLCLSISDYHPDTWNPAWTVSTIITGLMSFM-NDNQPTLGSLVTSESERKLLAKKSKQW 145          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Fly
Match: CG5823 (gene:FBgn0038515 transcript:FBtr0321266)

HSP 1 Score: 128.642 bits (322), Expect = 1.280e-33
Identity = 58/140 (41.43%), Postives = 91/140 (65.00%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFM--PTHGIGAIGSLDYPPEERRKLAKSSSDF 458
            AV R+ ++   L  +P     A+PL +N+ EWH+ ++GP D+ Y GG YHG +L P E+P KPP+I ++TP+GRF+ N ++CLSIS +HP+TW P+W + T L  ++ FM   T  +G+I S +Y   +++  A+ S  F
Sbjct:   15 AVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNY---DKQMFAQKSLAF 151          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Fly
Match: CG5823 (gene:FBgn0038515 transcript:FBtr0083505)

HSP 1 Score: 128.642 bits (322), Expect = 1.280e-33
Identity = 58/140 (41.43%), Postives = 91/140 (65.00%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFM--PTHGIGAIGSLDYPPEERRKLAKSSSDF 458
            AV R+ ++   L  +P     A+PL +N+ EWH+ ++GP D+ Y GG YHG +L P E+P KPP+I ++TP+GRF+ N ++CLSIS +HP+TW P+W + T L  ++ FM   T  +G+I S +Y   +++  A+ S  F
Sbjct:   15 AVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNY---DKQMFAQKSLAF 151          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Fly
Match: CG5440 (gene:FBgn0031331 transcript:FBtr0343837)

HSP 1 Score: 83.9593 bits (206), Expect = 9.963e-19
Identity = 47/121 (38.84%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   21 NMSYNTRSPAVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            + S+   + AVKR+ KE  E++ +P +   A P EDNL+EW  TI GP D+ Y+ GI+   I  P EYP  PP ++  TP     I+R   ICL I     E W P+ +I   LL+I   +
Sbjct:   13 SCSWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILK---EKWSPALTISKILLSICSLL 130          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Fly
Match: CG5440 (gene:FBgn0031331 transcript:FBtr0305552)

HSP 1 Score: 83.9593 bits (206), Expect = 9.963e-19
Identity = 47/121 (38.84%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   21 NMSYNTRSPAVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            + S+   + AVKR+ KE  E++ +P +   A P EDNL+EW  TI GP D+ Y+ GI+   I  P EYP  PP ++  TP     I+R   ICL I     E W P+ +I   LL+I   +
Sbjct:   13 SCSWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILK---EKWSPALTISKILLSICSLL 130          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0310554)

HSP 1 Score: 71.633 bits (174), Expect = 1.356e-14
Identity = 42/112 (37.50%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE Q+L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ +I   LL+I   +
Sbjct:    2 ALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR---SQWSPALTISKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Zebrafish
Match: ube2j1 (ubiquitin-conjugating enzyme E2, J1 [Source:ZFIN;Acc:ZDB-GENE-040426-2853])

HSP 1 Score: 266.929 bits (681), Expect = 5.951e-86
Identity = 121/182 (66.48%), Postives = 147/182 (80.77%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG-IKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PTE +HA+PLEDNLFEWHF++RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+TP+GRFE+ +KICLSISG+HPETW+PSWSIRTAL+AIIGFMPT G GAIGSLDY PEER+ LAK S DF C  C   ++  L  L+  S     + + LA QI+F  E
Sbjct:    5 YNLKSPAVKRLMKEAAELRDPTEHYHAQPLEDNLFEWHFSVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTPNGRFEVGKKICLSISGHHPETWQPSWSIRTALIAIIGFMPTKGEGAIGSLDYTPEERKALAKKSQDFCCEACSSCMRSALLPLSPDSDLRPADPQRLAQQINFKAE 186          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Zebrafish
Match: ube2j2 (ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070410-28])

HSP 1 Score: 132.494 bits (332), Expect = 3.183e-35
Identity = 61/147 (41.50%), Postives = 96/147 (65.31%), Query Frame = 3
Query:   33 NTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    6 NKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYLVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLASQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Zebrafish
Match: ube2j2 (ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070410-28])

HSP 1 Score: 114.39 bits (285), Expect = 3.220e-30
Identity = 48/105 (45.71%), Postives = 74/105 (70.48%), Query Frame = 3
Query:   33 NTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWS 338
            N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS
Sbjct:    7 NKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYLVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWS 111          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Zebrafish
Match: ube2d1b (ubiquitin-conjugating enzyme E2D 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2735])

HSP 1 Score: 73.1738 bits (178), Expect = 5.360e-15
Identity = 41/112 (36.61%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE Q+L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ ++   LL+I   +
Sbjct:    2 ALKRIQKELQDLQRDPPAQCSAGPVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---SQWSPALTVSKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Zebrafish
Match: ube2d1a (ubiquitin-conjugating enzyme E2D 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1609])

HSP 1 Score: 72.0182 bits (175), Expect = 7.972e-15
Identity = 41/112 (36.61%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE Q+L  +P     A PL ++LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ ++   LL+I   +
Sbjct:    2 ALKRIQKELQDLQRDPPSQCSAGPLGEDLFHWQATIMGPGDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---SQWSPALTVSKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Xenopus
Match: ube2j1 (ubiquitin conjugating enzyme E2 J1 [Source:NCBI gene;Acc:496585])

HSP 1 Score: 269.24 bits (687), Expect = 1.856e-86
Identity = 125/182 (68.68%), Postives = 149/182 (81.87%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCG-GIKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PT+ +HA+PLEDNLFEWHFT+RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEER+ LAK S D+ C  CG  +K  L  L+ +S     EA+ LA QISF  E
Sbjct:   27 YNLKSPAVKRLMKEAAELRDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERKALAKRSQDYFCEVCGVNMKCTLLPLSSSSSQADVEARELARQISFKAE 208          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Xenopus
Match: ube2j2 (ubiquitin conjugating enzyme E2 J2 [Source:NCBI gene;Acc:734006])

HSP 1 Score: 103.219 bits (256), Expect = 6.386e-25
Identity = 44/99 (44.44%), Postives = 69/99 (69.70%), Query Frame = 3
Query:  168 TDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    2 TPYEGGYYHGKLVFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLAAQSLTF 97          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 71.633 bits (174), Expect = 2.375e-14
Identity = 40/112 (35.71%), Postives = 56/112 (50.00%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE  +L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ ++   LL+I   +
Sbjct:    2 ALKRIQKELNDLQRDPPAQCSAGPVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---SQWSPALTVSKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Xenopus
Match: ube2d3 (ubiquitin conjugating enzyme E2 D3 [Source:NCBI gene;Acc:548818])

HSP 1 Score: 69.3218 bits (168), Expect = 1.384e-13
Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE  +L+ +P     A P+ D++F W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ +I   LL+I   +
Sbjct:    2 ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR---SQWSPALTISKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 71.2478 bits (173), Expect = 1.661e-13
Identity = 41/115 (35.65%), Postives = 57/115 (49.57%), Query Frame = 3
Query:   39 RSPAVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINR--KICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            R  A+KR+ KE  +L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ ++   LL+I   +
Sbjct:   95 RPMALKRIQKELNDLQRDPPAQCSAGPVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---SQWSPALTVSKVLLSICSLL 206          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Mouse
Match: Ube2j1 (ubiquitin-conjugating enzyme E2J 1 [Source:MGI Symbol;Acc:MGI:1926245])

HSP 1 Score: 275.018 bits (702), Expect = 4.546e-89
Identity = 129/185 (69.73%), Postives = 151/185 (81.62%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG----IKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PT+ +HA+PLEDNLFEWHFT+RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG     +   L+S + +S AD  EAK LA QISF  E
Sbjct:    5 YNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSGSSQAD-QEAKELARQISFKAE 188          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Mouse
Match: Ube2j1 (ubiquitin-conjugating enzyme E2J 1 [Source:MGI Symbol;Acc:MGI:1926245])

HSP 1 Score: 248.054 bits (632), Expect = 2.814e-79
Identity = 117/169 (69.23%), Postives = 138/169 (81.66%), Query Frame = 3
Query:   69 EAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG----IKFVLRSLTDASVADVNEAKNLASQISF 563
            EA EL +PT+ +HA+PLEDNLFEWHFT+RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG     +   L+S + +S AD  EAK LA QISF
Sbjct:    2 EAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSGSSQAD-QEAKELARQISF 169          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Mouse
Match: Ube2j1 (ubiquitin-conjugating enzyme E2J 1 [Source:MGI Symbol;Acc:MGI:1926245])

HSP 1 Score: 162.155 bits (409), Expect = 1.299e-47
Identity = 80/120 (66.67%), Postives = 92/120 (76.67%), Query Frame = 3
Query:  225 MKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG----IKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            MKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG     +   L+S + +S AD  EAK LA QISF  E
Sbjct:    1 MKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSGSSQAD-QEAKELARQISFKAE 119          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Mouse
Match: Ube2j2 (ubiquitin-conjugating enzyme E2J 2 [Source:MGI Symbol;Acc:MGI:2153608])

HSP 1 Score: 130.568 bits (327), Expect = 2.127e-34
Identity = 60/147 (40.82%), Postives = 96/147 (65.31%), Query Frame = 3
Query:   33 NTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +++LA  S  F
Sbjct:    6 NKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKKQLAAQSLVF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Mouse
Match: Ube2j2 (ubiquitin-conjugating enzyme E2J 2 [Source:MGI Symbol;Acc:MGI:2153608])

HSP 1 Score: 130.568 bits (327), Expect = 2.127e-34
Identity = 60/147 (40.82%), Postives = 96/147 (65.31%), Query Frame = 3
Query:   33 NTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +++LA  S  F
Sbjct:    6 NKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKKQLAAQSLVF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. UniProt/SwissProt
Match: sp|Q9Y385|UB2J1_HUMAN (Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2)

HSP 1 Score: 278.87 bits (712), Expect = 1.015e-89
Identity = 130/185 (70.27%), Postives = 152/185 (82.16%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG----IKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PT+ +HA+PLEDNLFEWHFT+RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG     +   L+S +D+S AD  EAK LA QISF  E
Sbjct:    5 YNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQAD-QEAKELARQISFKAE 188          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. UniProt/SwissProt
Match: sp|Q9JJZ4|UB2J1_MOUSE (Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus OX=10090 GN=Ube2j1 PE=1 SV=2)

HSP 1 Score: 275.018 bits (702), Expect = 3.180e-88
Identity = 129/185 (69.73%), Postives = 151/185 (81.62%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGG----IKFVLRSLTDASVADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PT+ +HA+PLEDNLFEWHFT+RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+T +GRFE+ +KICLSISG+HPETW+PSWSIRTALLAIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG     +   L+S + +S AD  EAK LA QISF  E
Sbjct:    5 YNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSGSSQAD-QEAKELARQISFKAE 188          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. UniProt/SwissProt
Match: sp|Q9LSP7|UBC32_ARATH (Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana OX=3702 GN=UBC32 PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 5.425e-60
Identity = 88/143 (61.54%), Postives = 117/143 (81.82%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSD 455
            YN ++PAVKR+++E +E+ + P++ F + PLE+N+FEW F IRGP DT+++GGIYHGRI LPA+YP KPP+ +L+TP+GRFE N KICLSIS YHPE W+PSWS+RTAL+A+I FMPT   GA+GS+DYP +ERR LA  S +
Sbjct:    6 YNRKNPAVKRILQEVKEMQANPSDDFMSLPLEENIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKPPSFMLLTPNGRFETNTKICLSISNYHPEHWQPSWSVRTALVALIAFMPTSPNGALGSVDYPKDERRTLAIKSRE 148          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. UniProt/SwissProt
Match: sp|Q6FQK7|UBC6_CANGA (Ubiquitin-conjugating enzyme E2 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=UBC6 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 5.679e-37
Identity = 69/177 (38.98%), Postives = 102/177 (57.63%), Query Frame = 3
Query:   48 AVKRLMKEAQELSE-PTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEK 575
            A KRL KE + + E P     A+P E+N+ EWH+ I GP DT YDGG YHG +  P++YP KPP I ++TP+GRF+ N ++CLS+S YHP+TW P WS+ T L  ++ FM T      GS+    +E++ LAK S  +        K V   + + ++ ++   K     +S   +K
Sbjct:    6 AQKRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM-TGDESTTGSITTTQQEKKILAKKSMYYNTFNSTRFKLVFPEIVEKNITELQRRKQEEKDMSMFEKK 181          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. UniProt/SwissProt
Match: sp|O42646|UBC6_SCHPO (Ubiquitin-conjugating enzyme E2 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc6 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.012e-36
Identity = 64/138 (46.38%), Postives = 87/138 (63.04%), Query Frame = 3
Query:   48 AVKRLMKEAQELSE-PTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDF 458
            A KRLMKE   L + P EL  AKP  +N+ EWH+ I GP DT Y+GG YHG ++ P +YP KPP I ++TPSGRF+ N ++CLS S +HP++W PSW + T L+ ++ FM +  I   G +      RR  AK +  F
Sbjct:    6 AYKRLMKEYLALQKNPVELVDAKPATENILEWHYIITGPPDTPYEGGQYHGTLIFPPDYPFKPPAIRMITPSGRFQTNTRLCLSFSDFHPKSWNPSWMVSTILVGLVSFMTSDEI-TTGGIVTSESTRRTYAKDTKRF 142          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. TrEMBL
Match: A0A4S2LUH3 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005969 PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.224e-93
Identity = 139/194 (71.65%), Postives = 161/194 (82.99%), Query Frame = 3
Query:   24 MSYNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNNETIE 605
            ++YNTR+PAVKRL+KEAQEL+EPTEL+HA+PLEDNLFEWHFTIRGP DT++ GG+YHGRILLP+EYPMKPPNI+L+TP+GRFE +RKICLSISGYHPE+WRPSWSIRTALLAIIGFMPTHG GAIGSLD P EER+ LA+SS  F+C  CG    +LR LTDAS +   EA   ASQI+ TG     K  E  E
Sbjct:    3 VTYNTRNPAVKRLLKEAQELAEPTELYHAQPLEDNLFEWHFTIRGPEDTEFSGGVYHGRILLPSEYPMKPPNIVLLTPNGRFETHRKICLSISGYHPESWRPSWSIRTALLAIIGFMPTHGAGAIGSLDLPAEERKALARSSQSFVCDSCGPTSNLLRPLTDASRSVCIEAAEAASQIAMTGTGDGQKPTEMSE 196          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. TrEMBL
Match: V3ZR05 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_196190 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.580e-93
Identity = 133/190 (70.00%), Postives = 159/190 (83.68%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNNET 599
            Y+ RSPAVKRLMKEAQEL EPTE +H +PL+DNLFEWHFTIRGP D+D+DGGIYHGRI+LP +YPMKPP+I+L+TP+GRFE+ +KICLSISG+HPE+W+PSWSIRTALLAIIGFMPTHG GAIGSLDY PEER+ LAK S+D+ C  CG I  +L  +T AS     EAK LASQI+F GEK +D +  +
Sbjct:    5 YSMRSPAVKRLMKEAQELREPTEQYHVQPLDDNLFEWHFTIRGPADSDFDGGIYHGRIILPPDYPMKPPSIILLTPNGRFEVYKKICLSISGHHPESWQPSWSIRTALLAIIGFMPTHGAGAIGSLDYTPEERKVLAKKSNDWKCENCGCIGHILPPVTKASEKTTQEAKELASQIAFQGEKPKDGSQSS 194          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. TrEMBL
Match: A0A1I8GCM1 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 8.451e-93
Identity = 125/194 (64.43%), Postives = 168/194 (86.60%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCG------GIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNN 593
            +N+R+PAVKRLM+EA++L+ PTEL++A+PLEDNLFEWHFTIRGP+D+D++GG+YHGR+L+P +YPMKPPNI+L+TP+GRFEIN+KICLSISGYHPETWRP+WSIRTALLA++GFMPTHG+GAIG+L+YPPEERR+LA+ S D+ CP C        ++ +L  L+DAS  +  EA++LA +IS  GEK ++ ++
Sbjct:    2 HNSRNPAVKRLMREAKDLAAPTELYYAQPLEDNLFEWHFTIRGPVDSDFEGGVYHGRVLIPGDYPMKPPNIILLTPNGRFEINKKICLSISGYHPETWRPAWSIRTALLALVGFMPTHGLGAIGALEYPPEERRRLARQSRDWRCPICCPTPDSPSLESLLNPLSDASAKETEEARSLAKEISIAGEKPKESDD 195          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. TrEMBL
Match: A0A1I8GSJ0 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006777g1 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.909e-92
Identity = 125/194 (64.43%), Postives = 168/194 (86.60%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCG------GIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNN 593
            +N+R+PAVKRLM+EA++L+ PTEL++A+PLEDNLFEWHFTIRGP+D+D++GG+YHGR+L+P +YPMKPPNI+L+TP+GRFEIN+KICLSISGYHPETWRP+WSIRTALLA++GFMPTHG+GAIG+L+YPPEERR+LA+ S D+ CP C        ++ +L  L+DAS  +  EA++LA +IS  GEK ++ ++
Sbjct:    2 HNSRNPAVKRLMREAKDLAAPTELYYAQPLEDNLFEWHFTIRGPVDSDFEGGVYHGRVLIPGDYPMKPPNIILLTPNGRFEINKKICLSISGYHPETWRPAWSIRTALLALVGFMPTHGLGAIGALEYPPEERRRLARQSRDWRCPICCPTPDSPSLESLLNPLSDASAKETEEARSLAKEISIAGEKPKESDD 195          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. TrEMBL
Match: A0A0L8FSC7 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22009275mg PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.014e-91
Identity = 134/189 (70.90%), Postives = 162/189 (85.71%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNNE 596
            YN RSPAVKRLMKEAQEL +PTELF+A+PL+DNLFEWHFTIRGPIDTD+DGGI+HGRI+LP +YPMKPP+I+++TP+GRFE+N+KICLSISG+HPE+W+PSWSIRTALLAIIGFMPTHG GAIGSLDY  EER+ L+K S  + CP CG +  VL+SLTDAS     EAK+LAS+I+F  EK     ++
Sbjct:    5 YNMRSPAVKRLMKEAQELKDPTELFYAQPLDDNLFEWHFTIRGPIDTDFDGGIFHGRIVLPPDYPMKPPSIIILTPNGRFEVNKKICLSISGHHPESWQPSWSIRTALLAIIGFMPTHGAGAIGSLDYTAEERKVLSKKSLCWKCPVCGSVNNVLKSLTDASKKTSEEAKDLASKINFQSEKGNKSGSD 193          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Cavefish
Match: ube2j1 (ubiquitin conjugating enzyme E2 J1 [Source:NCBI gene;Acc:103030064])

HSP 1 Score: 263.077 bits (671), Expect = 2.341e-84
Identity = 115/149 (77.18%), Postives = 133/149 (89.26%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCG 476
            YN +SPAVKRLMKEA EL +PTE +HA+PLEDNLFEWHF++RGP D+D+DGGIYHGRI+LP EYPMKPP+I+L+TP+GRFE+ +KICLSISG+HPETW+PSWSIRTAL+AIIGFMPT G GAIGSLDY PEERR LAK S DF C  CG
Sbjct:    5 YNLKSPAVKRLMKEAAELRDPTEHYHAQPLEDNLFEWHFSVRGPPDSDFDGGIYHGRIVLPPEYPMKPPSIILLTPNGRFEVGKKICLSISGHHPETWQPSWSIRTALIAIIGFMPTKGEGAIGSLDYTPEERRALAKKSLDFCCEMCG 153          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Cavefish
Match: ube2j2 (ubiquitin conjugating enzyme E2 J2 [Source:NCBI gene;Acc:103045603])

HSP 1 Score: 132.494 bits (332), Expect = 2.864e-35
Identity = 61/147 (41.50%), Postives = 96/147 (65.31%), Query Frame = 3
Query:   33 NTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+    +R+LA  S  F
Sbjct:    6 NKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYLVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF---TKRQLASQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Cavefish
Match: ube2j2 (ubiquitin conjugating enzyme E2 J2 [Source:NCBI gene;Acc:103045603])

HSP 1 Score: 128.257 bits (321), Expect = 6.478e-34
Identity = 56/132 (42.42%), Postives = 89/132 (67.42%), Query Frame = 3
Query:   33 NTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDY 413
            N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + D+
Sbjct:    6 NKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYLVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDF 137          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Cavefish
Match: ube2d1b (ubiquitin conjugating enzyme E2 D1 [Source:NCBI gene;Acc:103029965])

HSP 1 Score: 73.1738 bits (178), Expect = 4.542e-15
Identity = 41/112 (36.61%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE Q+L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ ++   LL+I   +
Sbjct:    2 ALKRIQKELQDLQRDPPAQCSAGPVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---SQWSPALTVSKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Cavefish
Match: ube2d1a (ubiquitin-conjugating enzyme E2 D4-like [Source:NCBI gene;Acc:103029158])

HSP 1 Score: 70.0922 bits (170), Expect = 5.171e-14
Identity = 39/112 (34.82%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE Q+L  +P     A P+ ++LF W  TI GP D+ + GG++   I  P +YP KPP +   T      IN    ICL I       W P+ ++   LL+I   +
Sbjct:    2 AMKRIQKELQDLQRDPPSQCSAGPMGEDLFHWQATIMGPGDSPFQGGVFFLTIQFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---SQWSPALTVSKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 3.657e-13
Identity = 39/113 (34.51%), Postives = 54/113 (47.79%), Query Frame = 3
Query:   45 PAVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            P  + L +E  +L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ +I   LL+I   +
Sbjct:    2 PPTRPLHQELNDLGRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR---SQWSPALTISKVLLSICSLL 111          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Sea Lamprey
Match: ube2na (ubiquitin-conjugating enzyme E2Na [Source:ZFIN;Acc:ZDB-GENE-040426-2873])

HSP 1 Score: 53.9138 bits (128), Expect = 1.407e-9
Identity = 24/58 (41.38%), Postives = 33/58 (56.90%), Query Frame = 3
Query:   81 LSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMT 254
            L+EP     A+P E N   +H  I GP D+ ++GG +   + LP EYPM PP +  MT
Sbjct:   17 LAEPVPGIKAEPDESNARYFHVVIAGPADSPFEGGTFKLELFLPEEYPMAPPKVRFMT 74          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Sea Lamprey
Match: ube2t (ubiquitin-conjugating enzyme E2T (putative) [Source:NCBI gene;Acc:768152])

HSP 1 Score: 54.299 bits (129), Expect = 3.106e-9
Identity = 36/112 (32.14%), Postives = 54/112 (48.21%), Query Frame = 3
Query:   51 VKRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINR--KICLSISGYHPE-TWRPSWSIRTALLAIIGFM 374
            V RL +E + L SEP         ++   E    I G   T Y+GGI+   + +P  YP +PP +  +TP     I+   +ICL I    P+  WRPS ++ T L ++   M
Sbjct:    4 VSRLAREVERLASEPPPGVSCWLCDEASGELRAQILGGAGTPYEGGIFSLEVQIPDRYPFEPPKVTFLTPIYHPNIDTAGRICLDILKMPPKGAWRPSLNVSTVLTSVQQLM 115          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Sea Lamprey
Match: UBE2E1 (ubiquitin conjugating enzyme E2 E1 [Source:HGNC Symbol;Acc:HGNC:12477])

HSP 1 Score: 51.2174 bits (121), Expect = 1.375e-8
Identity = 30/91 (32.97%), Postives = 43/91 (47.25%), Query Frame = 3
Query:  108 AKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A P  DN++EW  TI GP  + Y+GG++   I    EYP     +   T      IN +  ICL I     + W P+ +I   LL+I   +
Sbjct:    3 AGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFNTAGVTFRTRIYHCNINSQGVICLDI---LKDNWSPALTISKVLLSICSLL 90          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Sea Lamprey
Match: UBE2E1 (ubiquitin conjugating enzyme E2 E1 [Source:HGNC Symbol;Acc:HGNC:12477])

HSP 1 Score: 50.8322 bits (120), Expect = 2.715e-8
Identity = 30/91 (32.97%), Postives = 43/91 (47.25%), Query Frame = 3
Query:  108 AKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A P  DN++EW  TI GP  + Y+GG++   I    EYP     +   T      IN +  ICL I     + W P+ +I   LL+I   +
Sbjct:    3 AGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFNTAGVTFRTRIYHCNINSQGVICLDI---LKDNWSPALTISKVLLSICSLL 90          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Yeast
Match: UBC6 (Ubiquitin-conjugating enzyme involved in ERAD; located at the cytosolic side of the ER membrane; tail region contains a transmembrane segment at the C-terminus; substrate of the ubiquitin-proteasome pathway; ER-associated protein degradation is also known as ERAD [Source:SGD;Acc:S000000902])

HSP 1 Score: 138.658 bits (348), Expect = 1.620e-38
Identity = 69/180 (38.33%), Postives = 103/180 (57.22%), Query Frame = 3
Query:   48 AVKRLMKEAQELSE-PTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKARD 584
            A KRL KE + + E P     A+P EDN+ EWH+ I GP DT Y GG YHG +  P++YP KPP I ++TP+GRF+ N ++CLS+S YHP+TW P WS+ T L  ++ FM T      GS+     +++ LA++S  +   Q    K +   +   +V  + + K      + TG++  D
Sbjct:    6 AHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM-TSDEATTGSITTSDHQKKTLARNSISYNTFQNVRFKLIFPEVVQENVETLEKRKLDEGDAANTGDETED 184          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Yeast
Match: UBC13 (E2 ubiquitin-conjugating enzyme; involved in the error-free DNA postreplication repair pathway; interacts with Mms2p to assemble ubiquitin chains at the Ub Lys-63 residue; DNA damage triggers redistribution from the cytoplasm to the nucleus [Source:SGD;Acc:S000002499])

HSP 1 Score: 68.1662 bits (165), Expect = 3.825e-14
Identity = 39/110 (35.45%), Postives = 62/110 (56.36%), Query Frame = 3
Query:   54 KRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINR--KICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            KR++KE ++L S+P     A+P +DNL  +  TI GP  + Y+ GI+   + LP +YPM+ P +  +T      I+R  +ICL +   +   W P+  IRT LL+I   +
Sbjct:    6 KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---WSPALQIRTVLLSIQALL 112          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 66.6254 bits (161), Expect = 1.165e-13
Identity = 38/110 (34.55%), Postives = 55/110 (50.00%), Query Frame = 3
Query:   54 KRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINR--KICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            KR+ KE  +L  +P     A P+ D+L+ W  +I GP D+ Y GG++   I  P +YP KPP I   T      IN    ICL I     + W P+ ++   LL+I   +
Sbjct:    5 KRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILK---DQWSPALTLSKVLLSICSLL 111          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Yeast
Match: UBC5 (Ubiquitin-conjugating enzyme; mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible; protein abundance increases in response to DNA replication stress; UBC5 has a paralog, UBC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002466])

HSP 1 Score: 66.2402 bits (160), Expect = 1.469e-13
Identity = 37/110 (33.64%), Postives = 55/110 (50.00%), Query Frame = 3
Query:   54 KRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            KR+ KE  +L  +P     A P+ D+L+ W  +I GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I     + W P+ ++   LL+I   +
Sbjct:    5 KRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILK---DQWSPALTLSKVLLSICSLL 111          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Yeast
Match: UBC7 (Ubiquitin conjugating enzyme; involved in the ER-associated protein degradation (ERAD) pathway and in the inner nuclear membrane-associated degradation (INMAD) pathway; requires Cue1p for recruitment to the ER membrane; proposed to be involved in chromatin assembly [Source:SGD;Acc:S000004624])

HSP 1 Score: 63.929 bits (154), Expect = 1.133e-12
Identity = 43/136 (31.62%), Postives = 67/136 (49.26%), Query Frame = 3
Query:   48 AVKRLMKEAQEL--SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPS---GRFEINRKICLSI---SGYHP-------ETWRPSWSIRTALLAIIGFMPTHGIGAIGSLD 410
            A KRL+KE Q+L    P  +      E+N+F W   I+GP DT Y  G+++ ++  P +YP+ PP  L  TPS        N ++C+SI    G  P       E W P  S+   LL+++  +    I +  ++D
Sbjct:    5 AQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPK-LTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Nematostella
Match: EDO38825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBT3])

HSP 1 Score: 208.764 bits (530), Expect = 1.739e-66
Identity = 92/127 (72.44%), Postives = 112/127 (88.19%), Query Frame = 3
Query:   63 MKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAK 443
            M+EA+EL   TEL+HA+PLEDNLFEWHFT+RGP DT++ GG YHGRI+LP EYPMKPP+I+L+TP+GRFEI +KICLS+S +HPETW+PSWSIRT L+AIIGFMPT G GAIG+LDY P+ER  LA+
Sbjct:    1 MREAKELRNATELYHAQPLEDNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLTPNGRFEIGKKICLSMSAHHPETWQPSWSIRTVLMAIIGFMPTKGAGAIGALDYTPKERAVLAR 127          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Nematostella
Match: EDO28988 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4X5])

HSP 1 Score: 129.413 bits (324), Expect = 8.988e-37
Identity = 54/72 (75.00%), Postives = 66/72 (91.67%), Query Frame = 3
Query:  123 DNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWS 338
            DNLFEWHFT+RGP DT++ GG YHGRI+LP EYPMKPP+I+L+TP+GRFEI +KICLS+S +HPETW+PSWS
Sbjct:    2 DNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLTPNGRFEIGKKICLSMSAHHPETWQPSWS 73          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Nematostella
Match: EDO38458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT8])

HSP 1 Score: 84.7297 bits (208), Expect = 5.832e-19
Identity = 33/80 (41.25%), Postives = 54/80 (67.50%), Query Frame = 3
Query:   48 AVKRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK 284
            A  RL ++   +  +P     A PL  N+ EWH+ +RGP +T Y+GG YHG+++ P ++P KPP+I ++TP+GRF++N +
Sbjct:   11 AAARLRQDYLRIVRDPVPYITAAPLPSNILEWHYVVRGPENTPYEGGFYHGKLVFPRDFPFKPPSIYMITPNGRFKVNTR 90          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 73.9442 bits (180), Expect = 6.993e-16
Identity = 43/112 (38.39%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE Q+L  +P     A P+ D+LF W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ +I   LL+I   M
Sbjct:    2 ALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINSNGSICLDILR---SQWSPALTISKVLLSICSLM 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Nematostella
Match: EDO40595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q0])

HSP 1 Score: 73.1738 bits (178), Expect = 1.702e-15
Identity = 41/110 (37.27%), Postives = 59/110 (53.64%), Query Frame = 3
Query:   54 KRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINR--KICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            +R++KE Q L +EP     A P E N   +H T+ GP D+ Y+GG +   + LP EYPM  P +  MT      I++  +ICL I     + W P+  IRT LL+I   +
Sbjct:    8 RRIIKETQRLVAEPVAGIQAVPDESNARYFHVTVNGPKDSPYEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILK---DKWSPALQIRTVLLSIQALL 114          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Medaka
Match: ube2j1 (ubiquitin conjugating enzyme E2 J1 [Source:NCBI gene;Acc:101160616])

HSP 1 Score: 265.388 bits (677), Expect = 2.279e-85
Identity = 122/184 (66.30%), Postives = 150/184 (81.52%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCG-GIKFVLRSLTDAS--VADVNEAKNLASQISFTGE 572
            YN +SPAVKRLMKEA EL +PTE +HA+PL+DNLFEWHF++RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+TP+GRFE+ +KICLSISG+HPETW+PSWSIRTAL+AIIGFMPT G GAIGSLDY PEER+ LAK S DF C  C   ++  L   T  S   A+ ++A+ LA QI+F  E
Sbjct:    5 YNLKSPAVKRLMKEAAELRDPTEHYHAQPLDDNLFEWHFSVRGPPDSDFDGGVYHGRIILPPEYPMKPPSIILLTPNGRFEVGKKICLSISGHHPETWQPSWSIRTALIAIIGFMPTKGEGAIGSLDYTPEERKALAKKSQDFCCESCSCSMRTALLPPTANSNPSAEDHKAQELAQQINFKAE 188          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Medaka
Match: ube2j1 (ubiquitin conjugating enzyme E2 J1 [Source:NCBI gene;Acc:101160616])

HSP 1 Score: 186.037 bits (471), Expect = 1.717e-54
Identity = 77/103 (74.76%), Postives = 96/103 (93.20%), Query Frame = 3
Query:   30 YNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWS 338
            YN +SPAVKRLMKEA EL +PTE +HA+PL+DNLFEWHF++RGP D+D+DGG+YHGRI+LP EYPMKPP+I+L+TP+GRFE+ +KICLSISG+HPETW+PSWS
Sbjct:    5 YNLKSPAVKRLMKEAAELRDPTEHYHAQPLDDNLFEWHFSVRGPPDSDFDGGVYHGRIILPPEYPMKPPSIILLTPNGRFEVGKKICLSISGHHPETWQPSWS 107          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Medaka
Match: ube2j2 (ubiquitin conjugating enzyme E2 J2 [Source:NCBI gene;Acc:101164303])

HSP 1 Score: 133.65 bits (335), Expect = 9.794e-36
Identity = 62/151 (41.06%), Postives = 98/151 (64.90%), Query Frame = 3
Query:   21 NMSYNTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            N + N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + DY    +R+L+  S  F
Sbjct:    2 NNAGNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDY---TKRQLSAQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Medaka
Match: ube2j2 (ubiquitin conjugating enzyme E2 J2 [Source:NCBI gene;Acc:101164303])

HSP 1 Score: 133.65 bits (335), Expect = 9.794e-36
Identity = 62/151 (41.06%), Postives = 98/151 (64.90%), Query Frame = 3
Query:   21 NMSYNTRSP--AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHG--IGAIGSLDYPPEERRKLAKSSSDF 458
            N + N R+P  A +RL ++   +  +P     A+PL  N+ EWH+ +RGP  T Y+GG YHG+++ P E+P KPP+I ++TP+GRF+ N ++CLSI+ +HP+TW P+WS+ T L  ++ FM   G  +G+I + DY    +R+L+  S  F
Sbjct:    2 NNAGNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDY---TKRQLSAQSLAF 149          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Medaka
Match: UBE2D2 (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:101158902])

HSP 1 Score: 70.0922 bits (170), Expect = 4.710e-14
Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ KE  +L+ +P     A P+ D++F W  TI GP D+ Y GG++   I  P +YP KPP +   T      IN    ICL I       W P+ +I   LL+I   +
Sbjct:    2 ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR---SQWSPALTISKVLLSICSLL 110          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Planmine SMEST
Match: SMESG000008271.1 (SMESG000008271.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 391/394 (99.24%), Postives = 393/394 (99.75%), Query Frame = 3
Query:   24 MSYNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNNETIELKTEVKXXXXXXXXXXXXXXXXXXXXXXXXNFTPFNSDXXXXXXXXXXXXXXSFEEWYYQVKCAEKTDAEKGDTETPLKSNRDNETTMPFQTNKXXXXXXXXXXXXXXXXXXXQLASAGFTDPIIDSALLDILPNEEIRQRNIPQQDSVPVVDSAARPNIDLASIRYRQSIIFKCIVFVAGVLGFILVARLNSMHSEIHN 1205
            MSYNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKA DKNNETIELKTEVKSQVSVQAAPSQQ+LLPQSDQLPQPNFTPFNSDQMMPLMPPMNLQPLSFEEWYYQVKCAEKTDAEKGDTETPLKSNRDNETT+PFQTNKISEEIPPIAPEIPLVVEEPQLASAGFTDPIIDSALLDILPNEEIRQRNIPQQDSVPVVDSAARPNIDLASIRYRQSIIFKCIVFVAGVLGFILVARLNSMHSEIHN
Sbjct:    1 MSYNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQCGGIKFVLRSLTDASVADVNEAKNLASQISFTGEKAGDKNNETIELKTEVKSQVSVQAAPSQQKLLPQSDQLPQPNFTPFNSDQMMPLMPPMNLQPLSFEEWYYQVKCAEKTDAEKGDTETPLKSNRDNETTVPFQTNKISEEIPPIAPEIPLVVEEPQLASAGFTDPIIDSALLDILPNEEIRQRNIPQQDSVPVVDSAARPNIDLASIRYRQSIIFKCIVFVAGVLGFILVARLNSMHSEIHN 394          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Planmine SMEST
Match: SMESG000064580.1 (SMESG000064580.1)

HSP 1 Score: 119.783 bits (299), Expect = 6.722e-31
Identity = 55/127 (43.31%), Postives = 77/127 (60.63%), Query Frame = 3
Query:   90 PTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFM----PTHGIGAIGSLDYPPEERRKLAKSSSDF 458
            P     A+PL  N+FEWH+ I GP D+DY GG YHG +    EYP K P+I ++TP+GRF+   ++CLSIS +H E+W PSW + T L  ++ FM    PT      GS+    E R +LA+ S ++
Sbjct:   20 PIPFIIAEPLSSNIFEWHYIIEGPKDSDYYGGFYHGYLKFSQEYPFKAPSIYMITPNGRFQCRTRLCLSISDFHQESWNPSWCVGTILTGLLSFMLEESPT-----FGSISSSKETRWQLARESLEY 141          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Planmine SMEST
Match: SMESG000054117.1 (SMESG000054117.1)

HSP 1 Score: 89.7373 bits (221), Expect = 7.595e-21
Identity = 47/139 (33.81%), Postives = 75/139 (53.96%), Query Frame = 3
Query:   54 KRLMKEAQEL-SEPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETWRPSWSIRTALLAIIGFMPTH---GIGAIGSLDYPPEERRKLAKSSSDF 458
            +RLM++ + + + P +    +   +NL  W++ + G   T + GG Y GRI L  +YP  PPN+ ++TP+GRF  N  +C S + +HPETW   ++     L +I FM      G+G I   D+  +   +LAK S  F
Sbjct:    9 QRLMRDIKMIKTNPVDGIRLEVDPENLLNWYYILEGSDGTPFKGGFYLGRITLSKDYPFNPPNVQMITPNGRFYPNVNLCFSYTNHHPETWSAVFNPSHVALGLISFMNDFIDTGVGCIH--DFTVQNIEELAKFSLKF 145          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Planmine SMEST
Match: SMESG000059645.1 (SMESG000059645.1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.181e-15
Identity = 48/135 (35.56%), Postives = 69/135 (51.11%), Query Frame = 3
Query:   48 AVKRLMKEAQELSE-PTELFHAKPL-EDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEI--NRKICLSI---------SGYHP-ETWRPSWSIRTALLAIIGFMPTHGIGAIGSLD 410
            ++K L KE +EL E P E F    L +DNLFEW   I GP  T Y+GG +   +  P +YP  PP++  +T      I  N  +C+SI         SG  P E W P+ ++RT LL++I  +    I +   +D
Sbjct:    8 SIKTLQKELKELKENPVEGFIVDLLSDDNLFEWQVAIFGPPKTLYEGGYFKAVLNFPCDYPYSPPSMKFITKMFHPNIFENGDVCISILHTPGDDPQSGELPSERWNPTQNVRTILLSVISMLNEPNINSAAHVD 142          
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Planmine SMEST
Match: SMESG000064169.1 (SMESG000064169.1)

HSP 1 Score: 72.7886 bits (177), Expect = 4.461e-15
Identity = 41/112 (36.61%), Postives = 59/112 (52.68%), Query Frame = 3
Query:   48 AVKRLMKEAQELS-EPTELFHAKPLEDNLFEWHFTIRGPIDTDYDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRK--ICLSISGYHPETWRPSWSIRTALLAIIGFM 374
            A+KR+ +E Q+L+ +P     A P+ ++LF W  TI GP D+ YDGG++   I  P +YP KPP +   T      IN    ICL I       W P+ +I   LL+I   +
Sbjct:    2 ALKRIGRELQDLAKDPPAQCSAGPMHEDLFHWQATIMGPNDSPYDGGVFFLDIQFPTDYPFKPPKVTFTTKIYHPNINANGSICLDILR---GQWSPALTISKVLLSICSLL 110          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2J12.113e-9070.27ubiquitin conjugating enzyme E2 J1 [Source:HGNC Sy... [more]
UBE2J24.415e-3541.38ubiquitin conjugating enzyme E2 J2 [Source:HGNC Sy... [more]
UBE2J23.035e-3441.38ubiquitin conjugating enzyme E2 J2 [Source:HGNC Sy... [more]
UBE2J23.035e-3441.38ubiquitin conjugating enzyme E2 J2 [Source:HGNC Sy... [more]
UBE2J24.429e-3037.27ubiquitin conjugating enzyme E2 J2 [Source:HGNC Sy... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubc-64.083e-8561.78UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-61.177e-7962.22UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-61.177e-7962.22UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-264.524e-3743.15UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-264.524e-3743.15UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58231.280e-3341.43gene:FBgn0038515 transcript:FBtr0321266[more]
CG58231.280e-3341.43gene:FBgn0038515 transcript:FBtr0083505[more]
CG54409.963e-1938.84gene:FBgn0031331 transcript:FBtr0343837[more]
CG54409.963e-1938.84gene:FBgn0031331 transcript:FBtr0305552[more]
eff1.356e-1437.50gene:FBgn0011217 transcript:FBtr0310554[more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2j15.951e-8666.48ubiquitin-conjugating enzyme E2, J1 [Source:ZFIN;A... [more]
ube2j23.183e-3541.50ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog,... [more]
ube2j23.220e-3045.71ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog,... [more]
ube2d1b5.360e-1536.61ubiquitin-conjugating enzyme E2D 1b [Source:ZFIN;A... [more]
ube2d1a7.972e-1536.61ubiquitin-conjugating enzyme E2D 1a [Source:ZFIN;A... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2j11.856e-8668.68ubiquitin conjugating enzyme E2 J1 [Source:NCBI ge... [more]
ube2j26.386e-2544.44ubiquitin conjugating enzyme E2 J2 [Source:NCBI ge... [more]
chmp2b2.375e-1435.71charged multivesicular body protein 2B [Source:Xen... [more]
ube2d31.384e-1335.71ubiquitin conjugating enzyme E2 D3 [Source:NCBI ge... [more]
chmp2b1.661e-1335.65charged multivesicular body protein 2B [Source:Xen... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2j14.546e-8969.73ubiquitin-conjugating enzyme E2J 1 [Source:MGI Sym... [more]
Ube2j12.814e-7969.23ubiquitin-conjugating enzyme E2J 1 [Source:MGI Sym... [more]
Ube2j11.299e-4766.67ubiquitin-conjugating enzyme E2J 1 [Source:MGI Sym... [more]
Ube2j22.127e-3440.82ubiquitin-conjugating enzyme E2J 2 [Source:MGI Sym... [more]
Ube2j22.127e-3440.82ubiquitin-conjugating enzyme E2J 2 [Source:MGI Sym... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y385|UB2J1_HUMAN1.015e-8970.27Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens... [more]
sp|Q9JJZ4|UB2J1_MOUSE3.180e-8869.73Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus... [more]
sp|Q9LSP7|UBC32_ARATH5.425e-6061.54Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis ... [more]
sp|Q6FQK7|UBC6_CANGA5.679e-3738.98Ubiquitin-conjugating enzyme E2 6 OS=Candida glabr... [more]
sp|O42646|UBC6_SCHPO1.012e-3646.38Ubiquitin-conjugating enzyme E2 6 OS=Schizosacchar... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LUH34.224e-9371.65UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
V3ZR054.580e-9370.00UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A1I8GCM18.451e-9364.43UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A1I8GSJ01.909e-9264.43UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A0L8FSC71.014e-9170.90UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2j12.341e-8477.18ubiquitin conjugating enzyme E2 J1 [Source:NCBI ge... [more]
ube2j22.864e-3541.50ubiquitin conjugating enzyme E2 J2 [Source:NCBI ge... [more]
ube2j26.478e-3442.42ubiquitin conjugating enzyme E2 J2 [Source:NCBI ge... [more]
ube2d1b4.542e-1536.61ubiquitin conjugating enzyme E2 D1 [Source:NCBI ge... [more]
ube2d1a5.171e-1434.82ubiquitin-conjugating enzyme E2 D4-like [Source:NC... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010378.13.657e-1334.51pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ube2na1.407e-941.38ubiquitin-conjugating enzyme E2Na [Source:ZFIN;Acc... [more]
ube2t3.106e-932.14ubiquitin-conjugating enzyme E2T (putative) [Sourc... [more]
UBE2E11.375e-832.97ubiquitin conjugating enzyme E2 E1 [Source:HGNC Sy... [more]
UBE2E12.715e-832.97ubiquitin conjugating enzyme E2 E1 [Source:HGNC Sy... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC61.620e-3838.33Ubiquitin-conjugating enzyme involved in ERAD; loc... [more]
UBC133.825e-1435.45E2 ubiquitin-conjugating enzyme; involved in the e... [more]
UBC41.165e-1334.55Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
UBC51.469e-1333.64Ubiquitin-conjugating enzyme; mediates selective d... [more]
UBC71.133e-1231.62Ubiquitin conjugating enzyme; involved in the ER-a... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388251.739e-6672.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289888.988e-3775.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384585.832e-1941.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436696.993e-1638.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405951.702e-1537.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2j12.279e-8566.30ubiquitin conjugating enzyme E2 J1 [Source:NCBI ge... [more]
ube2j11.717e-5474.76ubiquitin conjugating enzyme E2 J1 [Source:NCBI ge... [more]
ube2j29.794e-3641.06ubiquitin conjugating enzyme E2 J2 [Source:NCBI ge... [more]
ube2j29.794e-3641.06ubiquitin conjugating enzyme E2 J2 [Source:NCBI ge... [more]
UBE2D24.710e-1435.71ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 J1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008271.10.000e+099.24SMESG000008271.1[more]
SMESG000064580.16.722e-3143.31SMESG000064580.1[more]
SMESG000054117.17.595e-2133.81SMESG000054117.1[more]
SMESG000059645.14.181e-1535.56SMESG000059645.1[more]
SMESG000064169.14.461e-1536.61SMESG000064169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017397 ID=SMED30017397|Name=Ubiquitin-conjugating enzyme E2 J1|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
ACATAAACGTATTATTTTGAAATATGAGTTATAATACCAGAAGTCCAGCT
GTAAAACGACTTATGAAAGAGGCTCAAGAACTGTCTGAGCCTACTGAGTT
ATTTCATGCCAAACCCTTAGAAGATAATTTGTTCGAGTGGCACTTTACAA
TTAGAGGCCCAATAGATACTGACTATGACGGAGGAATTTATCACGGACGA
ATACTTCTACCTGCTGAATATCCAATGAAGCCTCCAAATATATTATTAAT
GACACCAAGTGGTAGATTTGAAATCAATCGTAAAATATGTCTAAGCATAT
CTGGATATCATCCTGAGACTTGGCGTCCCTCGTGGTCCATTAGGACAGCA
CTATTAGCCATTATTGGATTTATGCCTACTCATGGTATCGGAGCAATTGG
ATCTCTCGATTATCCACCTGAAGAAAGGCGTAAATTAGCTAAAAGTTCAT
CAGATTTTATCTGTCCGCAATGTGGTGGAATTAAATTTGTACTCAGATCT
TTGACAGACGCCTCTGTGGCTGATGTGAACGAAGCGAAAAATTTGGCATC
TCAAATATCATTTACGGGTGAGAAAGCCAGGGACAAAAACAATGAAACTA
TCGAACTGAAAACAGAAGTTAAAAGCCAAGTCAGCGTCCAAGCAGCGCCC
TCTCAACAGCAACTATTACCTCAATCAGATCAACTTCCCCAACCGAATTT
CACACCTTTCAACAGCGACCAAATGATGCCTTTGATGCCGCCAATGAACC
TTCAGCCGTTGTCATTTGAAGAGTGGTATTATCAAGTGAAATGTGCTGAG
AAGACCGACGCAGAGAAAGGCGACACAGAGACTCCATTGAAATCCAATAG
GGACAATGAAACAACTATGCCTTTTCAAACCAACAAAATATCCGAAGAAA
TCCCGCCAATCGCTCCCGAAATCCCATTAGTAGTTGAGGAACCTCAATTG
GCATCAGCTGGATTCACTGATCCAATTATTGATTCAGCACTTCTAGATAT
TCTGCCGAATGAAGAAATACGCCAGAGAAATATCCCGCAACAGGACTCCG
TACCGGTGGTGGACAGTGCTGCCAGACCCAATATCGATCTCGCGTCAATC
CGATATCGGCAGAGCATCATTTTCAAGTGCATAGTATTTGTTGCAGGAGT
GCTTGGTTTCATTCTAGTTGCCAGACTGAATAGCATGCACAGTGAAATCC
ATAATTGATTGATTAGTCATTCAGAAATGCTAAAAATAGATTGATTTCTA
AATAAACTTCCTTGTTGGTTCCTCTATATTTTTGTTATTAAACATTTTAT
TCTGTAGCACATTGATTGGTTCTCATTGTCGAGATTAATATAATGGAGGT
ATGCTTAGTTCTTTTTAGTATAATAATCAATAATGAG
back to top

protein sequence of SMED30017397-orf-1

>SMED30017397-orf-1 ID=SMED30017397-orf-1|Name=SMED30017397-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MSYNTRSPAVKRLMKEAQELSEPTELFHAKPLEDNLFEWHFTIRGPIDTD
YDGGIYHGRILLPAEYPMKPPNILLMTPSGRFEINRKICLSISGYHPETW
RPSWSIRTALLAIIGFMPTHGIGAIGSLDYPPEERRKLAKSSSDFICPQC
GGIKFVLRSLTDASVADVNEAKNLASQISFTGEKARDKNNETIELKTEVK
SQVSVQAAPSQQQLLPQSDQLPQPNFTPFNSDQMMPLMPPMNLQPLSFEE
WYYQVKCAEKTDAEKGDTETPLKSNRDNETTMPFQTNKISEEIPPIAPEI
PLVVEEPQLASAGFTDPIIDSALLDILPNEEIRQRNIPQQDSVPVVDSAA
RPNIDLASIRYRQSIIFKCIVFVAGVLGFILVARLNSMHSEIHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000608UBQ-conjugat_E2
IPR016135UBQ-conjugating_enzyme/RWD
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 11..148
e-value: 3.9E-26
score: 102.8
NoneNo IPR availablePANTHERPTHR24068:SF168UBIQUITIN-CONJUGATING ENZYME E2 J1coord: 5..230
NoneNo IPR availablePANTHERPTHR24068FAMILY NOT NAMEDcoord: 5..230
NoneNo IPR availableTMHMMTMhelixcoord: 364..386
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 12..117
e-value: 2.0E-18
score: 66.4
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 11..117
score: 23.65
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 10..117
e-value: 1.19643E-41
score: 141.571
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 1..181
e-value: 1.7E-57
score: 195.9
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 9..119