Sodium bicarbonate transporter-like protein 11

Overview
NameSodium bicarbonate transporter-like protein 11
Smed IDSMED30017389
Length (bp)2473
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium bicarbonate transporter-like protein 11 (SMED30017389) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium bicarbonate transporter-like protein 11 (SMED30017389) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017389

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017389SMESG000012150.1 SmedASXL_016361SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30017389SMESG000012150.1 dd_Smed_v4_11216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017389SMESG000012150.1 dd_Smed_v4_11216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017389SMESG000012150.1 dd_Smed_v6_11216_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30017389SMESG000012150.1 Contig53109newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30017389SMESG000012150.1 Contig53109uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017389SMESG000012150.1 Contig53109newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017389SMESG000012150.1 Contig53109uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017389SMESG000012150.1 Contig42420newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017389SMESG000012150.1 Contig42420uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30017389SMESG000012150.1 dd_Smed_v4_11216_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017389SMESG000012150.1 dd_Smed_v4_11216_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30017389SMESG000012150.1 dd_Smed_v4_11216_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 447.203 bits (1149), Expect = 1.067e-143
Identity = 294/802 (36.66%), Postives = 439/802 (54.74%), Query Frame = 1
Query:  130 VTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDK------LDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQ------NSKPKSDNXXXXXXXXXXLHNK---------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG--------------------GHCVNATI------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGL---------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             T+G   L+ T  +   +    EEIRA  D + F   ASIVLN    +T   + ++L+ M     RD D       LDL + + F +   +     G     + TI G      GV     SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +      ET   + FKE  V  +      +  P +  ++         H           V  G+GI +D   R P Y  D+ D  + KN ++ K ITT   L+F+ LLPTIAFG LN+  T+  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL+L I     +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG                    G  +NA++      +   S T+  S          ++L + L  L          ++P+L+   R++LS+ ALP++VL  S I S+ F+E+++  F   P  +   +A  I+ L +  +  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+  D  +V V ETR+  + A++L+G  + L+P PL +IP PVL GLFLY+A T+L  NQL +R+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K++FP I+I  +P R+I+ P+II  KYLD +D
Sbjct:   84 ATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLN----ETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTD---AGAPMRGKVHLLSDTIQGVTATVTGVRYQQ-SWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKL-----LETRTEEEFKEALVHQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMA-QIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYD-TIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 870          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 447.203 bits (1149), Expect = 1.427e-143
Identity = 294/802 (36.66%), Postives = 439/802 (54.74%), Query Frame = 1
Query:  130 VTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDK------LDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQ------NSKPKSDNXXXXXXXXXXLHNK---------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG--------------------GHCVNATI------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGL---------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             T+G   L+ T  +   +    EEIRA  D + F   ASIVLN    +T   + ++L+ M     RD D       LDL + + F +   +     G     + TI G      GV     SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +      ET   + FKE  V  +      +  P +  ++         H           V  G+GI +D   R P Y  D+ D  + KN ++ K ITT   L+F+ LLPTIAFG LN+  T+  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL+L I     +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG                    G  +NA++      +   S T+  S          ++L + L  L          ++P+L+   R++LS+ ALP++VL  S I S+ F+E+++  F   P  +   +A  I+ L +  +  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+  D  +V V ETR+  + A++L+G  + L+P PL +IP PVL GLFLY+A T+L  NQL +R+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K++FP I+I  +P R+I+ P+II  KYLD +D
Sbjct:  100 ATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLN----ETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTD---AGAPMRGKVHLLSDTIQGVTATVTGVRYQQ-SWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKL-----LETRTEEEFKEALVHQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMA-QIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYD-TIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 886          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 446.432 bits (1147), Expect = 6.676e-143
Identity = 294/802 (36.66%), Postives = 439/802 (54.74%), Query Frame = 1
Query:  130 VTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDK------LDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQ------NSKPKSDNXXXXXXXXXXLHNK---------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG--------------------GHCVNATI------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGL---------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             T+G   L+ T  +   +    EEIRA  D + F   ASIVLN    +T   + ++L+ M     RD D       LDL + + F +   +     G     + TI G      GV     SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +      ET   + FKE  V  +      +  P +  ++         H           V  G+GI +D   R P Y  D+ D  + KN ++ K ITT   L+F+ LLPTIAFG LN+  T+  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL+L I     +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG                    G  +NA++      +   S T+  S          ++L + L  L          ++P+L+   R++LS+ ALP++VL  S I S+ F+E+++  F   P  +   +A  I+ L +  +  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+  D  +V V ETR+  + A++L+G  + L+P PL +IP PVL GLFLY+A T+L  NQL +R+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K++FP I+I  +P R+I+ P+II  KYLD +D
Sbjct:  127 ATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLN----ETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTD---AGAPMRGKVHLLSDTIQGVTATVTGVRYQQ-SWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKL-----LETRTEEEFKEALVHQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMA-QIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYD-TIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 913          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 435.261 bits (1118), Expect = 2.211e-139
Identity = 284/768 (36.98%), Postives = 424/768 (55.21%), Query Frame = 1
Query:  232 SLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDK------LDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQ------NSKPKSDNXXXXXXXXXXLHNK---------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG--------------------GHCVNATI------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGL---------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            S  ASIVLN    +T   + ++L+ M     RD D       LDL + + F +   +     G     + TI G      GV     SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +      ET   + FKE  V  +      +  P +  ++         H           V  G+GI +D   R P Y  D+ D  + KN ++ K ITT   L+F+ LLPTIAFG LN+  T+  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL+L I     +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG                    G  +NA++      +   S T+  S          ++L + L  L          ++P+L+   R++LS+ ALP++VL  S I S+ F+E+++  F   P  +   +A  I+ L +  +  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+  D  +V V ETR+  + A++L+G  + L+P PL +IP PVL GLFLY+A T+L  NQL +R+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K++FP I+I  +P R+I+ P+II  KYLD +D
Sbjct:   95 SRKASIVLN----ETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTD---AGAPMRGKVHLLSDTIQGVTATVTGVRYQQ-SWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKL-----LETRTEEEFKEALVHQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMA-QIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYD-TIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 847          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 390.963 bits (1003), Expect = 1.208e-122
Identity = 277/802 (34.54%), Postives = 416/802 (51.87%), Query Frame = 1
Query:  130 VTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDK------LDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQ------NSKPKSDNXXXXXXXXXXLHNK---------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG--------------------GHCVNATI------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGL---------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             T+G   L+ T  +   +    EEIRA  D + F   ASIVLN    +T   + ++L+ M     RD D       LDL + + F +   +     G     + TI G      GV     SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +      ET   + FKE  V  +      +  P +  ++         H           V  G+GI +D   R P Y  D+ D  + KN ++ K ITT   L+F+ LLPTIAFG LN+  T+  I +                                 +I   Y ++      F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG                    G  +NA++      +   S T+  S          ++L + L  L          ++P+L+   R++LS+ ALP++VL  S I S+ F+E+++  F   P  +   +A  I+ L +  +  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+  D  +V V ETR+  + A++L+G  + L+P PL +IP PVL GLFLY+A T+L  NQL +R+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K++FP I+I  +P R+I+ P+II  KYLD +D
Sbjct:   84 ATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLN----ETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTD---AGAPMRGKVHLLSDTIQGVTATVTGVRYQQ-SWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKL-----LETRTEEEFKEALVHQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIVIR--------------------------------VICDDYDLD------FNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMA-QIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYD-TIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 832          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 462.996 bits (1190), Expect = 4.000e-151
Identity = 288/759 (37.94%), Postives = 437/759 (57.58%), Query Frame = 1
Query:  199 EIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGF--EHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTI---RGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLG-RGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-----------------------------YGGHCVNATIAVTGS-CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIF-LMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            EIRA  D +     A ++L+      E I   ++ +M      D  + + + E   + L     D    +   ++T+         GG    D +W+ A+  L+ + HR V      HP N+G +   ++ + IVIAP + K  K  +ET+R  A + +D E RQ +   +  +   +T   A KE A+     + +  +    H +      +     RG+ ++F+ RL  Y SDY D      ++ K  +T+  L+F+ LLP IAFG+LN+  T   INV   ++AQ IGG+ F+LFGGQPMII+LTT PL++ I   + ++  LGY FL  Y  +G+F  ++L +YS T    +MKF+ RS EE F LF+++ F V+S++A   SF   Y                              G    + +I  TGS C ++ S+L++LL+ GT+ LGL+L    +TP+L    R+ L+++ALP SVL MSF GSY F +++   F       +  +A D+  LP +G  +   + F LS LFF++QNI S+IVN   NKLKKG +++ DL VV ++N+ LS+FGLPW+HGALPHSP+H+ ALA +EE + +G+ + + ++ V ETR+  +IA+++I   +F L+PYPL  IP  VL+GLFLYMA T+L  N++FERLLL ITEQ AYPP HY+++VPQ+KVH+FT+ Q LQL++LC  GF+P  ++++VFP +    LP RH + P++I  KYLDALD
Sbjct:   46 EIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEM------DIQEPEFTSEQVRSVLF--TQDAGNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMA-DVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 794          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 461.84 bits (1187), Expect = 8.281e-150
Identity = 286/759 (37.68%), Postives = 437/759 (57.58%), Query Frame = 1
Query:  199 EIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGF--EHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTI---RGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLG-RGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-----------------------------YGGHCVNATIAVTGS-CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIF-LMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            EIRA  D +     A ++L+        + +  L+++F   I + D  +          ++   D    +   ++T+         GG    D +W+ A+  L+ + HR V      HP N+G +   ++ + IVIAP + K  K  +ET+R  A + +D E RQ +   +  +   +T   A KE A+     + +  +    H +      +     RG+ ++F+ RL  Y SDY D      ++ K  +T+  L+F+ LLP IAFG+LN+  T   INV   ++AQ IGG+ F+LFGGQPMII+LTT PL++ I   + ++  LGY FL  Y  +G+F  ++L +YS T    +MKF+ RS EE F LF+++ F V+S++A   SF   Y                              G    + +I  TGS C ++ S+L++LL+ GT+ LGL+L    +TP+L    R+ L+++ALP SVL MSF GSY F +++   F       +  +A D+  LP +G  +   + F LS LFF++QNI S+IVN   NKLKKG +++ DL VV ++N+ LS+FGLPW+HGALPHSP+H+ ALA +EE + +G+ + + ++ V ETR+  +IA+++I   +F L+PYPL  IP  VL+GLFLYMA T+L  N++FERLLL ITEQ AYPP HY+++VPQ+KVH+FT+ Q LQL++LC  GF+P  ++++VFP +    LP RH + P++I  KYLDALD
Sbjct:  127 EIRATMDIDHLLNKAVLLLD--------LQETSLEEIFAKIIHEMDIQEPEFTSEQVRSVLFTQDAGNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMA-DVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 875          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 461.84 bits (1187), Expect = 1.203e-149
Identity = 288/759 (37.94%), Postives = 437/759 (57.58%), Query Frame = 1
Query:  199 EIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGF--EHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTI---RGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLG-RGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-----------------------------YGGHCVNATIAVTGS-CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIF-LMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            EIRA  D +     A ++L+      E I   ++ +M      D  + + + E   + L     D    +   ++T+         GG    D +W+ A+  L+ + HR V      HP N+G +   ++ + IVIAP + K  K  +ET+R  A + +D E RQ +   +  +   +T   A KE A+     + +  +    H +      +     RG+ ++F+ RL  Y SDY D      ++ K  +T+  L+F+ LLP IAFG+LN+  T   INV   ++AQ IGG+ F+LFGGQPMII+LTT PL++ I   + ++  LGY FL  Y  +G+F  ++L +YS T    +MKF+ RS EE F LF+++ F V+S++A   SF   Y                              G    + +I  TGS C ++ S+L++LL+ GT+ LGL+L    +TP+L    R+ L+++ALP SVL MSF GSY F +++   F       +  +A D+  LP +G  +   + F LS LFF++QNI S+IVN   NKLKKG +++ DL VV ++N+ LS+FGLPW+HGALPHSP+H+ ALA +EE + +G+ + + ++ V ETR+  +IA+++I   +F L+PYPL  IP  VL+GLFLYMA T+L  N++FERLLL ITEQ AYPP HY+++VPQ+KVH+FT+ Q LQL++LC  GF+P  ++++VFP +    LP RH + P++I  KYLDALD
Sbjct:  139 EIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEM------DIQEPEFTSEQVRSVLF--TQDAGNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMA-DVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 887          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 465.692 bits (1197), Expect = 2.418e-149
Identity = 296/812 (36.45%), Postives = 457/812 (56.28%), Query Frame = 1
Query:   46 NKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPF--LSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGF--EHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTI---RGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLG-RGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-----------------------------YGGHCVNATIAVTGS-CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIF-LMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            ++ F   + D  S + P D   T+ +    N ++ + +   +   +P      EIRA  D +     A ++L+      E I   ++ +M      D  + + + E   + L     D    +   ++T+         GG    D +W+ A+  L+ + HR V      HP N+G +   ++ + IVIAP + K  K  +ET+R  A + +D E RQ +   +  +   +T   A KE A+     + +  +    H +      +     RG+ ++F+ RL  Y SDY D      ++ K  +T+  L+F+ LLP IAFG+LN+  T   INV   ++AQ IGG+ F+LFGGQPMII+LTT PL++ I   + ++  LGY FL  Y  +G+F  ++L +YS T    +MKF+ RS EE F LF+++ F V+S++A   SF   Y                              G    + +I  TGS C ++ S+L++LL+ GT+ LGL+L    +TP+L    R+ L+++ALP SVL MSF GSY F +++   F       +  +A D+  LP +G  +   + F LS LFF++QNI S+IVN   NKLKKG +++ DL VV ++N+ LS+FGLPW+HGALPHSP+H+ ALA +EE + +G+ + + ++ V ETR+  +IA+++I   +F L+PYPL  IP  VL+GLFLYMA T+L  N++FERLLL ITEQ AYPP HY+++VPQ+KVH+FT+ Q LQL++LC  GF+P  ++++VFP +    LP RH + P++I  KYLDALD
Sbjct:  242 SQPFLAEDRDFDSDTPPLD---TLSWSNAGNEYDNVTLMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEM------DIQEPEFTSEQVRSVLFT--QDAGNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMA-DVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 1040          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 461.455 bits (1186), Expect = 1.210e-148
Identity = 286/759 (37.68%), Postives = 437/759 (57.58%), Query Frame = 1
Query:  199 EIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGF--EHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTI---RGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLG-RGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-----------------------------YGGHCVNATIAVTGS-CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIF-LMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            EIRA  D +     A ++L+        + +  L+++F   I + D  +          ++   D    +   ++T+         GG    D +W+ A+  L+ + HR V      HP N+G +   ++ + IVIAP + K  K  +ET+R  A + +D E RQ +   +  +   +T   A KE A+     + +  +    H +      +     RG+ ++F+ RL  Y SDY D      ++ K  +T+  L+F+ LLP IAFG+LN+  T   INV   ++AQ IGG+ F+LFGGQPMII+LTT PL++ I   + ++  LGY FL  Y  +G+F  ++L +YS T    +MKF+ RS EE F LF+++ F V+S++A   SF   Y                              G    + +I  TGS C ++ S+L++LL+ GT+ LGL+L    +TP+L    R+ L+++ALP SVL MSF GSY F +++   F       +  +A D+  LP +G  +   + F LS LFF++QNI S+IVN   NKLKKG +++ DL VV ++N+ LS+FGLPW+HGALPHSP+H+ ALA +EE + +G+ + + ++ V ETR+  +IA+++I   +F L+PYPL  IP  VL+GLFLYMA T+L  N++FERLLL ITEQ AYPP HY+++VPQ+KVH+FT+ Q LQL++LC  GF+P  ++++VFP +    LP RH + P++I  KYLDALD
Sbjct:  208 EIRATMDIDHLLNKAVLLLD--------LQETSLEEIFAKIIHEMDIQEPEFTSEQVRSVLFTQDAGNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMA-DVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 956          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0299537)

HSP 1 Score: 171.014 bits (432), Expect = 2.129e-43
Identity = 152/546 (27.84%), Postives = 258/546 (47.25%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV---VDSVKACTKSF--HNYYYGGHCV-----NATIA-----------------VTGSC----TKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYV---FKEVKIHSFTAPPWRNIS-MIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            G+  D + + P Y SDYKDA        + + +   L+F+ L P I FG L    T   +     L++  + G+G+  F GQP+ I+ +T P+ +  +  Y     +G+ ++ F  WIG++ A    V +    S ++ +  R TEE F   ++  F+   +++V    K+F  +   Y   C      NA++                  V G C    T+   L+ V+L  GT  +   L       F  S+ R+ +S+F++ +++  MSF    +    +++++ +   P       +I   + + P    ++A   A   +IL FM+Q I + IVN   NKLKKG  YH DL ++ I+  I S+ GLPW   A   S  HV +L    E    G K   + + V E R+  I+  + IG  + L P  L  IP PVL G+FLYM   +L   Q F+R+L+        P   +L++VP K+VH+FT IQ   L++L +      +   ++FP +L++ +  R  +   + +++ L  LD ++
Sbjct:  416 GLINDIKRKAPWYISDYKDALS-----MQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEK--PQFLGVREQRVTHILIFLTIGVSVLLTPL-LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWL--IKSFSQTSILFPLMLVVMIGIRKAL-DLVFTRRELKILDDIM 950          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0331662)

HSP 1 Score: 170.629 bits (431), Expect = 2.462e-43
Identity = 152/546 (27.84%), Postives = 258/546 (47.25%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV---VDSVKACTKSF--HNYYYGGHCV-----NATIA-----------------VTGSC----TKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYV---FKEVKIHSFTAPPWRNIS-MIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            G+  D + + P Y SDYKDA        + + +   L+F+ L P I FG L    T   +     L++  + G+G+  F GQP+ I+ +T P+ +  +  Y     +G+ ++ F  WIG++ A    V +    S ++ +  R TEE F   ++  F+   +++V    K+F  +   Y   C      NA++                  V G C    T+   L+ V+L  GT  +   L       F  S+ R+ +S+F++ +++  MSF    +    +++++ +   P       +I   + + P    ++A   A   +IL FM+Q I + IVN   NKLKKG  YH DL ++ I+  I S+ GLPW   A   S  HV +L    E    G K   + + V E R+  I+  + IG  + L P  L  IP PVL G+FLYM   +L   Q F+R+L+        P   +L++VP K+VH+FT IQ   L++L +      +   ++FP +L++ +  R  +   + +++ L  LD ++
Sbjct:  439 GLINDIKRKAPWYISDYKDALS-----MQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEK--PQFLGVREQRVTHILIFLTIGVSVLLTPL-LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWL--IKSFSQTSILFPLMLVVMIGIRKAL-DLVFTRRELKILDDIM 973          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0331660)

HSP 1 Score: 170.629 bits (431), Expect = 2.693e-43
Identity = 152/546 (27.84%), Postives = 258/546 (47.25%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV---VDSVKACTKSF--HNYYYGGHCV-----NATIA-----------------VTGSC----TKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYV---FKEVKIHSFTAPPWRNIS-MIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            G+  D + + P Y SDYKDA        + + +   L+F+ L P I FG L    T   +     L++  + G+G+  F GQP+ I+ +T P+ +  +  Y     +G+ ++ F  WIG++ A    V +    S ++ +  R TEE F   ++  F+   +++V    K+F  +   Y   C      NA++                  V G C    T+   L+ V+L  GT  +   L       F  S+ R+ +S+F++ +++  MSF    +    +++++ +   P       +I   + + P    ++A   A   +IL FM+Q I + IVN   NKLKKG  YH DL ++ I+  I S+ GLPW   A   S  HV +L    E    G K   + + V E R+  I+  + IG  + L P  L  IP PVL G+FLYM   +L   Q F+R+L+        P   +L++VP K+VH+FT IQ   L++L +      +   ++FP +L++ +  R  +   + +++ L  LD ++
Sbjct:  413 GLINDIKRKAPWYISDYKDALS-----MQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEK--PQFLGVREQRVTHILIFLTIGVSVLLTPL-LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWL--IKSFSQTSILFPLMLVVMIGIRKAL-DLVFTRRELKILDDIM 947          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0331659)

HSP 1 Score: 170.244 bits (430), Expect = 3.889e-43
Identity = 152/546 (27.84%), Postives = 258/546 (47.25%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV---VDSVKACTKSF--HNYYYGGHCV-----NATIA-----------------VTGSC----TKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYV---FKEVKIHSFTAPPWRNIS-MIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            G+  D + + P Y SDYKDA        + + +   L+F+ L P I FG L    T   +     L++  + G+G+  F GQP+ I+ +T P+ +  +  Y     +G+ ++ F  WIG++ A    V +    S ++ +  R TEE F   ++  F+   +++V    K+F  +   Y   C      NA++                  V G C    T+   L+ V+L  GT  +   L       F  S+ R+ +S+F++ +++  MSF    +    +++++ +   P       +I   + + P    ++A   A   +IL FM+Q I + IVN   NKLKKG  YH DL ++ I+  I S+ GLPW   A   S  HV +L    E    G K   + + V E R+  I+  + IG  + L P  L  IP PVL G+FLYM   +L   Q F+R+L+        P   +L++VP K+VH+FT IQ   L++L +      +   ++FP +L++ +  R  +   + +++ L  LD ++
Sbjct:  472 GLINDIKRKAPWYISDYKDALS-----MQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEK--PQFLGVREQRVTHILIFLTIGVSVLLTPL-LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWL--IKSFSQTSILFPLMLVVMIGIRKAL-DLVFTRRELKILDDIM 1006          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Fly
Match: Ndae1 (gene:FBgn0259111 transcript:FBtr0299538)

HSP 1 Score: 170.244 bits (430), Expect = 4.101e-43
Identity = 152/546 (27.84%), Postives = 258/546 (47.25%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV---VDSVKACTKSF--HNYYYGGHCV-----NATIA-----------------VTGSC----TKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYV---FKEVKIHSFTAPPWRNIS-MIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            G+  D + + P Y SDYKDA        + + +   L+F+ L P I FG L    T   +     L++  + G+G+  F GQP+ I+ +T P+ +  +  Y     +G+ ++ F  WIG++ A    V +    S ++ +  R TEE F   ++  F+   +++V    K+F  +   Y   C      NA++                  V G C    T+   L+ V+L  GT  +   L       F  S+ R+ +S+F++ +++  MSF    +    +++++ +   P       +I   + + P    ++A   A   +IL FM+Q I + IVN   NKLKKG  YH DL ++ I+  I S+ GLPW   A   S  HV +L    E    G K   + + V E R+  I+  + IG  + L P  L  IP PVL G+FLYM   +L   Q F+R+L+        P   +L++VP K+VH+FT IQ   L++L +      +   ++FP +L++ +  R  +   + +++ L  LD ++
Sbjct:  485 GLINDIKRKAPWYISDYKDALS-----MQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEK--PQFLGVREQRVTHILIFLTIGVSVLLTPL-LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWL--IKSFSQTSILFPLMLVVMIGIRKAL-DLVFTRRELKILDDIM 1019          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 410.223 bits (1053), Expect = 7.263e-131
Identity = 264/778 (33.93%), Postives = 435/778 (55.91%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLD--LSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA----VTGS----------------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVK--IHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EE+RA  D + F   ASI+L+    + E  + D+L+ M     +D    +   + E   + L      +E +    ++T+        G+     SWL  + ++  +  R V  +    P N G + + V+ + +++AP K K+ K  +E  R  A++ SD  FRQ +      E+  ++ FKE         TA + + +  + + ++   ++     +   +GRGIY+D   RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++L  G P++I LTT+P+++ I+    +       F  FY  IG++N+++L +      S+++K  +RS EE   LF+S+ FV D+VK   K FH+ Y+     N + A    ++GS                      CT+   LL +LL++GT+ +G  L     +PFL+   R++LS+ ALP+SVL  S++GSYVF ++   + +F   P   ++     + +L  A ++ A  + F L +L F++QNI  S+ N P N+L KG AYH+DL + G+IN+++S+ GLPW+H A PHS +HV  LA +EE + EG  + + +V V ETR+  ++ANILIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL LC  G  P+ Y+K++FP ++ + +P R+ + P+II  KYLD +D
Sbjct:   16 LLNTSRRYVKLMNFEEEVRAHRDLDGFLERASILLH----EDEASLDDVLKTMLRHVSQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATATGIQYQQ-SWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKL-----LESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVA----PLDKLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERV-EGGHLYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 778          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 410.223 bits (1053), Expect = 7.263e-131
Identity = 264/778 (33.93%), Postives = 435/778 (55.91%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLD--LSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA----VTGS----------------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVK--IHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EE+RA  D + F   ASI+L+    + E  + D+L+ M     +D    +   + E   + L      +E +    ++T+        G+     SWL  + ++  +  R V  +    P N G + + V+ + +++AP K K+ K  +E  R  A++ SD  FRQ +      E+  ++ FKE         TA + + +  + + ++   ++     +   +GRGIY+D   RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++L  G P++I LTT+P+++ I+    +       F  FY  IG++N+++L +      S+++K  +RS EE   LF+S+ FV D+VK   K FH+ Y+     N + A    ++GS                      CT+   LL +LL++GT+ +G  L     +PFL+   R++LS+ ALP+SVL  S++GSYVF ++   + +F   P   ++     + +L  A ++ A  + F L +L F++QNI  S+ N P N+L KG AYH+DL + G+IN+++S+ GLPW+H A PHS +HV  LA +EE + EG  + + +V V ETR+  ++ANILIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL LC  G  P+ Y+K++FP ++ + +P R+ + P+II  KYLD +D
Sbjct:   16 LLNTSRRYVKLMNFEEEVRAHRDLDGFLERASILLH----EDEASLDDVLKTMLRHVSQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATATGIQYQQ-SWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKL-----LESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVA----PLDKLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERV-EGGHLYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 778          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 409.838 bits (1052), Expect = 3.143e-130
Identity = 261/762 (34.25%), Postives = 427/762 (56.04%), Query Frame = 1
Query:  193 SEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLD--LSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA----VTGS----------------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             EE+RA  D + F   ASI+L+    + E  + D+L+ M     +D    +   + E   + L      +E +    ++T+        G+     SWL  + ++  +  R V  +    P N G + + V+ + +++AP K K+ K  +E  R  A++ SD  FRQ +      E+  ++ FKE         TA + + +  + + ++   ++     +   +GRGIY+D   RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++L  G P++I LTT+P+++ I+    +       F  FY  IG++N+++L +      S+++K  +RS EE   LF+S+ FV D+VK   K FH+ Y+     N + A    ++GS                      CT+   LL +LL++GT+ +G  L     +PFL+   R++LS+ ALP+SVL  S++GSYVF ++ +  F         +   D  +L  A ++ A  + F L +L F++QNI  S+ N P N+L KG AYH+DL + G+IN+++S+ GLPW+H A PHS +HV  LA +EE + EG  + + +V V ETR+  ++ANILIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL LC  G  P+ Y+K++FP ++ + +P R+ + P+II  KYLD +D
Sbjct:   66 EEEVRAHRDLDGFLERASILLH----EDEASLDDVLKTMLRHVSQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATATGIQYQQ-SWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKL-----LESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERV-EGGHLYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 814          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 409.838 bits (1052), Expect = 3.143e-130
Identity = 261/762 (34.25%), Postives = 427/762 (56.04%), Query Frame = 1
Query:  193 SEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLD--LSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA----VTGS----------------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             EE+RA  D + F   ASI+L+    + E  + D+L+ M     +D    +   + E   + L      +E +    ++T+        G+     SWL  + ++  +  R V  +    P N G + + V+ + +++AP K K+ K  +E  R  A++ SD  FRQ +      E+  ++ FKE         TA + + +  + + ++   ++     +   +GRGIY+D   RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++L  G P++I LTT+P+++ I+    +       F  FY  IG++N+++L +      S+++K  +RS EE   LF+S+ FV D+VK   K FH+ Y+     N + A    ++GS                      CT+   LL +LL++GT+ +G  L     +PFL+   R++LS+ ALP+SVL  S++GSYVF ++ +  F         +   D  +L  A ++ A  + F L +L F++QNI  S+ N P N+L KG AYH+DL + G+IN+++S+ GLPW+H A PHS +HV  LA +EE + EG  + + +V V ETR+  ++ANILIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL LC  G  P+ Y+K++FP ++ + +P R+ + P+II  KYLD +D
Sbjct:   66 EEEVRAHRDLDGFLERASILLH----EDEASLDDVLKTMLRHVSQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATATGIQYQQ-SWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKL-----LESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERV-EGGHLYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 814          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 409.838 bits (1052), Expect = 6.714e-130
Identity = 264/776 (34.02%), Postives = 432/776 (55.67%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLD--LSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA----VTGS----------------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EE+RA  D + F   ASI+L+    + E  + D+L+ M     +D    +   + E   + L      +E +    ++T+        G+     SWL  + ++  +  R V  +    P N G + + V+ + +++AP K K+ K  +E  R  A++ SD  FRQ +      E+  ++ FKE         TA + + +  + + ++   ++     +   +GRGIY+D   RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++L  G P++I LTT+P+++ I+    +       F  FY  IG++N+++L +      S+++K  +RS EE   LF+S+ FV D+VK   K FH+ Y+     N + A    ++GS                      CT+   LL +LL++GT+ +G  L     +PFL+   R++LS+ ALP+SVL  S++GSYVF ++ +  F         +   D  +L  A ++ A  + F L +L F++QNI  S+ N P N+L KG AYH+DL + G+IN+++S+ GLPW+H A PHS +HV  LA +EE + EG  + + +V V ETR+  ++ANILIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL LC  G  P+ Y+K++FP ++ + +P R+ + P+II  KYLD +D
Sbjct:   80 LLNTSRRYVKLMNFEEEVRAHRDLDGFLERASILLH----EDEASLDDVLKTMLRHVSQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATATGIQYQQ-SWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKL-----LESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERV-EGGHLYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 842          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 451.44 bits (1160), Expect = 1.576e-145
Identity = 286/800 (35.75%), Postives = 433/800 (54.12%), Query Frame = 1
Query:  106 SITIDFPTVTNGFNE-----LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV---ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKS--DNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-------------YGGHCVN---------------ATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTET-------PFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHS-PMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            ++ ++ P  T   NE     L+ T  +   +    EE+RA  D + F   ASI+L+    +T   + D+L++M    + D +  + S    ++       S   +EG+    + TI G      GV     SWL  + ++  +  R V  +    P N G +   V+ + +V+AP K K+ K   E  R  + + SD  FRQ +      E        +  +    +K  S  D  + +  +   L+   ++G+GI+ D   RLP Y  D+ D  +  N +I K ITT+  L+F+ LLP+IAFG LN+  T   I+V   ++ Q IGGV ++LF GQP++++LTT+PL+L I     +       F  FY W G++N+ +L +YS    S++MK  +RSTEE   LF+S+TFV+D++K   K F  YY             Y  H  N               +  A  GS   EE        + ++ L      L  T       P+L+S  R+MLS+ ALP+SVL  S +GSY FKE+ I  F      ++ ++A  I  LP+  I  A  + F LS+LFF+EQNI +S+ N P N+L KG AYH+DLL+V +IN  LS+FG+PW+H A  HS      A  + +     G+ I + +V V ETR+  ++AN+L+G  +FL+PYPL +IP PVL GLFLY+A T++  +QLFER+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQL++LC  G +P+ Y+K++FP I+I  +P R+ + PKII  KYLDA+D
Sbjct:   69 NVNLEVPQSTTAENESSGCVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIILD----ETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHLLSDTIQGVTATATGVQYQQ-SWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAP-IGSLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYNLLPKIIESKYLDAMD 861          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 451.055 bits (1159), Expect = 2.203e-145
Identity = 286/800 (35.75%), Postives = 433/800 (54.12%), Query Frame = 1
Query:  106 SITIDFPTVTNGFNE-----LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV---ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKS--DNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-------------YGGHCVN---------------ATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTET-------PFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHS-PMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            ++ ++ P  T   NE     L+ T  +   +    EE+RA  D + F   ASI+L+    +T   + D+L++M    + D +  + S    ++       S   +EG+    + TI G      GV     SWL  + ++  +  R V  +    P N G +   V+ + +V+AP K K+ K   E  R  + + SD  FRQ +      E        +  +    +K  S  D  + +  +   L+   ++G+GI+ D   RLP Y  D+ D  +  N +I K ITT+  L+F+ LLP+IAFG LN+  T   I+V   ++ Q IGGV ++LF GQP++++LTT+PL+L I     +       F  FY W G++N+ +L +YS    S++MK  +RSTEE   LF+S+TFV+D++K   K F  YY             Y  H  N               +  A  GS   EE        + ++ L      L  T       P+L+S  R+MLS+ ALP+SVL  S +GSY FKE+ I  F      ++ ++A  I  LP+  I  A  + F LS+LFF+EQNI +S+ N P N+L KG AYH+DLL+V +IN  LS+FG+PW+H A  HS      A  + +     G+ I + +V V ETR+  ++AN+L+G  +FL+PYPL +IP PVL GLFLY+A T++  +QLFER+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQL++LC  G +P+ Y+K++FP I+I  +P R+ + PKII  KYLDA+D
Sbjct:   72 NVNLEVPQSTTAENESSGCVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIILD----ETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHLLSDTIQGVTATATGVQYQQ-SWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAP-IGSLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYNLLPKIIESKYLDAMD 864          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 426.402 bits (1095), Expect = 5.445e-136
Identity = 280/792 (35.35%), Postives = 422/792 (53.28%), Query Frame = 1
Query:  106 SITIDFPTVTNGFNELVITRNRPTNVPFL-----SEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV---ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVS----------LGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-------------YGGHCVN---------------ATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTET-------PFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHS-PMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRH 2316
            ++ ++ P  T G   L  T   PT + +L      EE+RA  D + F   ASI+L+    +T   + D+L++M    + D +  + S    ++       S   +EG+    + TI G      GV     SWL  + ++  +  R V  +    P N G +   V+ + +V+AP K K+ K   E  R  + + SD  FRQ +      E        +  +    +K  S N   + + H  L  + S          +G+GI+ D   RLP Y  D+ D  +  N +I K ITT+  L+F+ LLP+IAFG LN+  T   I+V   ++ Q IGGV ++LF GQP++++LTT+PL+L I     +       F  FY W G++N+ +L +YS    S++MK  +RSTEE   LF+S+TFV+D++K   K F  YY             Y  H  N               +  A  GS   EE        + ++ L      L  T       P+L+S  R+MLS+ ALP+SVL  S +GSY FKE+ I  F      ++ ++A  I  LP+  I  A  + F LS+LFF+EQNI +S+ N P N+L KG AYH+DLL+V +IN  LS+FG+PW+H A  HS      A  + +     G+ I + +V V ETR+  ++AN+L+G  +FL+PYPL +IP PVL GLFLY+A T++  +QLFER+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQL++LC  G +P+ Y+K++FP I+I  +P R+
Sbjct:   67 NVNLEVPQSTTG-KSLTST---PTQITYLKLKNFEEEVRAHRDLDGFLAKASIILD----ETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHLLSDTIQGVTATATGVQYQQ-SWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKVRGSSPPKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAP-IGSLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY 847          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 421.009 bits (1081), Expect = 3.024e-135
Identity = 269/724 (37.15%), Postives = 411/724 (56.77%), Query Frame = 1
Query:  193 SEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV---ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKS--DNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGS---------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHS-PMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRH 2316
             EE+RA  D + F   ASI+L+    +T   + D+L++M    + D +  + S    ++       S   +EG+    + TI G      GV     SWL  + ++  +  R V  +    P N G +   V+ + +V+AP K K+ K   E  R  + + SD  FRQ +      E        +  +    +K  S  D  + +  +   L+   ++G+GI+ D   RLP Y  D+ D  +  N +I K ITT+  L+F+ LLP+IAFG LN+  T   I+V   ++ Q IGGV ++LF GQP++++LTT+PL+L I     +       F  FY W G++N+ +L +YS    S++MK  +RSTEE   LF+S+TFV+D++K   KS   YY      N+ + +              +E ++L ++L+ GT+ LG  L    ++P+L+S  R+MLS+ ALP+SVL  S +GSY FKE  IHS   P       +   I  LP+  I  A  + F LS+LFF+EQNI +S+ N P N+L KG AYH+DLL+V +IN  LS+FG+PW+H A  HS      A  + +     G+ I + +V V ETR+  ++AN+L+G  +FL+PYPL +IP PVL GLFLY+A T++  +QLFER+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQL++LC  G +P+ Y+K++FP I+I  +P R+
Sbjct:   25 EEEVRAHRDLDGFLAKASIILD----ETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHLLSDTIQGVTATATGVQYQQ-SWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKSKSIYYPQ---TNSNMRLVWKELLGYTEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKE--IHS-KLPD----MFVLAPIGSLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY 732          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 421.009 bits (1081), Expect = 7.817e-135
Identity = 268/747 (35.88%), Postives = 410/747 (54.89%), Query Frame = 1
Query:  106 SITIDFPTVTNGFNE-----LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV---ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHS-PMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRH 2316
            ++ ++ P  T   NE     L+ T  +   +    EE+RA  D + F   ASI+L+    +T   + D+L++M    + D +  + S    ++       S   +EG+    + TI G      GV     SWL  + ++  +  R V  +    P N G +   V+ + +V+AP K K+ K   E  R  + + SD  FRQ +      E        +  +    +K  S N   +      L+   ++G+GI+ D   RLP Y  D+ D  +  N +I K ITT+  L+F+ LLP+IAFG LN+  T   I+V   ++ Q IGGV ++LF GQP++++LTT+PL+L I     +       F  FY W G++N+ +L +YS    S++MK  +RSTEE   LF+S+TFV+D++K   KS   Y     C+ +   +     ++       ++    A      G    P+L+S  R+MLS+ ALP+SVL  S +GSY FKE  IHS   P       +   I  LP+  I  A  + F LS+LFF+EQNI +S+ N P N+L KG AYH+DLL+V +IN  LS+FG+PW+H A  HS      A  + +     G+ I + +V V ETR+  ++AN+L+G  +FL+PYPL +IP PVL GLFLY+A T++  +QLFER+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQL++LC  G +P+ Y+K++FP I+I  +P R+
Sbjct:   54 NVNLEVPQSTTAENESSGCVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIILD----ETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHLLSDTIQGVTATATGVQYQQ-SWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHK------LNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKSKSIY-----CIISVRPLG----RDWGCGIAGIVGRDGAYSSSGWGGLWLPYLHSRVREMLSDCALPISVLTFSVVGSYFFKE--IHS-KLPD----MFVLAPIGSLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY 772          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Mouse
Match: Slc4a11 (solute carrier family 4, sodium bicarbonate transporter-like, member 11 [Source:MGI Symbol;Acc:MGI:2138987])

HSP 1 Score: 435.647 bits (1119), Expect = 1.136e-139
Identity = 291/794 (36.65%), Postives = 435/794 (54.79%), Query Frame = 1
Query:  118 DFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIV-SNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXX------XLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGH-------------------------CVNATI-------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGLT-----ETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            D    T G   L+ T  +   +    EE+RA  D + F   ASI+LN      + +++ +L +  L    +H + D  ++L  A+L   +    E      + TI G      GV   + SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +     TE  F++A       L    P++                    +    G+GI+ D   R P Y  D+ D  + K+ S+ K +TT   L+F+ LLPTIAFG LN+  TN  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL++       +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG H                          +NA++       A T S     S     +L   + LG    G T     ++P+L+   R+ LS+ ALP++VL  S IGSY F+E+++  F   P  ++  +A  I  L    I  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+ I + +V V ETR+  + A++L+G  + L+P+PL +IP PVL GLFLY+A T+L  NQLF R+ L + EQ++YPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K+VFP I+I  +P R+ + P+II  KYLD +D
Sbjct:   71 DLEAATGGC-VLLHTSRKYLKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNRFALDP--NHAEPDCDLDLLMAKLFTDAGAPMESKVHLLSDTIQGVTATVRGVQY-EQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDITFRQKLLKTR-TEEEFKEALVHQRQLLTMMMPRAAGHSMSSLHTHRHPQPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMVKIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSPGSTHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEMSKFRYNPSESLFEVA-QIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYETIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLLKEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIRYNLLPRIIEAKYLDVMD 857          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Mouse
Match: Slc4a1 (solute carrier family 4 (anion exchanger), member 1 [Source:MGI Symbol;Acc:MGI:109393])

HSP 1 Score: 187.193 bits (474), Expect = 1.345e-48
Identity = 148/524 (28.24%), Postives = 255/524 (48.66%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVY-LFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA-VTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMS-----RKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATD---------IRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R P+Y SD  DA   +      +  +  ++F+ L P + FG L    T + + V+  L++  + G+ FAL G QP++++  + PL +   AF++   S   +++    WIG +  +  + V +F G S ++++  R T+E F   +S+ F+ ++     K F +Y      +  T A V      +  +    L    +  G +L  +T   F NS       R+++ +F +P+S+L M  + S++ K       + P    +S  +            R  P   +  +   A  + IL F+E  I + IV+ P  K+ KG  +H DLL+V  +  + ++FG+PW+      S  H  AL  + +    G     ++ +V E RI  ++ ++L+G  I + P  L  IP  VL G+FLYM  T+L   QLF+R+LL       +P   ++KRV   ++H+FT IQ + L +L ++  TP +   L  PF+LIL +P R +I P I  +  L  LD
Sbjct:  400 GLIRDIRRRYPYYLSDITDALSPQ-----VLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEG-SFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDY-----PLQQTYAPVVMKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFI-KGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKA--SGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPI-LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKSTPAS---LALPFVLILTVPLRRLILPLIFRELELQCLD 905          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 172.17 bits (435), Expect = 1.524e-43
Identity = 151/551 (27.40%), Postives = 262/551 (47.55%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNA-VYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETP-------------------------------FLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R PHY SD++DA +D     + +  +  ++F+ L P I FG L    T   I V+  +++  + GV F L G QP++++  + PL +   AF++  SS   ++L    WIG +   + L + +  G S +++F  R T+E F   +S+ F+ ++     K F  +   G C  +  +  GS +         +L+   +     +G  E P                               F     R+++ +F +P+++L M  +  Y  ++      + P     S+ A D R         + P    M+ A++  A  + IL FME  I + I++     L+KG  +H DLL++  +  I ++FGLPW+  A   S  H  AL  + + +  G+K   K+ +V E R+  ++  +L+G  + +    L  IP  VL G+FLYM  T+L+  Q +ERL L +     +P   Y+K+V   ++H+FT++Q L L LL  +     T   L FPFILIL +P R ++  +I +++ +  LD
Sbjct:  671 GLIRDVRRRYPHYLSDFRDA-LDP----QCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEG-SFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHG-CSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSG-QEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV-DYSIEDTYTQKLSVP--SGFSVTAPDKRGWVINPLGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQRVTGLLVALLVGLSMVIGDL-LRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTMRMHLFTALQLLCLALLWAVMS---TAASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1204          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 171.785 bits (434), Expect = 1.962e-43
Identity = 151/551 (27.40%), Postives = 262/551 (47.55%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNA-VYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETP-------------------------------FLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R PHY SD++DA +D     + +  +  ++F+ L P I FG L    T   I V+  +++  + GV F L G QP++++  + PL +   AF++  SS   ++L    WIG +   + L + +  G S +++F  R T+E F   +S+ F+ ++     K F  +   G C  +  +  GS +         +L+   +     +G  E P                               F     R+++ +F +P+++L M  +  Y  ++      + P     S+ A D R         + P    M+ A++  A  + IL FME  I + I++     L+KG  +H DLL++  +  I ++FGLPW+  A   S  H  AL  + + +  G+K   K+ +V E R+  ++  +L+G  + +    L  IP  VL G+FLYM  T+L+  Q +ERL L +     +P   Y+K+V   ++H+FT++Q L L LL  +     T   L FPFILIL +P R ++  +I +++ +  LD
Sbjct:  666 GLIRDVRRRYPHYLSDFRDA-LDP----QCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEG-SFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHG-CSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSG-QEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV-DYSIEDTYTQKLSVP--SGFSVTAPDKRGWVINPLGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQRVTGLLVALLVGLSMVIGDL-LRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTMRMHLFTALQLLCLALLWAVM---STAASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1199          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 171.4 bits (433), Expect = 2.592e-43
Identity = 151/551 (27.40%), Postives = 262/551 (47.55%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNA-VYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETP-------------------------------FLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R PHY SD++DA +D     + +  +  ++F+ L P I FG L    T   I V+  +++  + GV F L G QP++++  + PL +   AF++  SS   ++L    WIG +   + L + +  G S +++F  R T+E F   +S+ F+ ++     K F  +   G C  +  +  GS +         +L+   +     +G  E P                               F     R+++ +F +P+++L M  +  Y  ++      + P     S+ A D R         + P    M+ A++  A  + IL FME  I + I++     L+KG  +H DLL++  +  I ++FGLPW+  A   S  H  AL  + + +  G+K   K+ +V E R+  ++  +L+G  + +    L  IP  VL G+FLYM  T+L+  Q +ERL L +     +P   Y+K+V   ++H+FT++Q L L LL  +     T   L FPFILIL +P R ++  +I +++ +  LD
Sbjct:  680 GLIRDVRRRYPHYLSDFRDA-LDP----QCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEG-SFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHG-CSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSG-QEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV-DYSIEDTYTQKLSVP--SGFSVTAPDKRGWVINPLGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQRVTGLLVALLVGLSMVIGDL-LRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTMRMHLFTALQLLCLALLWAVMS---TAASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1213          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. UniProt/SwissProt
Match: sp|Q8NBS3|S4A11_HUMAN (Sodium bicarbonate transporter-like protein 11 OS=Homo sapiens OX=9606 GN=SLC4A11 PE=1 SV=2)

HSP 1 Score: 447.203 bits (1149), Expect = 6.854e-143
Identity = 294/802 (36.66%), Postives = 439/802 (54.74%), Query Frame = 1
Query:  130 VTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDK------LDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQ------NSKPKSDNXXXXXXXXXXLHNK---------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG--------------------GHCVNATI------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGL---------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
             T+G   L+ T  +   +    EEIRA  D + F   ASIVLN    +T   + ++L+ M     RD D       LDL + + F +   +     G     + TI G      GV     SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +      ET   + FKE  V  +      +  P +  ++         H           V  G+GI +D   R P Y  D+ D  + KN ++ K ITT   L+F+ LLPTIAFG LN+  T+  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL+L I     +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG                    G  +NA++      +   S T+  S          ++L + L  L          ++P+L+   R++LS+ ALP++VL  S I S+ F+E+++  F   P  +   +A  I+ L +  +  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+  D  +V V ETR+  + A++L+G  + L+P PL +IP PVL GLFLY+A T+L  NQL +R+ L + EQ+AYPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K++FP I+I  +P R+I+ P+II  KYLD +D
Sbjct:  100 ATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLN----ETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTD---AGAPMRGKVHLLSDTIQGVTATVTGVRYQQ-SWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKL-----LETRTEEEFKEALVHQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMA-QIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYD-TIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 886          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. UniProt/SwissProt
Match: sp|A2AJN7|S4A11_MOUSE (Sodium bicarbonate transporter-like protein 11 OS=Mus musculus OX=10090 GN=Slc4a11 PE=2 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 7.946e-139
Identity = 291/794 (36.65%), Postives = 435/794 (54.79%), Query Frame = 1
Query:  118 DFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIV-SNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXX------XLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGH-------------------------CVNATI-------AVTGSCTKEESXXXXXXXXXXXXXXXXXNGLT-----ETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            D    T G   L+ T  +   +    EE+RA  D + F   ASI+LN      + +++ +L +  L    +H + D  ++L  A+L   +    E      + TI G      GV   + SWL  + ++  +  R V  +  V P N G +   V+ + +V+AP K K+ K  +E +R  A + SD  FRQ +     TE  F++A       L    P++                    +    G+GI+ D   R P Y  D+ D  + K+ S+ K +TT   L+F+ LLPTIAFG LN+  TN  I+V   +  Q IGG+ +ALF GQP++I+LTT+PL++       +       F  FY W G++N+ +L +Y+F   S++M   +RSTEE   LF+S+TFV+D+VK   K F  YYYG H                          +NA++       A T S     S     +L   + LG    G T     ++P+L+   R+ LS+ ALP++VL  S IGSY F+E+++  F   P  ++  +A  I  L    I  A  + F LS+LFF+EQN+ +++VN P N+L KG AYH+DLL++ IIN  LS+FGLPW+H A PHSP+HV ALA +EE ++ G+ I + +V V ETR+  + A++L+G  + L+P+PL +IP PVL GLFLY+A T+L  NQLF R+ L + EQ++YPP HY++RVPQ+K+H FT +Q LQLLLLC  G + + Y+K+VFP I+I  +P R+ + P+II  KYLD +D
Sbjct:   71 DLEAATGGC-VLLHTSRKYLKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNRFALDP--NHAEPDCDLDLLMAKLFTDAGAPMESKVHLLSDTIQGVTATVRGVQY-EQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDITFRQKLLKTR-TEEEFKEALVHQRQLLTMMMPRAAGHSMSSLHTHRHPQPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMVKIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSPGSTHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEMSKFRYNPSESLFEVA-QIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYETIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLLKEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIRYNLLPRIIEAKYLDVMD 857          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. UniProt/SwissProt
Match: sp|P02730|B3AT_HUMAN (Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3)

HSP 1 Score: 188.734 bits (478), Expect = 2.224e-48
Identity = 148/533 (27.77%), Postives = 259/533 (48.59%), Query Frame = 1
Query:  814 LHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNAT-------IAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIAT--------DIR-ELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L     L  G+ +D R R P+Y SD  DAF  +      +  +  ++F+ L P I FG L    T +++ V+  L++  + G+ FAL G QP++++  + PL +   AF++   + G +++    WIG +  + + +      S +++F  R T+E F   +S+ F+ ++     K F +     H +  T       +          +LL ++L+ GT    + L     + +     R+++ +F +P+S+L M  +  ++ ++      + P    +S  +          +R E PI  +  +A  A  + IL F+E  I + IV+ P  K+ KG  +H DLL+V  +  + ++FG+PW+      S  H  AL  + +    G     ++ +V E RI  ++  +L+G  I + P  L  IP  VL G+FLYM  T+L   QLF+R+LL       +P   Y+KRV   ++H+FT IQ + L +L ++  TP +   L  PF+LIL +P R ++ P I     L  LD
Sbjct:  372 LQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQ-----VLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQD-----HPLQKTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFI-QDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAA--AQIQEVKEQRISGLLVAVLVGLSILMEPI-LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPAS---LALPFVLILTVPLRRVLLPLIFRNVELQCLD 887          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. UniProt/SwissProt
Match: sp|P04919|B3AT_MOUSE (Band 3 anion transport protein OS=Mus musculus OX=10090 GN=Slc4a1 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 9.410e-48
Identity = 148/524 (28.24%), Postives = 255/524 (48.66%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVY-LFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA-VTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMS-----RKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATD---------IRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R P+Y SD  DA   +      +  +  ++F+ L P + FG L    T + + V+  L++  + G+ FAL G QP++++  + PL +   AF++   S   +++    WIG +  +  + V +F G S ++++  R T+E F   +S+ F+ ++     K F +Y      +  T A V      +  +    L    +  G +L  +T   F NS       R+++ +F +P+S+L M  + S++ K       + P    +S  +            R  P   +  +   A  + IL F+E  I + IV+ P  K+ KG  +H DLL+V  +  + ++FG+PW+      S  H  AL  + +    G     ++ +V E RI  ++ ++L+G  I + P  L  IP  VL G+FLYM  T+L   QLF+R+LL       +P   ++KRV   ++H+FT IQ + L +L ++  TP +   L  PF+LIL +P R +I P I  +  L  LD
Sbjct:  400 GLIRDIRRRYPYYLSDITDALSPQ-----VLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEG-SFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDY-----PLQQTYAPVVMKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFI-KGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKA--SGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPI-LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKSTPAS---LALPFVLILTVPLRRLILPLIFRELELQCLD 905          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. UniProt/SwissProt
Match: sp|P48746|B3A2_RABIT (Anion exchange protein 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC4A2 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.023e-45
Identity = 153/548 (27.92%), Postives = 256/548 (46.72%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCV----------NATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGL-------------------TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R PHY SD++DA +D     + +  +  ++F+ L P I FG L    T   I V+  +++  + GV F L G QP++++  + PL +   AF+T  SS   ++L    WIG +  +   +      S +++F  R T+E F   +S+ F+ ++     K F  +   G  V          NAT A  GS     +             G     L                     + F     R+++ +F +P+++L M  +  Y  ++      + P     S+ A D R         + P    M+ A++  A  + IL FME  I + I++     L+KG  +H DLL++  +  I ++FGLPW+  A   S  H  AL  + + +  G+K   K+ +V E R+  ++  +L+G  I +    L  IP  VL G+FLYM  T+L+  Q +ERL L +     +P   Y+K+V   ++H+FT++Q L L LL  +     T   L FPFILIL +P R ++  +I +++ +  LD
Sbjct:  680 GLIRDVRRRYPHYLSDFRDA-LDP----QCVAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVIFCLLGAQPLLVIGFSGPLLVFEEAFFTFCSSNQLEYLVGRVWIGFWLVLLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSVSNSSETDSSENATWAGAGSTLGPANRSSAGQAGQGRPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV-DYSIEDTYTQKLSVP--SGFSVTAPDKRGWVINPLGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQRVTGLLVALLVGLSIVIGDL-LRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTLRMHLFTALQLLCLALLWAVM---STAASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1213          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. TrEMBL
Match: A0A267H2A6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031769g1 PE=4 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 342/829 (41.25%), Postives = 488/829 (58.87%), Query Frame = 1
Query:   64 ANSDIPSTSRPSDGSITIDFPTVTNGFNE----LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDH-----------------------DKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNS----KPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGH---------------------CVNATIAVTGS---------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
            A+ D  + S  S GS+ + F    +G +E    LV++R     +   S EIRA  D ++F   A+++L+      E I++ +L+ +F      H                        +LD  V+ A   L +  N  +  Y + AKTI          +  D SWL  M SL+ +  R V       P+N+G S   V  + +V+ P KEK  K DIE  R  A I++D EFRQ +   + TE+ F++  +  A  L       + KS  ++    +     +   +  GI  D + RL HY SD+ DAF D  +I K +TT+  L+F+ L+P IAFG+LN   TN  I V   +L+Q IGGV FALFGGQP+I+MLTT+PL+L     + ++ + G  F  F+ W+G+FNA  L +Y+    S +M++S RSTEE F +F+SV F V +VK+   +F  YY  G+                      +++  A+ GS         C ++ S+LF+LL +GT+ L ++L   T+TP+LN   R+++++F+LPVSVL MSF+G+Y+F+ V++ +F+  P+  +  +    R LP   I+ A  +A PLS+LFFMEQNI+S++VNCP NKL+KG AYH DLL V ++N ++S FGLPWVHGALPHSP+HV ALA +EE ID G  + Q VV+V ETRI  +++NILIG  + + P PL +IP PVL+GLF+ MA TAL  NQLFER+LL  TEQ+AYPP+HYL+RVPQ+KVHIFT +Q LQL +LC LGF  I Y KL FP IL LQ+P RH++ PK+I + YLDALDK
Sbjct:  101 ASVDRDNLSIMSGGSLAM-FYRNADGTDESLPCLVVSRLEKIPLKDFSSEIRANMDIQRFLKEATLLLDVEGANVECIIEQMLRSIFRADHESHHSSGSGGGGGDGGSVAGAAGAIDSRLDAKVQDAKKTLFLQANWMDYTYQRLAKTIKSISVVDSEGLITDNSWLCTMCSLNGVQKRHVAIARLSTPVNLGRSSEGVSFILLVVTPTKEKGTKSDIELGRTFATILADSEFRQKLLLAE-TESEFKEMLQGHAHELGEEQKIYRRKSLRTKDFMSQAFSYESSWPICNGIRADLKRRLSHYLSDFIDAFRDNKTIRKVVTTVIFLYFACLMPCIAFGVLNNSLTNGYITVHRVILSQCIGGVTFALFGGQPLIVMLTTAPLALYTHIIFELSQNHGLDFFAFFGWVGVFNAALLLLYAVLDLSKLMRWSTRSTEEIFAMFISVAFTVGAVKSVYGNFDTYYCDGNGGAETNGGNLTSGSDKWGRNLTLDSQSALNGSSSVGQKQQNCQRDVSILFLLLCIGTVFLSMYLLNFTKTPYLNRAKRELMADFSLPVSVLAMSFVGTYLFRNVQLENFSCLPYIQLEFVIA--RPLPGLAILGAFGLAIPLSMLFFMEQNISSAMVNCPANKLRKGSAYHLDLLTVALMNGVMSCFGLPWVHGALPHSPLHVKALADLEERIDLGQHVHQSVVRVRETRITGVVSNILIGLSLLMCPVPLSFIPVPVLDGLFVCMAITALFDNQLFERILLLFTEQAAYPPSHYLRRVPQRKVHIFTCLQLLQLFVLCALGFNSIAYAKLGFPVILFLQMPVRHLLIPKLIDENYLDALDK 925          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. TrEMBL
Match: A0A267G7Q1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031769g2 PE=4 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 342/829 (41.25%), Postives = 487/829 (58.75%), Query Frame = 1
Query:   64 ANSDIPSTSRPSDGSITIDFPTVTNGFNE----LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDH-----------------------DKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKP----KSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGH---------------------CVNATIAVTGS---------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
            A+ D  + S  S GS+ + F    +G +E    LV++R     +   S EIRA  D ++F   A+++L+      E I++ +L+ +F      H                        +LD  V+ A   L +  N  +  Y + AKTI          +  D SWL  M SL+ +  R V       P+N+G S   V  + +V+ P KEK  K DIE  R  A I++D EFRQ +   + TE+ F++  +  A  L   +     KS  ++    +     +   +  GI  D + RL HY SD+ DAF D  +I K +TT+  L+F+ L+P IAFG+LN   TN  I V   +L+Q IGGV FALFGGQP+IIMLTT+PL+L     + ++ + G  F  F+ W+G+FNA  L +Y+    S +M++S RSTEE F +F+SV F V +VK+   +F  YY  G+                      +++  A+ GS         C ++ S+LF+LL +GT+ L ++L   T+TP+LN   R+++++F+LPVSVL MSF+G+Y+F+ V++  F+  P+  +  +    R LP   I+ A  +A PLS+LFFMEQNI+S++VNCP NKL+KG AYH DLL V ++N ++S FGLPWVHGALPHSP+HV ALA +EE ID G  + Q VV+V ETRI  +++N+LIG  + + P PL +IP PVL+GLF+ MA TAL  NQLFER+LL  TEQ+AYPP+HYL+RVPQ+KVHIFT +Q LQL +LC LGF  I Y KL FP IL LQ+P RH++ PK+I + YLDALDK
Sbjct:  101 ASVDRDNLSIMSGGSLAM-FYRNADGTDESLPCLVVSRLEKIPLKDFSSEIRANMDIQRFLKEATLLLDVEGANVECIIEQMLRSIFRADHESHHSSGSGGGGGDGGSVAGAAGAIDSRLDAKVQDAKKTLFLQANWMDYTYQRLAKTIKSISVVDSEGLITDNSWLCTMCSLNGVQKRHVAIARLSTPVNLGRSSEGVSFILLVVTPTKEKGTKSDIELGRTFATILADSEFRQKLLLAE-TESEFKEMLQGHAHELGEEQKIYRRKSLRTKDFMSQAFNYESSWPICNGIRADLKRRLSHYLSDFIDAFRDNKTIRKVVTTVIFLYFACLMPCIAFGVLNNSLTNGYITVHRVILSQCIGGVTFALFGGQPLIIMLTTAPLALYTRIIFELSQNHGLDFFAFFGWVGVFNAALLLLYAVLDLSKLMRWSTRSTEEIFAMFISVAFTVGAVKSVYGNFDTYYCDGNGGAETNGGNLTSGSDKWGPNLTLDSQSALNGSSSVGQKQQNCQRDVSILFLLLCIGTVFLSMYLLNFTKTPYLNRAKRELMADFSLPVSVLAMSFVGTYLFRNVQLEKFSCLPYIQLEFVIA--RPLPGLAILGAFGLAIPLSMLFFMEQNISSAMVNCPANKLRKGSAYHLDLLTVALMNGVMSCFGLPWVHGALPHSPLHVKALADLEERIDLGQHVHQSVVRVRETRITGVVSNVLIGLSLLMCPVPLSFIPVPVLDGLFVCMAITALFDNQLFERILLLFTEQAAYPPSHYLRRVPQRKVHIFTCLQLLQLFVLCALGFNSIAYAKLGFPVILFLQMPVRHLLIPKLIDENYLDALDK 925          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. TrEMBL
Match: A0A0H3YEW7 (Slc4a-4 OS=Schmidtea mediterranea OX=79327 GN=slc4a-4 PE=2 SV=1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 328/770 (42.60%), Postives = 470/770 (61.04%), Query Frame = 1
Query:  139 GFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMF-LTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNS----KPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSC---------------TKEESXXXXXXXXXXXXXXXXXNGL-----TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            G   LV+ R     +   S E+RA  D EKF     ++L+      + IV+ LL++++ L       ++D  +  A   L +  + +   Y + AKT+ G    +   ++ D SW+ AM SL+ +  R V       P+N+G S   V  + +VI P KEK  K DIE SR  A ++SD EFR  +  +  TE  F++  +  A  L       + +S        +      K  LG GI  D R R+P Y SDYKD      +I K ++    L+F+ LLP++AFG+L +  T+ KINV   +L+Q +GG+ FAL GGQP+I+MLTT+PL+L I   Y +++     F   ++W+GIFN+++L +YS    S +M++S RSTEE F LF+S+ F+VD+VK   K F+  Y     VN T+ +  +                T EES     LL   + +G    G+     T+TPFLNS  R ++++++LP++VL MSFIGSY+FK++KI +F        S+   +  ++ I+ +  A  +AFPLS+LFFM+QN+ S++VNCP NKLKKG AYH+DLL+V IINL+LS+FGLPWVHG LPHSP+HV ALA +EE ID G++I + +VKV ETR+  +I++ILIG  + L+P PL+Y+P  VL+GLF+YMA TAL+ NQL ER++L  TEQ+AYPP+HYL+RVPQ+KVH+FT +Q  QL LLC LGF P  Y K+ FP +L+LQ+P RH IFPK IS  Y+DALDK I
Sbjct:  124 GLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLL-FAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTT-LVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 891          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. TrEMBL
Match: A0A267GLC9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006525g1 PE=4 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 342/829 (41.25%), Postives = 487/829 (58.75%), Query Frame = 1
Query:   64 ANSDIPSTSRPSDGSITIDFPTVTNGFNE----LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDH-----------------------DKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKP----KSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGH---------------------CVNATIAVTGS---------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
            A+ D  + S  S GS+ + F    +G +E    LV++R     +   S EIRA  D ++F   A+++L+      E I++ +L+ +F      H                        +LD  V+ A   L +  N  +  Y + AKTI          +  D SWL  M SL+ +  R V       P+N+G S   V  + +V+ P KEK  K DIE  R  A I++D EFRQ +   + TE+ F++  +  A  L   +     KS  ++    +     +   +  GI  D + RL HY SD+ DAF D  +I K +TT+  L+F+ L+P IAFG+LN   TN  I V   +L+Q IGGV FALFGGQP+IIMLTT+PL+L     + ++ + G  F  F+ W+G FNA  L +Y+    S +M++S RSTEE F +F+SV F V++VK+   +F  YY  G+                      +++  A+ GS         C ++ S+LF+LL +GT+ L ++L   T+TP+LN   R+++++F+LPVSVL MSF+G+Y+F+ V++  F+  P+  +  +    R LP   I+ A  +A PLS+LFFMEQNI+S++VNCP NKL+KG AYH DLL V ++N ++S FGLPWVHGALPHSP+HV ALA +EE ID G  + Q VV+V ETRI  +++N+LIG  + + P PL +IP PVL+GLF+ MA TAL  NQLFER+LL  TEQ+AYPP+HYL+RVPQ+KVHIFT +Q LQL +LC LGF  I Y KL FP IL LQ+P RH++ PK+I + YLDALDK
Sbjct:  101 ASVDRDNLSIMSGGSLAM-FYRNADGTDESLPCLVVSRLEKIPLKDFSSEIRANMDIQRFLKEATLLLDVEGANVECIIEQMLRSIFRADHESHHSSGSGGGGGDGGSVAGAAGAIDSRLDAKVQDAKKTLFLQANWMDYTYQRLAKTIKSISVVDSEGLITDNSWLCTMCSLNGVQKRHVAIARLSTPVNLGRSSEGVSFILLVVTPTKEKGTKSDIELGRTFATILADSEFRQKLLLAE-TESEFKEMLQGHAHELGEEQKIYRRKSLRTKDFMSQAFNYESSWPICNGIRADLKRRLSHYLSDFIDAFRDNKTIRKVVTTVIFLYFACLMPCIAFGVLNNSLTNGYITVHRVILSQCIGGVTFALFGGQPLIIMLTTAPLALYTHIIFELSQNHGLDFFAFFGWVGAFNAALLLLYAVLDLSKLMRWSTRSTEEIFAMFISVAFTVEAVKSVYGNFDTYYCDGNGGAETNGGNLTSGSDKWGPNLTLDSQSALNGSSSVGQKQQNCQRDVSILFLLLCIGTVFLSMYLLNFTKTPYLNRAKRELMADFSLPVSVLAMSFVGTYLFRNVQLEKFSCLPYIQLEFVIA--RPLPGLAILGAFGLAIPLSMLFFMEQNISSAMVNCPANKLRKGSAYHLDLLTVALMNGVMSCFGLPWVHGALPHSPLHVKALADLEERIDLGQHVHQSVVRVRETRITGVVSNVLIGLSLLMCPVPLSFIPVPVLDGLFVCMAITALFDNQLFERILLLFTEQAAYPPSHYLRRVPQRKVHIFTCLQLLQLFVLCALGFNSIAYAKLGFPVILFLQMPVRHLLIPKLIDENYLDALDK 925          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. TrEMBL
Match: G7YII3 (Sodium bicarbonate transporter-like protein 11 OS=Clonorchis sinensis OX=79923 GN=CLF_108778 PE=4 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 319/697 (45.77%), Postives = 443/697 (63.56%), Query Frame = 1
Query:  397 EGDYFQ-FAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTI---RGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYY---------------GGHCVNATIAVTG---------------------SCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
            EGD +Q  AKTI G        ++ D SW+ A+ SL  I+ R +       P+N+G S     ++ +VI P KEK  K D+E  R  A I+SDPEFR ++    G +  +        E A R    + +S   E  H+  S L N V  G+G+Y+D R RLPHYWSDY +  + KN++ KTI+    L+F+ LLPTIAFG+LN   TN +I+V   +++Q IGG+    FGGQP+I++L+T+PL+L     YT+  S G  F   Y  +G+FN+++LF +S TG S +M++S RSTEE F LFVSV F++ +VK C K+F  YY                G   +   I  TG                     SC KE +LL++LLLLGT+ L L+L   T+TPFL +  R++L++FALP++VL MS IGS +   + +  +   P R++ +  T +  L    ++ A  +A PLS+LF+MEQNIAS+IVN P N+L+K PA H+DL+VV +IN++LS+F LPWVH ALPHSP+H+ ALA IEE ID G  I Q +V+V ETR+  II++I IG  + ++P PL YIP  VL GLF+YMA TA++SNQLFERLLLFITEQSAYPP+HY++RVPQ+K+H+FT IQ +QLL+LC  GF P  YV++VFP +L+ Q+ FRH + PK+I +KYLDALD+
Sbjct:  226 EGDRYQRLAKTIKGISVLDEDGLSTDQSWVCALCSLGPINRRYLALARLSTPVNLGRSSEGTCLILLVITPTKEKETKSDVEVGRTFATILSDPEFRSSLMYAAGVEEVKALLLARANELANRRPEDRRRSSVFERSHKIASDLKNDVCFGKGLYQDLRNRLPHYWSDYSEGILGKNTLRKTISGTLFLYFACLLPTIAFGVLNFANTNGQIDVTQMIISQTIGGLCNGFFGGQPLIVLLSTAPLALYTKIVYTICESFGLNFTAMYGCVGLFNSLFLFGFSVTGLSSLMRWSTRSTEEIFALFVSVAFIMGAVKDCYKTFQKYYVCQTPTQIMEANQTIAGNRTIKNIIGFTGNSAEHLDENLSKEAGFLLESSSCNKEVALLYLLLLLGTVWLSLYLYNFTKTPFLTAGKREILTDFALPIAVLVMSTIGSLLSGNISLEPYLHSP-RDLQLSLTPLTNLDWRAVLGALGLALPLSMLFYMEQNIASAIVNSPANRLRKSPAPHWDLMVVALINMVLSLFCLPWVHAALPHSPLHIRALADIEERIDMGQHIRQTIVRVRETRLTTIISHIFIGLSLLMIPIPLCYIPPAVLMGLFVYMAVTAVYSNQLFERLLLFITEQSAYPPSHYIRRVPQRKLHLFTIIQLIQLLVLCAFGFAPNPYVEMVFPVLLVGQIVFRHKLIPKLIDRKYLDALDR 921          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Cavefish
Match: ENSAMXT00000011908.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:229098:263825:-1 gene:ENSAMXG00000011585.2 transcript:ENSAMXT00000011908.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 452.21 bits (1162), Expect = 7.770e-147
Identity = 276/762 (36.22%), Postives = 426/762 (55.91%), Query Frame = 1
Query:  178 NVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNK-------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNAT-------------------------IAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            N+    EE+RA  D   F   ASI+L+    +T   + ++L++M     RD        E+  A L      +E       +TI        GV     SWL  + ++  +  R V  T    P N G +   V+ + +++AP + K+ K  IE  R  A + SD  FRQ +      ET  +D FK+  V        +++     EE     NK       +  GRGIY+D   RLP+Y SD+ D     N S+ K  TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGGV ++L  G PM+I +TT+PL++ I+    +       F  FY  IG++N+++L +      S+ MK  +RSTEE   LF+S+ FV D+VK   K FH YY+G   VN++                          AV   CT+E  +L +LL+LGT+ LG  L  +  +PFL++  R+++S+ ALP+SV+  SF+GSY+F ++++  F        ++   D+  L    ++ A  + F L++L F++QNI  S+ N P N+L KG AYH+DL++ G IN+++S+ GLPW+H A PHS +HV  LA +E+ +++G+ + + +V V ETR+  + AN+LIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY++RVPQ+KVH FT +Q +QL++LC  G  P+ Y+K++FP ++I  +P R+ + PKII  KYLD +D
Sbjct:   41 NLMNFQEEVRAHRDLNSFLAQASILLD----ETAASLDEVLRRMLQHVARDGQGSCDQREVISA-LFTDAGGQEASVHLLTETIQAVTATATGVRYQQ-SWLCVLCNVKSLQRRCVCITRLERPQNWGVNCCEVRFVILILAPPRTKSTKTAIELGRTFATLFSDISFRQKL-----LETKTQDDFKQELVHQMQLLSSAEHKASIEEETGPHINKPLKVKEFLQAGRGIYEDLSRRLPYYVSDFTDGMYGSNRSLLKYTTTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLLAGSPMVIPITTAPLAIFISVIRGICDDYDLDFPAFYACIGLWNSLFLILGGLFNISLFMKLFKRSTEEVIALFISIAFVGDAVKGTIKIFHKYYHGPTLVNSSAVEIHHLADMIQHPDSSSSSTAPSLSAVLTLCTRERPILCLLLMLGTLWLGYVLFLIKRSPFLHAKVREVVSDCALPISVVIFSFVGSYLFIDIELPVFNYYNGSIFNIAPLDM--LSGMNVLSACGLGFLLALLIFIDQNIVISLTNAPENRLLKGTAYHWDLMLSGFINILMSVLGLPWMHAAFPHSTLHVRQLAKVEQRVEQGH-LYETIVSVKETRLTSLAANVLIGLSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRIALLLKEQTSYPPTHYIRRVPQRKVHYFTGLQLIQLIILCAFGMYPLPYMKMIFPLLMIFLIPVRNSMLPKIIEAKYLDIID 788          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Cavefish
Match: ENSAMXT00000047690.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:229977:263825:-1 gene:ENSAMXG00000011585.2 transcript:ENSAMXT00000047690.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 434.491 bits (1116), Expect = 2.764e-140
Identity = 267/746 (35.79%), Postives = 415/746 (55.63%), Query Frame = 1
Query:  178 NVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNK-------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNAT-------------------------IAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRH 2316
            N+    EE+RA  D   F   ASI+L+    +T   + ++L++M     RD        E+  A L      +E       +TI        GV     SWL  + ++  +  R V  T    P N G +   V+ + +++AP + K+ K  IE  R  A + SD  FRQ +      ET  +D FK+  V        +++     EE     NK       +  GRGIY+D   RLP+Y SD+ D     N S+ K  TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGGV ++L  G PM+I +TT+PL++ I+    +       F  FY  IG++N+++L +      S+ MK  +RSTEE   LF+S+ FV D+VK   K FH YY+G   VN++                          AV   CT+E  +L +LL+LGT+ LG  L  +  +PFL++  R+++S+ ALP+SV+  SF+GSY+F ++++  F        ++   D+  L    ++ A  + F L++L F++QNI  S+ N P N+L KG AYH+DL++ G IN+++S+ GLPW+H A PHS +HV  LA +E+ +++G+ + + +V V ETR+  + AN+LIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY++RVPQ+KVH FT +Q +QL++LC  G  P+ Y+K++FP ++I  +P R+
Sbjct:   41 NLMNFQEEVRAHRDLNSFLAQASILLD----ETAASLDEVLRRMLQHVARDGQGSCDQREVISA-LFTDAGGQEASVHLLTETIQAVTATATGVRYQQ-SWLCVLCNVKSLQRRCVCITRLERPQNWGVNCCEVRFVILILAPPRTKSTKTAIELGRTFATLFSDISFRQKL-----LETKTQDDFKQELVHQMQLLSSAEHKASIEEETGPHINKPLKVKEFLQAGRGIYEDLSRRLPYYVSDFTDGMYGSNRSLLKYTTTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLLAGSPMVIPITTAPLAIFISVIRGICDDYDLDFPAFYACIGLWNSLFLILGGLFNISLFMKLFKRSTEEVIALFISIAFVGDAVKGTIKIFHKYYHGPTLVNSSAVEIHHLADMIQHPDSSSSSTAPSLSAVLTLCTRERPILCLLLMLGTLWLGYVLFLIKRSPFLHAKVREVVSDCALPISVVIFSFVGSYLFIDIELPVFNYYNGSIFNIAPLDM--LSGMNVLSACGLGFLLALLIFIDQNIVISLTNAPENRLLKGTAYHWDLMLSGFINILMSVLGLPWMHAAFPHSTLHVRQLAKVEQRVEQGH-LYETIVSVKETRLTSLAANVLIGLSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRIALLLKEQTSYPPTHYIRRVPQRKVHYFTGLQLIQLIILCAFGMYPLPYMKMIFPLLMIFLIPVRY 772          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Cavefish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 414.075 bits (1063), Expect = 2.091e-132
Identity = 266/778 (34.19%), Postives = 434/778 (55.78%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLD--LSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHK-------INVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIM-KFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIA----------VTGS-------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSF---TAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EEIRA  D + F   ASI+L+    + E  + D+L+ M     +D    +   + E   + L      +E +    ++T+        G+     SWL  + ++  +  R V  +    P N G + + V+ + +++AP+K K+ K  +E  R  A++ SD  FRQ +      E+  ++ FKE         TA + + +  + + ++    +     +   +GRGIY+D   RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +        +V   ++ Q IGG+ ++L  G P++I LTT+P+++ I+    +       F  FY  IG++N+++L +      S+++ K  +RS EE   LF+S+ FV D++K   K FH YY+     N +I           +TG        CT+   LL +LL+LGT+ +G  L     +PFL++  R++LS+ ALP+SVL  S++GSYVF ++ +  F     P +R        + +L  A ++ A  + F L++L F++QNI  S+ N P N+L KG AYH+DL + G+IN+++S+ GLPW+H A PHS +HV  LA +EE + EG  + + +V V ETR+  ++ANILIG  +FL+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL LC  G  P+ Y+K++FP ++ + +P R+ + P+II  KYLD +D
Sbjct:   19 LLNTSRRYVKLMNFEEEIRAHRDLDGFLERASILLH----EDEASLDDVLKTMLRHISQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATATGIQYQQ-SWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPLKMKSTKTAMELGRTFASMFSDISFRQKL-----LESKTQEEFKEALVIQRYHLTATKRKTTTVEEEETDPHSHKPLKCRDFFRVGRGIYEDLCRRLPFYPSDFTDGIVGNNKALVKYMTTSIFLYIAVLLPAIAFGSLNDESTRGENSICVSVSDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIIGGVFNLSLLLVKLFKRSIEEVIALFISIAFVADAMKGTVKIFHKYYHAPTLANGSIEELNRISRDMNLTGELPESFILCTRARPLLCLLLMLGTLWVGYTLYQFKRSPFLHAKMREILSDCALPISVLIFSYVGSYVFNDIGLPVFDFHKGPVFR-----VAPLEKLTGASVLSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERV-EGGHLYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCTFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIDAKYLDIMD 780          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 197.593 bits (501), Expect = 6.875e-52
Identity = 156/544 (28.68%), Postives = 264/544 (48.53%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVY-SFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFH------------------------NYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R P Y SD+KDA   +      +  +  ++F+ L P I FG L    T   I V+  ++A  I GV F L G QP++++  + PL +   AFY+   S G ++L    WIG +  + + V  +F G S +++F  R T+E F   +S+ F+ ++     K F                         N+ +     N++  +        +LL ++L+ GT  +  +L     + F     R+++ +F +P+++L M  +  Y  +E      + P     S+ + D R         E+     M+AA+V  A  + IL FME  I + IV+     L KG  +H DLLV+  +  I ++FGLPW+  A   S  HV AL  + + +  G+K   ++ +V E R+  ++  IL+G  I +    L  IP  VL G+FLYM   +L+  QL ER+ L +     +P + Y+++V   ++H+FT++Q + L  L  +  T  +   L FPF+LIL +P +  + P+I S + +  LD
Sbjct:  629 GMIRDIRRRYPKYLSDFKDALNPQ-----CMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEG-SFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLV-DYSIQETYTQKLSVP--SGFSVTSPDKRGWIVNPLGSEVQFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALFGLPWMAAATVRSVTHVNALTVMSKAVAPGDK--PRIQEVKEQRVTGLLVAILVGLSIVIGDL-LRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKVRTLRMHLFTALQVVCLAALWAVMSTSAS---LAFPFVLILTVPLKMFLLPRIFSTREMQCLD 1157          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 197.208 bits (500), Expect = 1.015e-51
Identity = 156/544 (28.68%), Postives = 264/544 (48.53%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVY-SFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFH------------------------NYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R P Y SD+KDA   +      +  +  ++F+ L P I FG L    T   I V+  ++A  I GV F L G QP++++  + PL +   AFY+   S G ++L    WIG +  + + V  +F G S +++F  R T+E F   +S+ F+ ++     K F                         N+ +     N++  +        +LL ++L+ GT  +  +L     + F     R+++ +F +P+++L M  +  Y  +E      + P     S+ + D R         E+     M+AA+V  A  + IL FME  I + IV+     L KG  +H DLLV+  +  I ++FGLPW+  A   S  HV AL  + + +  G+K   ++ +V E R+  ++  IL+G  I +    L  IP  VL G+FLYM   +L+  QL ER+ L +     +P + Y+++V   ++H+FT++Q + L  L  +  T  +   L FPF+LIL +P +  + P+I S + +  LD
Sbjct:  637 GMIRDIRRRYPKYLSDFKDALNPQ-----CMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEG-SFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLV-DYSIQETYTQKLSVP--SGFSVTSPDKRGWIVNPLGSEVQFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALFGLPWMAAATVRSVTHVNALTVMSKAVAPGDK--PRIQEVKEQRVTGLLVAILVGLSIVIGDL-LRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKVRTLRMHLFTALQVVCLAALWAVMSTSAS---LAFPFVLILTVPLKMFLLPRIFSTREMQCLD 1165          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Sea Lamprey
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 423.32 bits (1087), Expect = 6.000e-137
Identity = 275/752 (36.57%), Postives = 413/752 (54.92%), Query Frame = 1
Query:  193 SEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLG-----RGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSF-HNYYYG--GHCVNA-----------TIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTE---TPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIH----SFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLL-YIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
            SEE+RA  D ++F   A+++L+      E      L  M  + + D+       E   A   +   D        ++TI        G +    SWL  + + + + HR V         N G +   V+ + +V+AP K K+ K   E  R  A I  D  FRQ +      E  F+ A       L     + ++S          H +V         GI++D R RLP+Y SD+ D  +    I K I  +  L+F+ LLP+IAFG LN+  T   I+V   L+AQ +GGV FA+  GQP+I++LTT+PL+L I A  T+       F  +Y  IG++N+ +L +Y+    S  +  S+RS EE F LF+S+ FVVD++K   K F  NY  G  G C +A              V     K    + +L LL  +      + L +    P+L+  +R++LS+ A+P+SV+  SF+GSYVF+++        F+  P  +   +A  +  L +  I  A  + F LSILFFME  +A+S+ N P N+LKKG +YH+DLL+V ++N   S+FGLPW+H A PHSP+HV ALAT+EE +++G+ +D+      +TR+PV++A++L+G  +F +    L +IP PVL+G+FLY+A T+L  NQLF+RL L  TEQ+AYPP HY++RVPQ+K+H FT +Q LQL +LC +GF+PI Y+K+VFP I++  LP R    PKII  +YLD +D+
Sbjct:    9 SEEVRAGRDVDRFLSQAAVLLDLPSRSLE----STLCHMLESVLEDNP----CAEPREARCSLLKTDCINKVHLLSETIQAVTVNPSG-LHYQQSWLCVLCTETTLQHREVCIARLERAQNWGENCCEVRFVILVLAPPKSKSTKTATEVGRTFATIFVDIGFRQQLIEARSPEE-FKHALLLRRHDLTAQHEEQEDSSKSSVSIQHPHEQVFGAVVWPLMGIWEDIRRRLPYYSSDFTDGILRNRCIGKYIIAMIFLYFACLLPSIAFGSLNDINTRGAIDVQKTLVAQSMGGVLFAVLSGQPLIVLLTTAPLALYIYAIRTICDEFELDFHAYYACIGLWNSFFLTLYALLHMSTRLHLSKRSIEEIFALFISIAFVVDAIKDIIKIFKQNYLPGEPGGCGSAGNNTSDDGWEGAAGVDSGGPKGSRDVALLALLLMLGTVWLGSTLYQFRKRPYLHLQAREILSDCAMPLSVIAFSFLGSYVFRDIDRMVTGLKFSYTPSESYFALAP-LNLLTVGSICSAMGIGFLLSILFFMEHTMAASLTNAPHNRLKKGTSYHWDLLLVAVLNATFSLFGLPWMHAAFPHSPLHVRALATVEERVEDGH-VDETQGNSLKTRVPVLLAHMLLGLSLFFLLPLPLQWIPRPVLDGIFLYIALTSLDGNQLFQRLALLFTEQTAYPPTHYVRRVPQRKIHYFTGLQLLQLAVLCGVGFSPIPYMKMVFPVIMLAALPVRFFAVPKIIESRYLDVMDE 748          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 185.652 bits (470), Expect = 7.899e-49
Identity = 150/538 (27.88%), Postives = 253/538 (47.03%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNA-VYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNY-----------------YYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXX--XNGLTETPFLNSMSRKMLSEFALPVSVLFMSFI-----GSYVFKEVKIHSF--TAPPWRNISMIATDIRELPIAGIMLAAAV-AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPI--TYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R PHY SD +DA   +      +  +  ++F+ L P I FG L    T   + V+  +++  + G+ FAL G QP++I+  + PL +   AF++  SS G ++L    WIG +   + L + +F G S +++F  R T+E F + +S+ F+ ++     K F ++                       VN T A T     + +   + LLL +    +   L     + FL    R+++ +F +P+++L M  +      +Y  K      F  T+P  R   +            +M A  +    + IL FME  I + IV+     L KG  +H DLL++ ++  I +IFGLPW+  A   S  HV AL  + +    G+K   + VK  E RI  ++  I++G  + L    L  IP  VL G+FLYM  T+L+  Q ++RL+L       +P   Y  +V   +++++T      +  +C+ G   +  T   L FPF+LIL +P R  +  +I + + L  LD
Sbjct:  468 GLVRDARRRYPHYLSDLRDALNPQ-----CLAAVIFIYFAALSPAITFGGLLSEKTQGLMGVSELIISTCLQGILFALLGAQPLLIIGFSGPLLVFEEAFFSFCSSQGVEYLTGRVWIGFWMVLIVLLLVAFEG-SFMVRFISRFTQEIFSILISLIFIYETFSKLYKVFQDHPLLSTYPVISNMTTNSDTSNSSIVNGTTAATPKVLNQPNTALLSLLLMSGTFFIAFFLRKFKNSRFLAGKVRRVIGDFGVPIAILVMVLVDFGVPNTYTQKLNVPDGFSVTSPSKRGWVINPLGAEGTFPVWLMFACVIPGLLVFILIFMESQITTLIVSKKERMLLKGSGFHLDLLLIVVMGAICTIFGLPWLTAATVRSVTHVNALTVMSKATAPGDKPRIECVK--EQRITGLLVAIIVGLSMVLGQV-LRQIPLAVLFGIFLYMGVTSLNGIQFYDRLMLVFMPAKYHPDTAYATKVRTLRMNLYTG-----IQFVCLGGLWAVMSTAASLAFPFVLILTVPLRRFLLSRIFTDRELKCLD 991          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 156.377 bits (394), Expect = 2.733e-39
Identity = 156/546 (28.57%), Postives = 252/546 (46.15%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIF-NAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHN------YYYGGHCV-------NATIAVTGSCTKEESXXXXXXXXXXXXXXXXX----------------NGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGS-----YVFKEVKIHSF--TAPPWRNISMIATDIRELPIAGIMLAAAVAFPLS-ILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+ +D R R P Y SD KDA +D     + +  +  ++F+ L P I FG L    T   I V+  +++  I  + FAL   QP++I+  + PL +   AF++   S   ++L    WIG +   + L   +F G S ++++  R T+E F + +S+ F+ ++     K F        Y  GG  +       NA++ V GS T                    L                  L  + FL    R+++ +F +P+++L M  + S     Y  K      F  T+P  R+  +    +R      +M A  V   L  IL FME  I + IV+    +L KG  +H DLL++ ++    ++ G+PW+  A   S  HV AL  + +    G K   + VK  E R   ++  +LIG  + L    L  IP  VL G+FLYM  T+++  Q+++RLLL       +P + Y  +V   +++++T+IQF+ L LL        T   L FPF+LIL +P RH + P+I +   L  LD
Sbjct:  680 GVVRDARRRYPFYPSDIKDA-VDP----QCLAAVIFIYFAALSPAITFGGLLGEKTQGLIGVSELIISTSIQSIFFALLSAQPLLIVGFSGPLLVFEEAFFSFCWSQDVEYLTGRLWIGFWLILIVLLTVAFEG-SFLVRYISRFTQEIFSILISIIFIYETFYKLFKVFKEHPLLKTYTIGGTDLAGSGVWGNASM-VIGSATAAARNDTDAPTKMPSQPNTSLLSLVLMSGTFFIAFFLRKLKNSRFLAGKVRRVIGDFGVPIAILIMVLVDSAIPDTYTQKLAVPDGFSVTSPDQRSWLVNPLGVRSTFPVWMMFACVVPAALVFILIFMETQITTLIVSKSERRLVKGSGFHLDLLLIVLMGGASALLGVPWLTAATVRSVTHVNALTVMSKATAPGEKPRIECVK--EQRATGLLVAVLIGLSVVLGEV-LRRIPLAVLFGIFLYMGVTSVNGIQMYDRLLLAFMPAKHHPDSAYASKVKTWRMNMYTAIQFVCLALLW---VVMSTAASLAFPFVLILTVPLRHFLLPRIFTAHELRCLD 1212          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 128.257 bits (321), Expect = 7.953e-32
Identity = 119/451 (26.39%), Postives = 191/451 (42.35%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY-------------YGGHC---------------VNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMS--------------RKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAG-----IMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAP 2052
            G++KD + +LP + SD  DA     SI     T+F+ + + +   I FG L    T++   V    L   + G  F LF GQP+II+ +T P+ +     +  +    + +L+F  WIG+++A    +   T  S ++++  R TEE F   +S  F+ D++K     F NYY             Y   C               +NA +     C+K    L          + L    L    +  +M+              RK++S+F++ +S+   +F+G  +   ++      P     +         P  G      +++A  A  ++IL FM+Q I + IVN   NKLKKG  YH DL  V ++    S  GLPW   A   S  H+ +L    E    G +   K + V E RI  ++  +L G  +FL P  L  IP P
Sbjct:    5 GLFKDIKRKLPFFCSDIYDAL----SIQSLSATLFI-YLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLF-NYYPINLDYKPDYITLYSCTCQAPDPEWGKKLNTAVINAALYNKKECSKYGGSLSGKACKFVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIILSIF--TFVGLDILIGLETPKLVVPTEFKPTSAKRGWFVPPFGGNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCSFLGLPWYVAATVLSIAHIDSLKMETETSAPGEQ--PKFLGVREQRITGVLVFVLTGVSVFLAPI-LKKIPRP 444          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Sea Lamprey
Match: slc4a7 (solute carrier family 4 member 7 [Source:ZFIN;Acc:ZDB-GENE-140106-104])

HSP 1 Score: 128.257 bits (321), Expect = 1.589e-30
Identity = 101/290 (34.83%), Postives = 156/290 (53.79%), Query Frame = 1
Query: 1513 RKMLSEFALPVSVLFMSFIGSYV---FKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            R  +S+FA+ +++L M  I  ++     ++++ S   P   +   I   I   P   I+ AA  A   +IL FM+Q I + I+N   +KLKKG  YH DLL V I+  + SI GLPW   A   S  HV +L    E    G +   K + + E R+  ++  +L+GC +F M   L +IP PVL G+FLYM  ++L   Q F+R+ LF+      P   YL+ VP +KVH+FT++QF  L+LL ++  +P     +VFP +++L L F   +     +K+ L  LD L+
Sbjct:  760 RSTVSDFAVFLTILSMVVIDYFLGIPSPKLQVPSEFKPTRDDRGWIVDPIGPNPWWTILAAAIPALLCTILVFMDQQITAVIINRKEHKLKKGCGYHLDLLWVAIMLAVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQ--PKFLGIREQRVTGLMIFVLMGCSVF-MTGVLKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFVMPAKHQPDFIYLRHVPLRKVHLFTAVQFTCLVLLWVIKASP---AAIVFP-MMVLALVFIRKLLDFCFTKRELSWLDDLM 1042          

HSP 2 Score: 82.0333 bits (201), Expect = 3.429e-16
Identity = 41/163 (25.15%), Postives = 78/163 (47.85%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVK 1329
            G+ +D + ++P YWSDY+D+        + I +   L+ + + P I FG L    T  +I+    L    + G+ ++LF GQP+ I+ +T P+ +     Y         +L     IG++ A    +   T  S ++ +  R TEE F   + + F+ ++++
Sbjct:  488 GLVRDIKRKIPFYWSDYRDSLN-----LQCIASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCKDYNLSYLSLRACIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALE 645          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Yeast
Match: BOR1 (Boron efflux transporter of the plasma membrane; binds HCO3-, I-, Br-, NO3- and Cl-; has similarity to the characterized boron efflux transporter A. thaliana BOR1 [Source:SGD;Acc:S000005219])

HSP 1 Score: 156.762 bits (395), Expect = 8.432e-41
Identity = 125/473 (26.43%), Postives = 222/473 (46.93%), Query Frame = 1
Query:  829 SLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMS---FIGSYV----FKEVKIHSFTAPPWRNISMIATDI--RELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLY----IPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTS 2208
            +LG GI+ D + R+P+Y SD+ DAF      ++ I +I   +F+NLLP IAF       T++   V   LL+  + G+ F + GGQP+ I+  T P+S+     Y +   L   +  F  WI +++ ++  V +FT    ++++      + F LF++V ++   ++  T+ F              A +G  + ++    V++ L   A GL+       P  +   R  +S+++  +SVLF S     G Y+    FK++ I     P  +      T +    +P+  + +A      L+ILF+ + N++S +      KLKK  ++HYD  ++G+   I  + G+P  +G +P +P+H   L   +         +QKV+   E R       ++I   +  M  PLL     IP  VL+GLF  M    L +N + +RL+   ++ +       L +V +K + IF S
Sbjct:   57 TLGIGIWLDLKDRIPYYKSDWVDAFN-----YRVIPSIVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIKPLNTSYFGFMFWICMWSMIFHLVLAFTNAVCLLQYVTTFPCDIFGLFINVVYIQKGIQILTRQFS-------------AKSGEKSVQDGFASVVVALVMTAFGLFFKLFHYYPLFSHRIRTFISDYSTALSVLFWSSFTHFGGYLHDVKFKKLPITKAFFPTSKVNRPQNTWLAYEPIPVKDVFIALPFGIFLTILFYFDHNVSSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNGLIPQAPLHTETLLVRDS--------NQKVISCVEQRFTNTFQGLMI---LGTMTRPLLVCLGEIPQAVLSGLFFIMGINGLMTNSIIQRLVFLFSDPNRRDNTSPLMKVSKKSMLIFLS 500          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Nematostella
Match: EDO40611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T6])

HSP 1 Score: 343.584 bits (880), Expect = 2.263e-107
Identity = 247/737 (33.51%), Postives = 376/737 (51.02%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHN------------KVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFV--YSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLL--LFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFR 2313
            L++ +++  ++   S E+RAR D ++F    +++LN +  K E I+  +L K+        DK    V  + A       D        +  I G E  +GG      +WL+AMA L  I    +  +   H  N+G +     ++ ++++P+K K  K  +E  R  A ++SD +FRQ++   +  E  F     E    L N++ K + +       S   N             +   RGI  DF  R+PHY SD+KD  +   ++FK ++T+  L+F+ +LP++AFG+LN   T  K++V   L++Q+ GG+ F+L GGQP+II+LTT+PL+L I    T  S    K    +  I +          YS  G   +      ST +                 C+    N  Y              C++E   L++LL LGT+ LG+ L    ++PFL++  R+ L+++ALPV+VLF SFIG+Y F                           I  ++L ++                       + +LKKG A+H DLLVV IIN ILS FGLPW+HGALPHSP+HV ALA +EE +D+G+  D  +VKV ETR+  +IA+ILIG  + ++P PL YIP  VL+GL       + H+ Q+F  L    F+  QSAYPPNHY++RVPQ+K+H +T +Q LQL +LC  GF+P+ Y+K+VFP +L+L LP R
Sbjct:   14 LMLVKHQKIDMKNFSTEVRARKDIDRFLEKPTVLLNVHKTKIEDIIDLMLDKII------EDKQLQKVNFSAARTAFFTKD---SVHCLSHVIQGTEISEGGGWEETQNWLVAMADLPSIQQSHIAMSRLRHATNLGRTLQGTHLVVLILSPVKTKKTKNSLELGRTFATLLSDIDFRQSLLEAESKEE-FVKVLAERKSDLSNNRNKPEINSKLVRSASKGFNPYHCVFNFQETSTMKPCRGIRDDFMRRMPHYLSDFKDGVVGHRTLFKLVSTVIFLYFACILPSVAFGVLNSKNTKGKMDVQKVLVSQVFGGLFFSLLGGQPLIILLTTAPLALYIKDL-TAGSHYLTKTCNKHRRISLRKERRSITLPYSSCGICGVAGSGNVSTSQ-----------------CSAFGENMCY--------------CSREAGTLYLLLSLGTVLLGVTLYNFKKSPFLDANKREALADYALPVAVLFFSFIGTYFFSG---------------------ESCDIVVVVLCSSTH---------------------IQELKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGHVFD-IIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGL------ASSHNAQVFALLENNCFLL-QSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPVLLLLLLPIR 658          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Nematostella
Match: EDO40610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T5])

HSP 1 Score: 311.612 bits (797), Expect = 1.627e-99
Identity = 158/293 (53.92%), Postives = 224/293 (76.45%), Query Frame = 1
Query: 1486 ETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            ++PFL++  R+ L+++ALPV+VLF SFIG+Y F    +H+F +     +++  + +  L    +  A  + F LS+LFFM+QNI+S++VN P N+LKKG A+H DLLVV IIN ILS FGLPW+HGALPHSP+HV ALA +EE +D+G+  D  +VKV ETR+  +IA+ILIG  + ++P PL YIP  VL+GLFL++A T+L  NQ+FERLLLF+TEQSAYPPNHY++RVPQ+K+H +T +Q LQL +LC  GF+P+ Y+K+VFP +L+L LP RH++ P++I +K+LDA+D
Sbjct:   31 KSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESLHTFKSS--GAVTLKPSSLSLLSAGAVFGACGLGFCLSLLFFMDQNISSAMVNNPGNRLKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGHVFD-IIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGLFLFVAVTSLDDNQMFERLLLFVTEQSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPVLLLLLLPIRHLVVPRVIERKFLDAID 320          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Nematostella
Match: EDO31793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWX4])

HSP 1 Score: 174.481 bits (441), Expect = 4.401e-45
Identity = 141/503 (28.03%), Postives = 245/503 (48.71%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFI----GSYVFKEVKI---HSFTAPPWRN--ISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHII 2322
            G+ +D + R P+Y SD  D+F      ++ +    +++ + L P I+FG L    T   + VA  +++  + GV FALF GQP+II+  T PL L     + ++ S  ++++ +  W+GI+  +  +         ++++  R TEE F   +S+ F+ D +K     F  Y         T  V G      +L   +L  GT  +   +  +  + FLN   R+++S+F + ++++ M  +     S   + + +      T+P  R   ++ + T+ R L    I  A   A  +SIL FME    + I++   N+LKKGP Y+ DL VVG +  + S+ GLPW+     H+  H+ AL     +   G     ++++V E R+  II ++LIG  + L P   L  P  VL G+F+++ F++L   Q  ER  L     + +P   Y++ V   K++ FT +Q + LL L       +T V   FPF +I  +P R ++
Sbjct:  367 GLLRDVKRRFPYYKSDMTDSFN-----WRCVMATILVYVACLAPAISFGGLLYKKTKGWMGVAEMIVSTALSGVIFALFAGQPLIIIGATGPLLLFETNVFNLSESFDFEYMPWRAWVGIWVMLICWALVAMEGCFLIRYFTRFTEEIFACMISLIFIYDGIKYIYDIFGLYPLTS---GTTENVDGKDVSNTALFTTILFFGTFFVAHIIRDVRHSRFLNHTLRRVISDFGVLIAIVAMILVELSAQSIYVQRLNVPDGFDVTSPHLRGWYVNPMGTE-RRLGADAIFGALVPAILVSILVFMEVEFCNVILDKKDNQLKKGPGYNLDLFVVGFLMGMCSVLGLPWMCATPVHTVSHLHALMVHSTNHAPGEH--PQLLEVKEQRVTNIIIHVLIGLTMLLAPVIRL-TPVVVLFGVFVHLGFSSLSHLQFVERFKLLFVSPNHHPDRRYVRSVSTGKMNAFTLVQVVCLLFLVA---IKVTVVAPFFPFFVICLVPLRRML 854          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Nematostella
Match: EDO45844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK7])

HSP 1 Score: 158.688 bits (400), Expect = 5.455e-40
Identity = 154/522 (29.50%), Postives = 250/522 (47.89%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLF-VYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFH-NYYYGGHCVNAT----------IAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYV-------------FKEVKIHSF--TAPPWRNISMIATDIRELPIAGIMLAAAV-AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHII 2322
            G+ +D + R   Y SD+KD F      ++ +     L+F+   P +AFG L    T+  + V+  + A    G+ FALF GQP+II+  T P+ +     +        +FL +  WIG +  V LF V +F G  ++  F+R  TEE F   +S+ F+ +++    K F  N        N T          + VTG      +LL  +L+ GT  +  ++     + F    +R+++S+F + ++++ M  I   +               +V  H    T   W    M   D  +   AG + AA + A  + IL FME  +   ++N   N L+K P Y+ DLL++G+I LI S+FGLPW+  A   S  H  AL+        G K    +V+V E RI  I+ ++L G  I L P  L ++P PVL G+ LY+  ++L + QL  RL++ +     +P   Y+++VP  K+H +T IQ   LL+L       +T +   FPF +I  +P R ++
Sbjct:  393 GLIQDIKHRSKTYISDFKDGFN-----WQCLLVTVFLYFAVFAPNVAFGGLLAEKTDQWLGVSEVIFASCFCGLLFALFSGQPLIIIGATGPVMVFEQTIFKFCEQSNIEFLPWRCWIGFWVLVILFLVVAFEGCFLVRYFTR-FTEELFACLISLIFIYEAINFLYKVFKKNPLSRDPVTNLTNIDPYIKENIVPVTGE--PNTALLCAILMFGTYFVAFYMRKFRNSHFFGKKARRLVSDFGIAIAMITMVIIDVAIRDTVITPKISIGDVTKVGFHPTLKTKRGWFINPMGLVDSMK---AGWVFAAIIPALFVGILLFMETELTGVLINKKENCLQKRPGYNMDLLLMGVITLICSLFGLPWMCPATVRSVSHFNALSVWSTSHAPGEK--PYLVEVREQRITNILIHVLTGMSILLAPV-LHHVPVPVLFGVLLYLGLSSLSNLQLINRLIMMLMPPKHHPDVRYVRKVPTAKIHGYTLIQLACLLVLMA---VKLTILAPSFPFFIICLIPVRRLL 897          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Nematostella
Match: EDO27089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA82])

HSP 1 Score: 69.707 bits (169), Expect = 2.297e-14
Identity = 36/105 (34.29%), Postives = 58/105 (55.24%), Query Frame = 1
Query: 1036 LLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFH 1350
            +L   IGG+ FALF GQP+II+  T P+ +     YT    +G ++L F  WIGI+  ++  +   T  S ++ +  R TEETF   +++ ++ +  K   K FH
Sbjct:    5 MLGGAIGGILFALFSGQPLIILGATGPMLVFEEIVYTFCERVGLEYLSFRLWIGIWTMLFCLILVVTDASAMICYFTRFTEETFATLIAIIYIYEGFK---KLFH 106          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 431.409 bits (1108), Expect = 2.927e-138
Identity = 276/785 (35.16%), Postives = 433/785 (55.16%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV--ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY--------------YGGHCV-------------NATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEV-----KIHS---FTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EE+RA  D + F   ASI+L+    +T   + D+L++M     +D    + S   E   + L      +E +    ++TI G      G+     SWL  + ++  +  R V  +    P N G +   V+ + +++AP K K+ K  +E  R  A + SD  FRQ +      ET  ++ FKE         TA   Q +    + ++    +     +   +GRGIY+DF  RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++LF G P++I LTT+PL++ I+    +       F  FY  IG++N ++L +      S++MK  +RSTEE   LF+S+ FVVD+VK   K F  YY               GG  +             NA       C++E  +L +LL+LGT+ +G  L     +PFL++  R++LS+ ALP+SVL  SFIGSY+F ++     K+H+   F   P+  +S +           ++ A  + F L++L F++QNI  S+ N P N+L KG AYH+DL++ G+IN+++S+ GLPW+H A PHS +HV  LA +E+ + EG  + + +V+V ETR+  + ANI IG  + L+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL+LC  G  PI Y+K++FP ++I  +P R+ + P II  KYLD +D
Sbjct:   75 LLNTSRRYVKLMNFEEEVRALRDLDGFLAKASILLD----ETAASLDDVLKRMLHHVGQDGHAYEPSCNFEEVMSLLFTDAGAQEVNVHLLSETIQGVTATATGIQYQQ-SWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKL-----LETKTQEEFKEALLFQRHQLTAANQQPTALGKEETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARLMLNALPETIIQCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNVAPFERLSAM----------NVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRV-EGGHLYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 838          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 431.024 bits (1107), Expect = 3.695e-138
Identity = 276/785 (35.16%), Postives = 433/785 (55.16%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSV--ELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY--------------YGGHCV-------------NATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEV-----KIHS---FTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EE+RA  D + F   ASI+L+    +T   + D+L++M     +D    + S   E   + L      +E +    ++TI G      G+     SWL  + ++  +  R V  +    P N G +   V+ + +++AP K K+ K  +E  R  A + SD  FRQ +      ET  ++ FKE         TA   Q +    + ++    +     +   +GRGIY+DF  RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++LF G P++I LTT+PL++ I+    +       F  FY  IG++N ++L +      S++MK  +RSTEE   LF+S+ FVVD+VK   K F  YY               GG  +             NA       C++E  +L +LL+LGT+ +G  L     +PFL++  R++LS+ ALP+SVL  SFIGSY+F ++     K+H+   F   P+  +S +           ++ A  + F L++L F++QNI  S+ N P N+L KG AYH+DL++ G+IN+++S+ GLPW+H A PHS +HV  LA +E+ + EG  + + +V+V ETR+  + ANI IG  + L+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL+LC  G  PI Y+K++FP ++I  +P R+ + P II  KYLD +D
Sbjct:   77 LLNTSRRYVKLMNFEEEVRALRDLDGFLAKASILLD----ETAASLDDVLKRMLHHVGQDGHAYEPSCNFEEVMSLLFTDAGAQEVNVHLLSETIQGVTATATGIQYQQ-SWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKL-----LETKTQEEFKEALLFQRHQLTAANQQPTALGKEETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARLMLNALPETIIQCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNVAPFERLSAM----------NVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRV-EGGHLYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 840          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 427.172 bits (1097), Expect = 1.419e-136
Identity = 278/798 (34.84%), Postives = 438/798 (54.89%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELI-----------VSNNDKEGDYFQ----FAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKE---------TAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYY--------------YGGHCV-------------NATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEV-----KIHS---FTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            L+ T  R   +    EE+RA  D + F   ASI+L+    +T   + D+L++M     +D    + S    F E++           V++N +   +F      ++TI G      G+     SWL  + ++  +  R V  +    P N G +   V+ + +++AP K K+ K  +E  R  A + SD  FRQ +      ET  ++ FKE         TA   Q +    + ++    +     +   +GRGIY+DF  RLP Y SD+ D  +  N ++ K +TT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGG+ ++LF G P++I LTT+PL++ I+    +       F  FY  IG++N ++L +      S++MK  +RSTEE   LF+S+ FVVD+VK   K F  YY               GG  +             NA       C++E  +L +LL+LGT+ +G  L     +PFL++  R++LS+ ALP+SVL  SFIGSY+F ++     K+H+   F   P+  +S +           ++ A  + F L++L F++QNI  S+ N P N+L KG AYH+DL++ G+IN+++S+ GLPW+H A PHS +HV  LA +E+ + EG  + + +V+V ETR+  + ANI IG  + L+P PL +IP PVL GLFLY+A T++  NQ+ +R+ L + EQ++YPP HY+++VPQ+K+H FT +Q +QLL+LC  G  PI Y+K++FP ++I  +P R+ + P II  KYLD +D
Sbjct:   77 LLNTSRRYVKLMNFEEEVRALRDLDGFLAKASILLD----ETAASLDDVLKRMLHHVGQDGHAYEPSCN--FEEVMSLLFTDAGAQEVNDNSQSFVFFDDVHLLSETIQGVTATATGIQYQQ-SWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKL-----LETKTQEEFKEALLFQRHQLTAANQQPTALGKEETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARLMLNALPETIIQCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNVAPFERLSAM----------NVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRV-EGGHLYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 851          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Medaka
Match: SLC4A11 (sodium bicarbonate transporter-like protein 11 [Source:NCBI gene;Acc:101168050])

HSP 1 Score: 392.119 bits (1006), Expect = 4.571e-125
Identity = 244/676 (36.09%), Postives = 377/676 (55.77%), Query Frame = 1
Query:  508 IDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAV--RLQNSKPKSDNXXXXXXXXXXLHNK-------VSLGRGIYKDFRGRLPHYWSDYKDAFMDKN-SIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYG-------------------GHCVNATIAVTGS-------------------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFT---APPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            +  R V       P N G + +  + + +++AP + K+ K  IE  R  A + SD  FR+ +      +   +D FK+  V  R Q S+  ++    E EE      K          GRG+Y D R RLP Y SD+ D    K+  + K ITT   L+ + LLP IAFG LN+  T  +I+V   ++ Q IGGV ++LF G P++I LTT+PL++ I+    +       F  FY  IG++N  +L +      S++MK  +RSTEE   LF+S+ FV D++K   K F +Y++G                       N T  +T                           CT+E  +L +LL+LGT+ LG  L  +  +P+LN   R+++S+ ALP+SV+  SFIGSY+F ++++  F     P ++       +  +L    ++ A  + F L++L F++QNI  S+ + P +KL KG  +H+DL++ G IN+++S  GLPW+H A PHS +H   LA +E H++ G+ +   +V V ETR+  ++ANILIG   F++P PL +IP PVL GLFLY+A T+L  NQ+ +R+ L + EQ++YPP HY++RVPQ+KVH FT++Q LQL++LC  G  P+ Y+K+VFP ++IL +P R  + P++I  KYLD +D
Sbjct:   18 LQRRQVCIARLDKPQNWGVNCAEARYVILILAPPRTKSTKTAIELGRTFATMFSDISFREKL-----LDPRTQDEFKQELVSQRRQLSEVNANTIVEEVEESDPRRGKPLECRDFFKAGRGVYNDLRRRLPLYPSDFTDGITGKDRCLVKYITTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLFAGSPLVIPLTTAPLAIFISIIRGICDDYNLDFEAFYACIGLWNCFFLVLGGLFNVSLLMKLFKRSTEEVIALFISIAFVGDAIKGTIKIFDHYFHGPILATTNSSAVLQQINEILEKANNQTPHLTEHHKGDMSQFEQAETQVLVFLPETLVICTRERPILCLLLMLGTLWLGYALYLMKRSPYLNDKIREVVSDCALPISVMIFSFIGSYLFIDIQLPVFNVHDGPVFK-----YPEFEKLSGMAVLSAVGLGFLLALLIFIDQNIVISLTHVPEHKLLKGTTFHWDLVLTGFINILMSCLGLPWMHAAFPHSSLHARQLAKVEHHLENGH-LHSTIVSVKETRVTSLVANILIGLSAFMLPIPLQWIPKPVLYGLFLYVAATSLDGNQMVDRMTLLLKEQTSYPPTHYIRRVPQRKVHYFTALQMLQLIILCAFGMYPLPYMKMVFPLLMILLVPVRTGLLPRLIDAKYLDIMD 682          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Medaka
Match: slc4a3 (solute carrier family 4 member 3 [Source:NCBI gene;Acc:101164449])

HSP 1 Score: 191.43 bits (485), Expect = 6.634e-50
Identity = 157/527 (29.79%), Postives = 258/527 (48.96%), Query Frame = 1
Query:  841 GIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEE--------SXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIR---------ELPIAGIMLAAAV--AFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALD 2364
            G+  D R R P Y SD+KDA        + I  +  ++F+ L PTI FG L    T   + V   +++    GV F+LF GQP++I+  + PL +   A+Y    +  +++L    WIG +    + V      S ++++    T+E F   +S+ F+ ++     K F  +         T A TG   ++         +LL ++L++GT  +  +L     + FL   +R+++ +F +P+S+L +S +  Y   +        P     S+ + D R         + P    M+ A+V  A  + IL FME  I S IV+    +L KG  +H DLL++ I+  I  +FGLPW+  A   S  HV AL  + +    G K    + +V E R+  ++  +L+G  I +M   L  IP  VL G+FLYM  T+L   QL+ER+ L +T    +P + Y+ +V   ++++FT    +QL  +  L     T V L FPFILI+ +P R +I  +I  ++ L ALD
Sbjct:  706 GLIHDIRRRYPLYISDFKDALD-----MQCIAAVIFIYFAALSPTITFGGLLGEKTEGMMGVTELIVSTATLGVLFSLFAGQPLLIIGFSGPLLVFEEAYYKFCQAYKFEYLTGRVWIGFWLIGIVLVIVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFSKLFKVFKEHPLMAVYPTDTTAATGFPNEDNLIFNQPNTALLSLVLMMGTFFIAFFLRKFRNSRFLGGKARRIIGDFGIPISIL-VSVLVDYSITDTYTQKLNVP--SGFSVTSPDKRGWFISPFGDKQPFPTWMMGASVVPALLVFILIFMETQITSLIVSKKERRLIKGSGFHLDLLLIVILGAICPLFGLPWLTAATVRSVTHVNALTVMSKATAPGEK--PMIQEVKEQRLTGLLVAVLVGMSI-VMTDVLRLIPLAVLFGIFLYMGVTSLTGIQLYERITLMVTPAKHHPDHIYVTKVKTWRMNMFT---IIQLTCIVALWVVKSTVVSLAFPFILIMTVPLRRLILSRIFEERELQALD 1218          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Planmine SMEST
Match: SMESG000012150.1 (SMESG000012150.1)

HSP 1 Score: 1505.73 bits (3897), Expect = 0.000e+0
Identity = 775/781 (99.23%), Postives = 779/781 (99.74%), Query Frame = 1
Query:   31 MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFS T+SIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGG+MTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETA+RLQNSKPKSDNSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV+DSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESLLFVLLLL TMALGLWLNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI
Sbjct:    1 MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSSTSSIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGIMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETALRLQNSKPKSDNSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVIDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESLLFVLLLLSTMALGLWLNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 781          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Planmine SMEST
Match: SMESG000012150.1 (SMESG000012150.1)

HSP 1 Score: 1505.73 bits (3897), Expect = 0.000e+0
Identity = 775/781 (99.23%), Postives = 779/781 (99.74%), Query Frame = 1
Query:   31 MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 2373
            MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFS T+SIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGG+MTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETA+RLQNSKPKSDNSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFV+DSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESLLFVLLLL TMALGLWLNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI
Sbjct:    1 MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTNVPFLSEEIRARADAEKFSSTSSIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGIMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETALRLQNSKPKSDNSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVIDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESLLFVLLLLSTMALGLWLNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 781          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Planmine SMEST
Match: SMESG000039045.1 (SMESG000039045.1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 327/769 (42.52%), Postives = 469/769 (60.99%), Query Frame = 1
Query:  136 NGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMF-LTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNS----KPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSC---------------TKEESXXXXXXXXXXXXXXXXXNGL-----TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
             G   LV+ R     +   S E+RA  D EKF     ++L+      + IV+ LL++++ L       ++D  +  A   L +  + +   Y + AKT+ G    +   ++ D SW+ AM SL+ +  R V       P+N+G S   V  + +VI P KEK  K DIE SR  A ++SD EFR  +  +  TE  F++  +  A  L       + +S        +      K  LG GI  D R R+P Y SDYKD      +I K ++    L+F+ LLP++AFG+L +  T+ KINV   +L+Q +GG+ FAL GGQP+I+MLTT+PL+L I   Y +++     F   ++W+GIFN+++L +YS    S +M++S RSTEE F LF+S+ F+VD+VK   K F+  Y     VN T+ +  +                T EES     LL   + +G    G+     T+TPFLNS  R ++++++LP++VL MSFIGSY+FK++KI +F        S+   +  ++ I+ +  A  +AFPLS+LFFM+QN+ S++VNCP NKLKKG AYH+DLL+V IINL+LS+FGLPWVHG LPHSP+HV ALA +EE ID G++I + +VKV ETR+  +I++ILIG  + L+P PL+Y+P  VL+GLF+YMA TAL+ NQL ER++L  TEQ+AYPP+HYL+RVPQ+KVH+FT +Q  QL LLC LGF P  Y K+ FP +L+LQ+P RH IFPK IS  Y+DALDK
Sbjct:   69 EGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLL-FAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTT-LVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 835          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Planmine SMEST
Match: SMESG000039045.1 (SMESG000039045.1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 327/769 (42.52%), Postives = 469/769 (60.99%), Query Frame = 1
Query:  136 NGFNELVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMF-LTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNS----KPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVNATIAVTGSC---------------TKEESXXXXXXXXXXXXXXXXXNGL-----TETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
             G   LV+ R     +   S E+RA  D EKF     ++L+      + IV+ LL++++ L       ++D  +  A   L +  + +   Y + AKT+ G    +   ++ D SW+ AM SL+ +  R V       P+N+G S   V  + +VI P KEK  K DIE SR  A ++SD EFR  +  +  TE  F++  +  A  L       + +S        +      K  LG GI  D R R+P Y SDYKD      +I K ++    L+F+ LLP++AFG+L +  T+ KINV   +L+Q +GG+ FAL GGQP+I+MLTT+PL+L I   Y +++     F   ++W+GIFN+++L +YS    S +M++S RSTEE F LF+S+ F+VD+VK   K F+  Y     VN T+ +  +                T EES     LL   + +G    G+     T+TPFLNS  R ++++++LP++VL MSFIGSY+FK++KI +F        S+   +  ++ I+ +  A  +AFPLS+LFFM+QN+ S++VNCP NKLKKG AYH+DLL+V IINL+LS+FGLPWVHG LPHSP+HV ALA +EE ID G++I + +VKV ETR+  +I++ILIG  + L+P PL+Y+P  VL+GLF+YMA TAL+ NQL ER++L  TEQ+AYPP+HYL+RVPQ+KVH+FT +Q  QL LLC LGF P  Y K+ FP +L+LQ+P RH IFPK IS  Y+DALDK
Sbjct:  100 EGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLL-FAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTT-LVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 866          
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Planmine SMEST
Match: SMESG000061700.1 (SMESG000061700.1)

HSP 1 Score: 533.487 bits (1373), Expect = 2.349e-177
Identity = 309/776 (39.82%), Postives = 464/776 (59.79%), Query Frame = 1
Query:  151 LVITRNRPTNVPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNS----KPKSDNXXXXXXXXXXLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGG--HCVNATI-----------AVTGS-----------------CTKEESXXXXXXXXXXXXXXXXXNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAG---IMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSXXXXXXXXXXXXGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 2367
            LV++R     +   S E+RA  D EKF   + + L    +  E I++ +L  +    I D   L++ ++ A  +L +  +     Y + AKTI G        +  D SW+ AMA+L  +  R +       P N+G S+ +V  + +V+ P KEK  K +IE  R  + IM+D +FRQ +   +  E  FR   +  A +L  +    + +S   +   ++   +  K  +G GI  D + R+PHY SDY D F   N+I K  +T   L+FS LLP+IAFG+LN   T+ KI+V   +++Q IGG+ F + GGQP+I+MLTT+PL+L     +T+++     F   +   GIFNAVYL +YS T    +MK+S +STEE F  FV++ F VD+ K   K F  +Y     + VN +I            +T +                 C ++ S+L++LL +GT+ L   L   T+TP+LN+  R++L++FALP+++  MS IG+ +F+++ +  F    + +  +       LPI G   I+  AA+ FPLS+LFFM+QNIASS+VN P NKLKKG  +H+DL +V +IN  LSIFGLPW+HGA+PHSP+HV AL+ IEE ID G+K+ Q +V+V ETR+  I++NI I   +FL+P PL YIP  VL+GLF++MA T+L++NQ  ER+ L  TEQSAYPP+HYL+RVPQ+K+H+FT  Q +QL++L  LGF+P  Y+K+ FP +L+LQ+P RH I PK I + +++A+DK
Sbjct:  104 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIE-NEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF----YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 874          
The following BLAST results are available for this feature:
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A111.067e-14336.66solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A111.427e-14336.66solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A116.676e-14336.66solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A112.211e-13936.98solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A111.208e-12234.54solute carrier family 4 member 11 [Source:HGNC Sym... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abts-34.000e-15137.94Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-38.281e-15037.68Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-31.203e-14937.94Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-32.418e-14936.45Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-31.210e-14837.68Anion/Bicarbonate TranSporter family [Source:UniP... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ndae12.129e-4327.84gene:FBgn0259111 transcript:FBtr0299537[more]
Ndae12.462e-4327.84gene:FBgn0259111 transcript:FBtr0331662[more]
Ndae12.693e-4327.84gene:FBgn0259111 transcript:FBtr0331660[more]
Ndae13.889e-4327.84gene:FBgn0259111 transcript:FBtr0331659[more]
Ndae14.101e-4327.84gene:FBgn0259111 transcript:FBtr0299538[more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a117.263e-13133.93solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a117.263e-13133.93solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a113.143e-13034.25solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a113.143e-13034.25solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a116.714e-13034.02solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A111.576e-14535.75solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A112.203e-14535.75solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A115.445e-13635.35solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A113.024e-13537.15solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A117.817e-13535.88solute carrier family 4 member 11 [Source:NCBI gen... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc4a111.136e-13936.65solute carrier family 4, sodium bicarbonate transp... [more]
Slc4a11.345e-4828.24solute carrier family 4 (anion exchanger), member ... [more]
Slc4a21.524e-4327.40solute carrier family 4 (anion exchanger), member ... [more]
Slc4a21.962e-4327.40solute carrier family 4 (anion exchanger), member ... [more]
Slc4a22.592e-4327.40solute carrier family 4 (anion exchanger), member ... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NBS3|S4A11_HUMAN6.854e-14336.66Sodium bicarbonate transporter-like protein 11 OS=... [more]
sp|A2AJN7|S4A11_MOUSE7.946e-13936.65Sodium bicarbonate transporter-like protein 11 OS=... [more]
sp|P02730|B3AT_HUMAN2.224e-4827.77Band 3 anion transport protein OS=Homo sapiens OX=... [more]
sp|P04919|B3AT_MOUSE9.410e-4828.24Band 3 anion transport protein OS=Mus musculus OX=... [more]
sp|P48746|B3A2_RABIT3.023e-4527.92Anion exchange protein 2 OS=Oryctolagus cuniculus ... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H2A60.000e+041.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G7Q10.000e+041.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0H3YEW70.000e+042.60Slc4a-4 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A267GLC90.000e+041.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G7YII30.000e+045.77Sodium bicarbonate transporter-like protein 11 OS=... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011908.27.770e-14736.22pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047690.12.764e-14035.79pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
slc4a112.091e-13234.19solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a2b6.875e-5228.68anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2b1.015e-5128.68anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a116.000e-13736.57solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
SLC4A27.899e-4927.88solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A22.733e-3928.57solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A47.953e-3226.39solute carrier family 4 member 4 [Source:HGNC Symb... [more]
slc4a71.589e-3034.83solute carrier family 4 member 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BOR18.432e-4126.43Boron efflux transporter of the plasma membrane; b... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406112.263e-10733.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406101.627e-9953.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317934.401e-4528.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458445.455e-4029.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270892.297e-1434.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a112.927e-13835.16solute carrier family 4 member 11 [Source:NCBI gen... [more]
slc4a113.695e-13835.16solute carrier family 4 member 11 [Source:NCBI gen... [more]
slc4a111.419e-13634.84solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A114.571e-12536.09sodium bicarbonate transporter-like protein 11 [So... [more]
slc4a36.634e-5029.79solute carrier family 4 member 3 [Source:NCBI gene... [more]
back to top
BLAST of Sodium bicarbonate transporter-like protein 11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012150.10.000e+099.23SMESG000012150.1[more]
SMESG000012150.10.000e+099.23SMESG000012150.1[more]
SMESG000039045.10.000e+042.52SMESG000039045.1[more]
SMESG000039045.10.000e+042.52SMESG000039045.1[more]
SMESG000061700.12.349e-17739.82SMESG000061700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017389 ID=SMED30017389|Name=Sodium bicarbonate transporter-like protein 11|organism=Schmidtea mediterranea sexual|type=transcript|length=2473bp
TTAATCAAAAAAGACGATTCATAGAAATTTATGTTTTCTAACATTAATAA
AACTTTCGAACTAGCTAACAGTGACATTCCTTCGACTTCGAGACCCTCGG
ATGGTTCTATAACAATAGATTTTCCAACCGTCACTAATGGGTTCAATGAG
TTGGTTATTACGCGAAACAGACCGACAAATGTGCCATTTTTATCTGAGGA
AATTCGTGCTCGAGCTGACGCGGAAAAATTCTCTTTGACTGCGTCCATAG
TGTTGAATAATTACCACATCAAGACCGAAATCATTGTGAAGGATTTGCTG
CAGAAAATGTTTTTAACGACAATCCGAGATCATGACAAACTGGATCTTTC
TGTGGAATTGGCATTCGCTGAACTAATTGTCAGCAACAATGACAAGGAAG
GCGACTACTTTCAGTTCGCAAAAACTATAAACGGATTCGAGCACGGTAAA
GGGGGAGTAATGACCGCCGATCCTTCATGGTTGATTGCAATGGCATCGTT
GTCTTGGATAGATCATAGATTGGTTGGATTTACAACAACTGTCCATCCTA
TTAATATGGGCCCAAGTCATAGCAGTGTACAAATGTTAGCTATAGTTATT
GCTCCGATCAAAGAAAAAACGATGAAAAGAGACATTGAAACCAGTAGAAA
TATTGCAGCGATTATGAGCGACCCGGAATTTCGACAAACCATTAGAGGTT
ATGACGTAACTGAGACGACGTTTCGAGATGCATTCAAAGAGACCGCTGTC
CGGTTACAGAATTCCAAACCTAAATCTGACAACTCTGAAGGTGAGCATGA
AGAGCACAGTGGATTACATAATAAAGTAAGTTTGGGTCGTGGAATCTATA
AGGATTTTCGAGGACGGCTTCCACATTACTGGTCAGATTACAAGGATGCA
TTCATGGATAAAAATTCCATTTTTAAAACAATCACTACTATATTCGTTTT
ATTTTTTTCAAATCTTTTACCAACGATTGCATTTGGGATGTTGAACGAGT
ACGGAACAAATCACAAAATCAATGTTGCTAGTGGACTGCTCGCCCAATTA
ATTGGCGGGGTCGGATTCGCACTGTTCGGTGGTCAGCCTATGATAATTAT
GCTTACCACGTCTCCGTTGTCTCTTTTGATTGCCGCTTTTTATACAATGA
ACTCAAGTCTCGGTTACAAGTTTTTACAATTTTATACTTGGATCGGGATT
TTCAACGCTGTTTATTTGTTCGTTTACTCTTTTACTGGGTTCAGTATGAT
TATGAAATTTTCTCGTCGGTCAACAGAAGAAACCTTTGAGCTGTTTGTTT
CCGTAACTTTTGTCGTTGATTCAGTCAAGGCCTGCACGAAATCATTTCAT
AATTATTATTACGGAGGTCACTGCGTAAATGCTACTATTGCGGTGACAGG
AAGTTGCACGAAAGAAGAAAGTTTGTTGTTTGTTTTATTGCTCCTAGGTA
CAATGGCACTTGGTCTGTGGTTAAATGGGTTGACTGAAACACCCTTTCTC
AATTCGATGAGTAGAAAAATGTTATCTGAATTTGCACTTCCGGTATCAGT
ATTATTTATGTCGTTTATTGGATCTTATGTGTTCAAAGAAGTCAAAATCC
ATTCATTTACTGCACCCCCTTGGAGAAATATCTCAATGATAGCTACAGAC
ATTCGTGAATTGCCCATAGCGGGCATCATGCTAGCAGCTGCAGTGGCCTT
TCCTTTATCAATTCTATTTTTCATGGAACAGAACATTGCAAGTTCCATTG
TAAATTGTCCTTTAAACAAACTGAAAAAGGGACCAGCTTATCATTACGAT
TTGCTAGTTGTGGGGATTATTAATTTAATTCTTTCAATTTTCGGGTTACC
TTGGGTTCATGGAGCTCTACCTCATTCGCCGATGCATGTCACCGCCTTAG
CTACAATTGAAGAACATATTGATGAAGGAAACAAAATAGATCAAAAAGTC
GTGAAAGTCACAGAAACTCGTATTCCAGTAATTATTGCAAACATCTTAAT
TGGGTGCTGCATATTTCTTATGCCTTATCCATTACTCTACATCCCAGCTC
CAGTACTGAATGGGCTCTTCCTCTACATGGCCTTTACGGCACTTCATTCG
AATCAGTTATTCGAAAGACTTTTACTATTCATCACAGAGCAGTCGGCTTA
TCCTCCAAATCACTATCTCAAGCGAGTTCCTCAGAAAAAAGTCCACATTT
TTACATCAATTCAATTCCTGCAATTGTTGTTACTCTGTATTCTCGGATTC
ACTCCGATTACCTATGTGAAATTGGTCTTTCCATTTATTCTCATTCTTCA
GCTACCTTTTCGTCACATTATTTTCCCAAAAATTATCTCAAAAAAATATT
TAGACGCTTTGGATAAGTTGATATGTTAGAATATTTTATTTCCATTGAAT
ATTTTGTTTTAAACGTGCTATTTTTACGATGTATTTTTAATTGTTTGTTT
TTATGGCGGATTTTTTGGAGGTG
back to top

protein sequence of SMED30017389-orf-1

>SMED30017389-orf-1 ID=SMED30017389-orf-1|Name=SMED30017389-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=783bp
MFSNINKTFELANSDIPSTSRPSDGSITIDFPTVTNGFNELVITRNRPTN
VPFLSEEIRARADAEKFSLTASIVLNNYHIKTEIIVKDLLQKMFLTTIRD
HDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGVMTADPSW
LIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKR
DIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETAVRLQNSKPKSD
NSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKT
ITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFG
GQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYS
FTGFSMIMKFSRRSTEETFELFVSVTFVVDSVKACTKSFHNYYYGGHCVN
ATIAVTGSCTKEESLLFVLLLLGTMALGLWLNGLTETPFLNSMSRKMLSE
FALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIM
LAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLI
LSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPV
IIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLF
ITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVF
PFILILQLPFRHIIFPKIISKKYLDALDKLIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003020HCO3_transpt_euk
IPR011531HCO3_transpt_C
Vocabulary: biological process
TermDefinition
GO:0006820anion transport
GO:0006810transport
GO:0015698inorganic anion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005452inorganic anion exchanger activity
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003020Bicarbonate transporter, eukaryoticPRINTSPR01231HCO3TRNSPORTcoord: 285..294
score: 41.79
coord: 500..509
score: 33.21
coord: 405..417
score: 35.71
coord: 561..570
score: 57.5
coord: 575..588
score: 41.33
IPR003020Bicarbonate transporter, eukaryoticPANTHERPTHR11453ANION EXCHANGE PROTEINcoord: 55..779
NoneNo IPR availableGENE3DG3DSA:1.10.287.570coord: 278..323
e-value: 1.5E-6
score: 29.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 242..261
NoneNo IPR availablePANTHERPTHR11453:SF92SOLUTE CARRIER FAMILY 4 MEMBER 11coord: 55..779
NoneNo IPR availableTMHMMTMhelixcoord: 544..566
NoneNo IPR availableTMHMMTMhelixcoord: 721..743
NoneNo IPR availableTMHMMTMhelixcoord: 748..765
NoneNo IPR availableTMHMMTMhelixcoord: 464..481
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 501..518
NoneNo IPR availableTMHMMTMhelixcoord: 586..608
NoneNo IPR availableTMHMMTMhelixcoord: 381..403
NoneNo IPR availableTMHMMTMhelixcoord: 651..673
NoneNo IPR availableTMHMMTMhelixcoord: 300..322
NoneNo IPR availableTMHMMTMhelixcoord: 678..700
IPR011531Bicarbonate transporter, C-terminalPFAMPF00955HCO3_cotranspcoord: 265..443
e-value: 1.1E-47
score: 163.0
coord: 457..727
e-value: 1.0E-84
score: 285.2