Fibrillar collagen

Overview
NameFibrillar collagen
Smed IDSMED30017388
Length (bp)4277
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibrillar collagen (SMED30017388) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibrillar collagen (SMED30017388) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibrillar collagen (SMED30017388) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibrillar collagen (SMED30017388) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017388

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30017388h1SMcG0014134 Contig49544newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017388h1SMcG0014134 Contig49544uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30017388h1SMcG0014134 dd_Smed_v4_740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017388h1SMcG0014134 dd_Smed_v4_740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017388h1SMcG0014134 dd_Smed_v4_740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017388h1SMcG0014134 dd_Smed_v4_740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30017388h1SMcG0014134 dd_Smed_v6_740_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30017388h1SMcG0014134 dd_Smed_v6_740_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017388h1SMcG0014134 dd_Smed_v4_740_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017388h1SMcG0014134 dd_Smed_v4_740_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibrillar collagen vs. Ensembl Human
Match: COL2A1 (collagen type II alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2200])

HSP 1 Score: 139.813 bits (351), Expect = 1.713e-32
Identity = 77/242 (31.82%), Postives = 123/242 (50.83%), Query Frame = 2
Query: 3527 MYSDDANAANILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            +   DA     L S     ++I  P G++  PAR+C  LK      K G Y+IDPN G   DA +VFC METGETC+ P  ++  K ++  S++   K+I +GE ++G   F Y  D       N Q+ FL+++ST  +Q I   C N++A +++     +   +I   N+ E+  + +   +Y  +KD C   + +  +TV+   S  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1179 LRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDI---APMDIGGPEQEFGVDIGPVCF 1417          

HSP 2 Score: 69.3218 bits (168), Expect = 6.237e-11
Identity = 98/253 (38.74%), Postives = 117/253 (46.25%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV---------------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNA---GATGRPGLDGMI---------------------GIQGVKGDSGPQG 1201
            G +G  G  GP+G  G PG  GS G QG+ GP+G         P G  GP G  G  G  G +G  GE GAAG  G  G RGD+G +GP G+ G +G  G+                G +G PG  G  G  G PG  G TG  G  G  G  G +G  GA G  G+ G  GD GAPG  G +G PG +G  G TGP+G  G     GATG PG  G +                     G +G +GDSGP G
Sbjct:  618 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPG 870          

HSP 3 Score: 62.7734 bits (151), Expect = 5.391e-9
Identity = 95/282 (33.69%), Postives = 113/282 (40.07%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLG------------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            GPAG  GP G +G+PG KG  G                             G+ G  GA GPQGP+G PG    QGP G+ GPKG  G Q                     G  G  G PG  G +G                    GP G+ G  G PG  G  G  G  G  G  G PG  GP+G +G  G QG  G  G+ G PG  G+ G  G PG  GE G  G PG+             G  G  G  G  G+ GA G PG DG  G++G +G++
Sbjct:  762 GPAGFAGPPGADGQPGAKGEQG---------------------------EAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQ---------------------GPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 992          

HSP 4 Score: 58.9214 bits (141), Expect = 7.577e-8
Identity = 58/138 (42.03%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPG---------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G                +G  G  G PG +G  G RG  G+ G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  697 DRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAG 834          

HSP 5 Score: 58.5362 bits (140), Expect = 9.844e-8
Identity = 114/307 (37.13%), Postives = 131/307 (42.67%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPG---------------------IDGKDGSVGDPGAPGEHGSNGI------PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R   G  GLQGP G  G PG  GP G +GP G PG  G PG              G  G  GA G  GP G  G +G +GP+G  G  G                NGE+G  G  GP G  G +G  GE G  GP G  G  G  G+ G  G+ G +GE G  G  G PG  G +G  G  G  G TG KG RG QG  G  G  GA G                      DG  G+ GD G PG  G  G+      PG KG  G  GP G  G  G  G  G  G++G+ G +G+ G  GL
Sbjct:  634 FPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGL------------QGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGL 928          

HSP 6 Score: 58.151 bits (139), Expect = 1.439e-7
Identity = 54/131 (41.22%), Postives = 66/131 (50.38%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG---------------MNGTPGRDGRPGVAGM---------RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G++G  G+RGD G+ G  G PG+ G                NG  G  G PG AG          RG+TG PGP G AGP G+ G PG  G+ G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  679 LQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPT 809          

HSP 7 Score: 57.3806 bits (137), Expect = 2.828e-7
Identity = 79/208 (37.98%), Postives = 93/208 (44.71%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP+G TG+PG+ G +G QG  G  GP G Q                     GA GP G  G RG  G  G +G  GP GE G  G  GFPG DG+ G  G PG  GP+G  G +G  G  G  G  G PG  G  G  GD G  G+ G +G P               G  G  G  GP+G  G  G  G  GL G  G++G+ G  G
Sbjct:  381 GPKGQTGEPGIAGFKGEQGPKGEPGPAGPQ---------------------GAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDG 567          

HSP 8 Score: 55.0694 bits (131), Expect = 1.337e-6
Identity = 71/202 (35.15%), Postives = 84/202 (41.58%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGV---SGMPGV---------------------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------------------------DPGAPGEHGS---------NGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AGP G    RG  G+QGP G  G  G PG  G  G PG DGI G    +G PG+                     +GP G  G+ GI G KG +G  G PG  G  G+ G                        + GAPG  G           G PG +G  G  GP+G  G+ G  G PGL G  G+ G  GD+GPQG
Sbjct:  306 GEAGPTG---ARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQG 504          

HSP 9 Score: 54.299 bits (129), Expect = 2.109e-6
Identity = 56/134 (41.79%), Postives = 73/134 (54.48%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKG---KPGNTGPKGLTGNQGI 2926
            G +GP+G+ G PG+ GF G QG             PG +G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP   AGP+G+ G PG  G+ G PG +G   +PG+ GP+G  G  G 
Sbjct:  378 GPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGA 511          

HSP 10 Score: 53.5286 bits (127), Expect = 3.327e-6
Identity = 103/304 (33.88%), Postives = 121/304 (39.80%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQG------------------------KKGGEGVDGAPGIDGKDGSVGDPG---APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP+GP G+T                           G  G  GA GP G TG PG  G                       GP+G  G  GP G                    GE G  GP G PG +G+ G  GP G+ GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G                        ++G  G DG PG DG  G  GD G   A G  G+ G PGS G  G TG QG  G AGA G  G  G  G +G++G  GP+G
Sbjct:  789 GDAGAPGPQGPSGAPGPQGPTGVT---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGR------------------AGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRG 1047          

HSP 11 Score: 53.5286 bits (127), Expect = 3.873e-6
Identity = 84/215 (39.07%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  593 SGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGI---------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            +G  G  GP GP G  G  G+ G +G  GP GP G              GP G  G+ GA G  G  G +GD G+   QGP G+ GP+G  GV G  G  GA G  G +G PG  G  G     G+ G           G KG  G  G PG  G+ G  G  G PGE G  G  G  G++G  GPQG+ G  G  G PG  G  G  G+ G SG
Sbjct:  731 NGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAG------------FAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSG 933          

HSP 12 Score: 52.7582 bits (125), Expect = 7.111e-6
Identity = 80/213 (37.56%), Postives = 91/213 (42.72%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGIT---------------------GVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGI---PGSKGSQGGTGPQGIIGNAGATGRPGL 1150
             G +G  GA G +G TG PG  G  GP G +G  G  GEQG  G  G  G           G  GP G PG +G  G  GP G+ G +G PG     GFPGA G                       G  G  G  GP G  G+ G+QG  G  G  G PG DG  G+ G PG  G  G  GI   PG +G +G  G  G  G  G  G PG 
Sbjct:  743 AGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAP---------GPQGPSGAPGPQGPTGVTGPKGARGAQGPPGA---TGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGA 943          

HSP 13 Score: 52.373 bits (124), Expect = 9.395e-6
Identity = 60/153 (39.22%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVS------GRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDT---------------------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            GL G  G  G PG PG  G PG QG PG S      G  G  G  G  G PG  G  G +G PGRDG  GV G RG+T                           G+ G +GP GP G  GA G+ G  G  G KG+ G  G +GL G++G T
Sbjct:  915 GLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFT 1067          
BLAST of Fibrillar collagen vs. Ensembl Human
Match: COL2A1 (collagen type II alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2200])

HSP 1 Score: 136.732 bits (343), Expect = 1.360e-31
Identity = 77/242 (31.82%), Postives = 123/242 (50.83%), Query Frame = 2
Query: 3527 MYSDDANAANILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            +   DA     L S     ++I  P G++  PAR+C  LK      K G Y+IDPN G   DA +VFC METGETC+ P  ++  K ++  S++   K+I +GE ++G   F Y  D       N Q+ FL+++ST  +Q I   C N++A +++     +   +I   N+ E+  + +   +Y  +KD C   + +  +TV+   S  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1248 LRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDI---APMDIGGPEQEFGVDIGPVCF 1486          

HSP 2 Score: 69.707 bits (169), Expect = 3.899e-11
Identity = 98/253 (38.74%), Postives = 117/253 (46.25%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV---------------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNA---GATGRPGLDGMI---------------------GIQGVKGDSGPQG 1201
            G +G  G  GP+G  G PG  GS G QG+ GP+G         P G  GP G  G  G  G +G  GE GAAG  G  G RGD+G +GP G+ G +G  G+                G +G PG  G  G  G PG  G TG  G  G  G  G +G  GA G  G+ G  GD GAPG  G +G PG +G  G TGP+G  G     GATG PG  G +                     G +G +GDSGP G
Sbjct:  687 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPG 939          

HSP 3 Score: 63.929 bits (154), Expect = 2.635e-9
Identity = 95/282 (33.69%), Postives = 113/282 (40.07%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLG------------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            GPAG  GP G +G+PG KG  G                             G+ G  GA GPQGP+G PG    QGP G+ GPKG  G Q                     G  G  G PG  G +G                    GP G+ G  G PG  G  G  G  G  G  G PG  GP+G +G  G QG  G  G+ G PG  G+ G  G PG  GE G  G PG+             G  G  G  G  G+ GA G PG DG  G++G +G++
Sbjct:  831 GPAGFAGPPGADGQPGAKGEQG---------------------------EAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQ---------------------GPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 1061          

HSP 4 Score: 59.6918 bits (143), Expect = 4.767e-8
Identity = 114/307 (37.13%), Postives = 131/307 (42.67%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPG---------------------IDGKDGSVGDPGAPGEHGSNGI------PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R   G  GLQGP G  G PG  GP G +GP G PG  G PG              G  G  GA G  GP G  G +G +GP+G  G  G                NGE+G  G  GP G  G +G  GE G  GP G  G  G  G+ G  G+ G +GE G  G  G PG  G +G  G  G  G TG KG RG QG  G  G  GA G                      DG  G+ GD G PG  G  G+      PG KG  G  GP G  G  G  G  G  G++G+ G +G+ G  GL
Sbjct:  703 FPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGL------------QGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGL 997          

HSP 5 Score: 59.6918 bits (143), Expect = 5.365e-8
Identity = 58/138 (42.03%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPG---------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G                +G  G  G PG +G  G RG  G+ G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  766 DRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAG 903          

HSP 6 Score: 58.5362 bits (140), Expect = 1.081e-7
Identity = 54/131 (41.22%), Postives = 66/131 (50.38%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG---------------MNGTPGRDGRPGVAGM---------RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G++G  G+RGD G+ G  G PG+ G                NG  G  G PG AG          RG+TG PGP G AGP G+ G PG  G+ G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  748 LQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPT 878          

HSP 7 Score: 57.7658 bits (138), Expect = 1.809e-7
Identity = 79/208 (37.98%), Postives = 93/208 (44.71%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP+G TG+PG+ G +G QG  G  GP G Q                     GA GP G  G RG  G  G +G  GP GE G  G  GFPG DG+ G  G PG  GP+G  G +G  G  G  G  G PG  G  G  GD G  G+ G +G P               G  G  G  GP+G  G  G  G  GL G  G++G+ G  G
Sbjct:  450 GPKGQTGEPGIAGFKGEQGPKGEPGPAGPQ---------------------GAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDG 636          

HSP 8 Score: 55.0694 bits (131), Expect = 1.139e-6
Identity = 71/202 (35.15%), Postives = 84/202 (41.58%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGV---SGMPGV---------------------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------------------------DPGAPGEHGS---------NGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AGP G    RG  G+QGP G  G  G PG  G  G PG DGI G    +G PG+                     +GP G  G+ GI G KG +G  G PG  G  G+ G                        + GAPG  G           G PG +G  G  GP+G  G+ G  G PGL G  G+ G  GD+GPQG
Sbjct:  375 GEAGPTG---ARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQG 573          

HSP 9 Score: 55.0694 bits (131), Expect = 1.442e-6
Identity = 56/134 (41.79%), Postives = 73/134 (54.48%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKG---KPGNTGPKGLTGNQGI 2926
            G +GP+G+ G PG+ GF G QG             PG +G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP   AGP+G+ G PG  G+ G PG +G   +PG+ GP+G  G  G 
Sbjct:  447 GPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGA 580          

HSP 10 Score: 54.6842 bits (130), Expect = 1.811e-6
Identity = 103/304 (33.88%), Postives = 121/304 (39.80%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQG------------------------KKGGEGVDGAPGIDGKDGSVGDPG---APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP+GP G+T                           G  G  GA GP G TG PG  G                       GP+G  G  GP G                    GE G  GP G PG +G+ G  GP G+ GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G                        ++G  G DG PG DG  G  GD G   A G  G+ G PGS G  G TG QG  G AGA G  G  G  G +G++G  GP+G
Sbjct:  858 GDAGAPGPQGPSGAPGPQGPTGVT---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGR------------------AGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRG 1116          

HSP 11 Score: 54.299 bits (129), Expect = 2.218e-6
Identity = 84/215 (39.07%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  593 SGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGI---------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            +G  G  GP GP G  G  G+ G +G  GP GP G              GP G  G+ GA G  G  G +GD G+   QGP G+ GP+G  GV G  G  GA G  G +G PG  G  G     G+ G           G KG  G  G PG  G+ G  G  G PGE G  G  G  G++G  GPQG+ G  G  G PG  G  G  G+ G SG
Sbjct:  800 NGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAG------------FAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSG 1002          

HSP 12 Score: 53.1434 bits (126), Expect = 4.356e-6
Identity = 79/212 (37.26%), Postives = 92/212 (43.40%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGIT---------------------GVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG 1147
             G +G  GA G +G TG PG  G  GP G +G  G  GEQG  G  G  G           G  GP G PG +G  G  GP G+ G +G PG     GFPGA G                       G  G  G  GP G  G+ G+QG  G  G  G PG DG  G+ G P   G  G+ G  G+PG +G +G  G  G  G  G  G PG
Sbjct:  812 AGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAP---------GPQGPSGAPGPQGPTGVTGPKGARGAQGPPGA---TGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 1011          

HSP 13 Score: 52.7582 bits (125), Expect = 6.106e-6
Identity = 60/153 (39.22%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVS------GRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDT---------------------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            GL G  G  G PG PG  G PG QG PG S      G  G  G  G  G PG  G  G +G PGRDG  GV G RG+T                           G+ G +GP GP G  GA G+ G  G  G KG+ G  G +GL G++G T
Sbjct:  984 GLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFT 1136          

HSP 14 Score: 52.7582 bits (125), Expect = 6.157e-6
Identity = 110/277 (39.71%), Postives = 124/277 (44.77%), Query Frame = 2
Query:  440 AGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGP---------------------QGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            AG +G  GP+G PGP GP G  GP G+ GK G  G  G VGP GP G  G  G  G  G  G  G  G  G +GP G+ GPKG NG+                      G  G  GLPG RG  G  G  G  G  G  G  G  G PG  G  G  G PGV+G  G KG  G  GK G +G+ GAPG+ G  G  G+ GA G  G  G  G +G QG  GP                     QG+ G AGA G  G  G  G  G +G  G QGL 
Sbjct:  461 AGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDP---------------------GRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQ 716          
BLAST of Fibrillar collagen vs. Ensembl Human
Match: COL5A2 (collagen type V alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2210])

HSP 1 Score: 135.191 bits (339), Expect = 3.651e-31
Identity = 72/219 (32.88%), Postives = 114/219 (52.05%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYG-ELSGIQRFDYVIDN------TQLMFLKMVSTRANQEIKIACNN----MAVVEKTEYPAIIFTDNNRELTKDDHHLSYK--VIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            +T+  P G+K  PAR+C+ LK   S  + G Y+IDPN G + DA +V+C METGETCIS   SS  + ++  S++P NK + YG +++   +F Y          TQ+ FL+++S  A+Q I   C N    M    K    A++    N    K + ++ ++  V++D C   +    +TV    + +  RLPI DL  +       EF +++  VCF
Sbjct:  893 ETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSVEDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSPNTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIRFRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCF 1111          

HSP 2 Score: 70.0922 bits (170), Expect = 3.049e-11
Identity = 82/219 (37.44%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG---------GEGVDGAPGIDGKDGSVGDPGAPGEHG---------------SNGIPGSKGSQGGTGPQGIIGNAGATGR---PGLDG 1156
             +G +G  GA G  G  G PGL G +G +G+ GPKG                        E+GA G  G  G  G +G  G +G  GP GE G  G  GFPG+DG+ G  G  G  GP G+ G +G QG  G           G+ G PG+ G +G +G  GAPGE G               S G+PG KGS G  G  G  GNAG  G+   PG DG
Sbjct:   67 EVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKG------------------------EVGAPGSKGEAGPTGPMGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDG 261          

HSP 3 Score: 68.5514 bits (166), Expect = 1.050e-10
Identity = 55/108 (50.93%), Postives = 62/108 (57.41%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G PG +G  GN G PG  G  GERGD+G  G  G+PG  G  GTPG  G PG AG RGD   PG RGP GP G  G  GL G  G  G KG  G+ G +G  G++G T
Sbjct:  657 GEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGD---PGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRGQKGHRGFT 761          

HSP 4 Score: 66.6254 bits (161), Expect = 3.492e-10
Identity = 97/242 (40.08%), Postives = 116/242 (47.93%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRG---DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---------------GDPGAPG------------------EHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            MG  G  G  GP G  G PG  G  G  G+ GPKG  GE+GP G +GP G +G      + G  G  GLPG RG   + G QGP G  GP G PG  GR G PG+ GI G  G  G+ GP G+ GD G  G+ G  GV G  G  GKDG V               G+ G PG                  + G  G+PG  G+ G  GP+G  GN G  G PG+ G+ G +G+ G  GP G
Sbjct:  119 MGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQG------DPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDG 354          

HSP 5 Score: 65.0846 bits (157), Expect = 9.890e-10
Identity = 60/137 (43.80%), Postives = 74/137 (54.01%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERG---DQGKLGVPGIPGE---TGMNGTPGRDGRPGVAGMRG---------DTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G +GN G  G  G+PG  GFPG  G+PG+ G  G +G    +G++G PG  GE   TG  G PG  G PG  G RG           G PGP+G  G  G  G+ G  G  G PG+ G+PG  G +GLTGN G+ GP
Sbjct:   60 GRNGNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGP 196          

HSP 6 Score: 63.1586 bits (152), Expect = 3.929e-9
Identity = 60/141 (42.55%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGER------------GDQGKLGVPGIPGETGMN---------------GTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGST---GAPGLMGDIGKPGQKGKPGNTG 2896
            D G  G  GP G+ G PG  GFPG+ G+PG  G  GER            GD G+ G PG+PG  G+                G PG DGRPG  G  G  GQPG  G  GP+GS+   G PG  G+ G PGQ+G PG  G
Sbjct:  121 DPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDG 261          

HSP 7 Score: 62.3882 bits (150), Expect = 7.667e-9
Identity = 73/169 (43.20%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGIQGKKGGEGVDGAPGI---------------DGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS---GPQGL 1204
            E G  G  G PGI G  G +G  G HGP+G  G  G  G PG  G  G+ GMPG  G  GT   KGDRG  G+KG EG  G  G                 G+ G  G  G  G  GS G PGS+G  G TG  G  G  G  G+PG+ G  G  G KGD+   GPQGL
Sbjct:  325 ERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGL 493          

HSP 8 Score: 62.003 bits (149), Expect = 9.967e-9
Identity = 57/118 (48.31%), Postives = 64/118 (54.24%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G VGP   PG  G  G PGN+G PG  G  G +G QG+ G  G  G  G  G PGR G PG+ G RG TG PG +GP G  G  GAPG  G  G PG  G  G  G  GL G +G +G
Sbjct:  123 GTVGP---PGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSG 237          

HSP 9 Score: 58.9214 bits (141), Expect = 8.769e-8
Identity = 57/143 (39.86%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  845 EGEPGVG---GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP------------GAPGEH---GSNGIPGSKGSQ------GGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            +GEPG     G +GF G+ G  G  G PG+ G  G +G +G++G KG  G  G+ G  G  G +GDP            GAPG     GS+G+PG KG+Q      G +GP+G  G+ G  G PGL G  G+ G  G  GP+G
Sbjct:   56 DGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEG 198          

HSP 10 Score: 55.4546 bits (132), Expect = 8.251e-7
Identity = 63/150 (42.00%), Postives = 78/150 (52.00%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGN---PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP------------------------AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DG  G+ GP G PG+   PGL G PG +G+ G  G  G+RG  G+ G  G  G  G  G PG  G PG AG  G+ G+PGPRG                         AGP+G  G PG+ G+ G+PGQKG  G+ GP+GL G+ G  GP
Sbjct:  353 DGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGP 502          

HSP 11 Score: 54.6842 bits (130), Expect = 1.479e-6
Identity = 105/259 (40.54%), Postives = 124/259 (47.88%), Query Frame = 2
Query:  479 GPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRM------------GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGK---------KGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP+GP GL G QG  G  G PG  G  GP GP G              G  GRNG  G  G  G PG  G  G  G+ G KG  G +            G +GP GE+GA G  G  G  G +G  G +G  GP GE G  G  GFPG+DG+ G  G  G  GP G+ G +G QG           G  G+ G PG+ G +G +G  GAPGE G  G PGS G +G  G  G+ G  G++G PG  G  G  GV G  G
Sbjct:    9 GPRGPQGLQGQQGGAGPTGPPGEPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHK------------GLEGPKGEVGAPGSKGEAGPTGPMGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRG 255          

HSP 12 Score: 53.5286 bits (127), Expect = 3.718e-6
Identity = 51/112 (45.54%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 2603 PGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            PG PG DG PG  G PG  G  G  G +G  G PG+PG  G  G  G +G  G  G  G  G+ GP GP G  G+ G PG +G+ G PG +G PG+ G  G  G QG  GP+
Sbjct:   50 PGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPV 161          

HSP 13 Score: 52.7582 bits (125), Expect = 5.627e-6
Identity = 56/152 (36.84%), Postives = 69/152 (45.39%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---------------------PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G  G +GP G+ GN      PG+ G PG +G+ G  G DG +G  G  G PG  G  G+ G PG  G  G  G +GD G  G +G  G  G+ GA                     PG  G +G PG +G PG+ G  G TG  G  GP 
Sbjct:  313 DPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQ 464          

HSP 14 Score: 52.7582 bits (125), Expect = 6.552e-6
Identity = 77/182 (42.31%), Postives = 89/182 (48.90%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP------GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGR 1141
            G TG PGL G  G +G+ G  GP G++G  G               E GA G  G  G RG  G  GP G  GP   +GEPG  G +G PG+ G  G  G     GPTG  G  G QG  G  GV G PG  G+ G  G P      G+PG HG NG+PG KG +G  GP G  G  G+ GR
Sbjct:  366 GDTGPPGLQGMPGERGIAGTPGPKGDRGGIG---------------EKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGE---NGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGR 529          

HSP 15 Score: 52.373 bits (124), Expect = 7.565e-6
Identity = 128/319 (40.13%), Postives = 152/319 (47.65%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQG------MNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPG---APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSG 1516
            G  G  G  GP+G  G PG  G  GP G        GP GP GE+G  G                 G  G  GLPG +G  G +GP+GS GP+G  G  GR G PG  G  G++G PGV GP G  G  G  G+ G  G  G+ GI G+ GS+G PG   + G+ G  G  G+ G  G  G  G  G  G +G  G  G+ G +G +G  GP G  G  G  G  G  G  G  G PG+ G  G +G  G RG PG +G  G  G PG  G  G  G DG  G  G +G PG  GP G QG+ G  G  G  GP G  G
Sbjct:   90 GHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGDPGTVGPPGPVGERGAPG---------------NRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG 393          
BLAST of Fibrillar collagen vs. Ensembl Human
Match: COL5A2 (collagen type V alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2210])

HSP 1 Score: 134.035 bits (336), Expect = 9.696e-31
Identity = 72/219 (32.88%), Postives = 114/219 (52.05%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYG-ELSGIQRFDYVIDN------TQLMFLKMVSTRANQEIKIACNN----MAVVEKTEYPAIIFTDNNRELTKDDHHLSYK--VIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            +T+  P G+K  PAR+C+ LK   S  + G Y+IDPN G + DA +V+C METGETCIS   SS  + ++  S++P NK + YG +++   +F Y          TQ+ FL+++S  A+Q I   C N    M    K    A++    N    K + ++ ++  V++D C   +    +TV    + +  RLPI DL  +       EF +++  VCF
Sbjct: 1280 ETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSVEDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSPNTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIRFRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCF 1498          

HSP 2 Score: 81.2629 bits (199), Expect = 1.186e-14
Identity = 145/361 (40.17%), Postives = 174/361 (48.20%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGP---IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG------------TGPQGIIGNAGATGRPGLDGMI---------GIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPG---SRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
             +G +G  GA G  G  G PGL G +G +G+ GPKG  G        G  G  GP GP+G +G  GP G+PG RG LG QG     G+HG  G+PG  G +G PG+ G  G  GM G  GPTG +G  G QG++G  G  G  G  G  G++G  G PG  G  G PG+ G  G             TGPQGI G  G  G PG  G           GIQG  G  G +G  G  G  G+VGPPG +G  G PGNRG                                   G DGLPG  GA G+ G   S GP+GSQG  G PG+ G+ G  GL+G PG     GP+GK+GP G  G+
Sbjct:  277 EVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVG------APGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRG---------------------------------FPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQ---GPEGKLGPLGAPGE 595          

HSP 3 Score: 69.3218 bits (168), Expect = 6.322e-11
Identity = 83/198 (41.92%), Postives = 96/198 (48.48%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQG---MNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGR---PGLDG 1156
              G  G  G  G QGP G PG  G +GP+G     GP GP GE+G  G                 G  G  GLPG +G  G +GP+GS GP+G  G  GR G PG  G  G++G PGV GP G  G  G            APG DG+ G  G  G  G+ GS G+PG KGS G  G  G  GNAG  G+   PG DG
Sbjct:  478 EAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPG---------------NRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLG------------APGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDG 648          

HSP 4 Score: 68.1662 bits (165), Expect = 1.253e-10
Identity = 55/108 (50.93%), Postives = 62/108 (57.41%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G PG +G  GN G PG  G  GERGD+G  G  G+PG  G  GTPG  G PG AG RGD   PG RGP GP G  G  GL G  G  G KG  G+ G +G  G++G T
Sbjct: 1044 GEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGD---PGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRGQKGHRGFT 1148          

HSP 5 Score: 65.4698 bits (158), Expect = 7.761e-10
Identity = 108/292 (36.99%), Postives = 129/292 (44.18%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRG---DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---------------GDPGAPG------------------EHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP G+QGP GP G  G +GP G                                G  G  GP G  G PG  G  G  G+ GPKG  GE+GP G +GP G +G      + G  G  GLPG RG   + G QGP G  GP G PG  GR G PG+ GI G  G  G+ GP G+ GD G  G+ G  GV G  G  GKDG V               G+ G PG                  + G  G+PG  G+ G  GP+G  GN G  G PG+ G+ G +G+ G  GP G
Sbjct:  486 GPHGIQGPIGPPGEEGKRGPRG------------------------------DPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQG------DPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDG 741          

HSP 6 Score: 63.5438 bits (153), Expect = 3.638e-9
Identity = 60/141 (42.55%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGER------------GDQGKLGVPGIPGETGMN---------------GTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGST---GAPGLMGDIGKPGQKGKPGNTG 2896
            D G  G  GP G+ G PG  GFPG+ G+PG  G  GER            GD G+ G PG+PG  G+                G PG DGRPG  G  G  GQPG  G  GP+GS+   G PG  G+ G PGQ+G PG  G
Sbjct:  508 DPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDG 648          

HSP 7 Score: 62.7734 bits (151), Expect = 5.691e-9
Identity = 108/294 (36.73%), Postives = 127/294 (43.20%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPD---------------GPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLP---GIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGK---------KGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            +KG A  TG R   GP G +G                 G +G PG KGP G                 G  GP G  G  G  G  G+ GPQG  G+PG  G  G +G  GPKG  G                       G  GPIG P   G RG  G  G +G  GP GE G  G  GFPG+DG+ G  G  G  GP G+ G +G QG           G  G+ G PG+ G +G +G  GAPGE G  G PGS G +G  G  G+ G  G++G PG  G  G  GV G  G
Sbjct:  385 MKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTG---------------SPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPH---------------------GIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRG 642          

HSP 8 Score: 62.7734 bits (151), Expect = 5.986e-9
Identity = 119/323 (36.84%), Postives = 135/323 (41.80%), Query Frame = 2
Query:  395 KGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPT---------GKPGLMGSQGPQGMNGPKGPN---GEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLP------------------------GIR---GDLGSQGPIGSHGPEGEP---GVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD------------GSVGDPGAPGE---HGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            KG A  TG     GP G +G  G  GR GP+G  G                           + G  G  G  GP GP          G PG+ G  GP G  GP+GP    GE GP G  G PG  G  G  G  GA GP G P                        GIR   GD G  G  G  GP+GEP   G+ G IG PG +G  G  G PG +GP G  G+RG  G +G  G DG PG  G              GS GDPG PGE    G+ G+ G+ G QG  G  G +G  G  GRPG  G IGI+G  G  G
Sbjct:  320 KGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPG---------------------------QRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMG 615          

HSP 9 Score: 62.003 bits (149), Expect = 9.364e-9
Identity = 56/118 (47.46%), Postives = 64/118 (54.24%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G PG  G  G PGN+G PG  G  G +G QG+ G  G  G  G  G PGR G PG+ G RG TG PG +GP G  G  GAPG  G  G PG  G  G  G  GL G +G +G
Sbjct:  507 GDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSG 624          

HSP 10 Score: 62.003 bits (149), Expect = 1.002e-8
Identity = 73/169 (43.20%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGIQGKKGGEGVDGAPGI---------------DGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS---GPQGL 1204
            E G  G  G PGI G  G +G  G HGP+G  G  G  G PG  G  G+ GMPG  G  GT   KGDRG  G+KG EG  G  G                 G+ G  G  G  G  GS G PGS+G  G TG  G  G  G  G+PG+ G  G  G KGD+   GPQGL
Sbjct:  712 ERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGL 880          

HSP 11 Score: 61.2326 bits (147), Expect = 1.794e-8
Identity = 55/126 (43.65%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 2585 VGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRG---------DTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
             GP+G  G PG  G PG +G  G  G  G  G QG +G PG  G+ G  G PG  G PG  G RG           G PGP+G  G  G  G+ G  G  G PG+ G+PG  G +GLTGN G+ GP
Sbjct:  458 TGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGP 583          

HSP 12 Score: 60.8474 bits (146), Expect = 2.036e-8
Identity = 57/130 (43.85%), Postives = 71/130 (54.62%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGER---GDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL---MGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            + G +GN G  G  G+PG  GFPG  G+PG+ G  G +   G +G++G PG  GE G  G  G  G  G  GM G+ G+ GP+G  G  G+ G PG    MG +G PG  G PGN G KG  G  G  GP
Sbjct:  268 EPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGP 397          

HSP 13 Score: 60.8474 bits (146), Expect = 2.370e-8
Identity = 138/353 (39.09%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGR---------------IGFPGADGITGVSGMPGV------------------IGPTGTKG---DRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG---DSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGA 1528
            G  G  G+ G  GPTG  G MG  GP+GM G +G  G QG  G  G  G  G  GP+G LG  G  G PG  G  G  GP G+ GPEG  G  G                IG  G  G  G +G PG                    GP G +G   D G+ G KG  G  G PG  G  G +G PG  G+ G  G PG+ G  G  G +G  GN G  G  GL G  G QG +G    SGP+G  G  G  G  G PG+ G  GNPG                      QGP G  G  G+PG DGR G PG  G  G+PGS G  G +G +G PGK G  G  G+ GQ GA
Sbjct:  312 GEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPG---------------------VQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGA 643          

HSP 14 Score: 59.3066 bits (142), Expect = 6.922e-8
Identity = 85/218 (38.99%), Postives = 103/218 (47.25%), Query Frame = 2
Query:  476 PGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQ---GMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---EGEPGVGGRIGFPGADGIT---GVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP---GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQG 1093
             GP+G  G                 G  G  G  G  G  G  G  G QGP G PG  G +GP+   G  GP GP GE+               G  G  G  G  GLPG +G  G +GP+GS GP   +G+PG  G  G PGA G+T   GV G  G +GP G  G+ G  G  G  G+ G P   G+ G  GS GDPG PGE G+ G+PG +G+ G
Sbjct:  458 TGPQGIRGQP---------------GDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGER---------------GAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPG 645          

HSP 15 Score: 55.8398 bits (133), Expect = 8.205e-7
Identity = 63/150 (42.00%), Postives = 78/150 (52.00%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGN---PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP------------------------AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DG  G+ GP G PG+   PGL G PG +G+ G  G  G+RG  G+ G  G  G  G  G PG  G PG AG  G+ G+PGPRG                         AGP+G  G PG+ G+ G+PGQKG  G+ GP+GL G+ G  GP
Sbjct:  740 DGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGP 889          

HSP 16 Score: 54.299 bits (129), Expect = 2.007e-6
Identity = 104/245 (42.45%), Postives = 121/245 (49.39%), Query Frame = 2
Query:  845 EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            +GEPG  G  G  G  G  G  G PG  G  G KG RG +G +G +G  GAPG  G+ G  G  GA G  G  G+PG +G     GPQG  G  GA G PG  G +G  G+ G SG  G                     NPG +G+ G  G  G  G  G +G  GP GP G  G PGA G DG PG  G  G PG+ GP GS G  G PG  G  GP G+ GQPG    PG +G+ GP+G  G
Sbjct:  266 DGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGR---LGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPG---------------------NPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPG 486          

HSP 17 Score: 53.1434 bits (126), Expect = 5.387e-6
Identity = 56/152 (36.84%), Postives = 69/152 (45.39%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---------------------PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G  G +GP G+ GN      PG+ G PG +G+ G  G DG +G  G  G PG  G  G+ G PG  G  G  G +GD G  G +G  G  G+ GA                     PG  G +G PG +G PG+ G  G TG  G  GP 
Sbjct:  700 DPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQ 851          

HSP 18 Score: 52.7582 bits (125), Expect = 7.116e-6
Identity = 81/194 (41.75%), Postives = 93/194 (47.94%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP------GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGR 1141
            G  G  G  G  G TG PGL G  G +G+ G  GP G++G  G               E GA G  G  G RG  G  GP G  GP   +GEPG  G +G PG+ G  G  G     GPTG  G  G QG  G  GV G PG  G+ G  G P      G+PG HG NG+PG KG +G  GP G  G  G+ GR
Sbjct:  741 GPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIG---------------EKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGE---NGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGR 916          
BLAST of Fibrillar collagen vs. Ensembl Human
Match: COL1A1 (collagen type I alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2197])

HSP 1 Score: 132.494 bits (332), Expect = 2.850e-30
Identity = 83/256 (32.42%), Postives = 122/256 (47.66%), Query Frame = 2
Query: 3506 IYDPNRPMYSDDANAANI--LGSDT-----------ISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINK-YISYGE--LSGIQRFDY-------VIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEY----PAIIFTDNNR-ELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
             +D  R   +DDAN      L  DT           I  P G++  PAR+C  LK   S  K G Y+IDPN G   DA +VFC METGETC+ P Q S ++ ++  S+NP +K ++ +GE    G Q F+Y            QL FL+++ST A+Q I   C N       +      A++   +N  E+  + +   +Y V  D C + +    +TV+   +  + RLPI D+  L   +   EF   +  VCF
Sbjct: 1209 AHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQ-FEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCF 1463          

HSP 2 Score: 61.2326 bits (147), Expect = 1.878e-8
Identity = 107/293 (36.52%), Postives = 130/293 (44.37%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEG------------------EPGVGGRIGFPGADGI---------------TGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---------DGAPGIDGKDGSVGDPGAPGEHGS---NGIPGSKGSQGGTGPQGIIGNAG---ATGRPGLDGMIGI 1168
            G AG +GP G  G PGP GP G                          G  GR G  G  G +G TG PG   S GP G  GP GP G+ G  G  GPPG +G  G +G  G  G  G PG  G+ G  GP G+ GP G                  E G  G  G PG  G+                GV G  G  GP+G +G+RG  G++G +G          +GAPG DG  G  G PGAPG  G+    G+PG +G+ G  GP+G  G+AG   A G PG DG+ G+
Sbjct:  500 GVAGPKGPAGERGSPGPAGPKG------------------------SPGEAGRPGEAGLPGAKGLTGSPG---SPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGL 765          

HSP 3 Score: 60.8474 bits (146), Expect = 1.975e-8
Identity = 44/94 (46.81%), Postives = 53/94 (56.38%), Query Frame = 2
Query: 2636 NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            + G  G  GR GERG  G  G  G+PG  G+ G  G  G  G+ G +GD G  GP+G  G  G  GAPG MG  G PG++G+PG  GP G  GN
Sbjct:  231 DDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGN 324          

HSP 4 Score: 52.373 bits (124), Expect = 8.607e-6
Identity = 58/131 (44.27%), Postives = 72/131 (54.96%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGN---PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI---------------GKPGQKGKPGNTGPK 2902
            +DG  G+ G  G PG+   PGL G PG +G  G+ G  G+RGD G  G  G PG+ G+ G  G  G PG AG  GD G+ GP GPAGP G+ GAPG  G+                G+PG KG+PG+ G K
Sbjct:  705 NDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAK 835          
BLAST of Fibrillar collagen vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 84.3445 bits (207), Expect = 3.327e-16
Identity = 135/379 (35.62%), Postives = 162/379 (42.74%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGE------PGVGGRIGFPGADGITGVSGMPGVIGPTGT------------------------KGDRGI------QGKKGGEGVDGAPGIDGK------------DGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G+ G  G  G +G  G PG  G +G +G +G  GP G++G  G  G  G  G KG  G  GA G  G PG +GD G +G  GS G +G+      PG  G  G  GADG  G  G PG  G  G                         KGD+G       +G KG +G DGA G DG             DG  GD GA G  G+NG PG+KG +G  G  G  G  G  G  G  G  G+ G KGD G  G  G  G  G  G  G+ G  G PG+                            G  G+ GA G DG PG  G  G+ G  GP+G +G  G PG  G  G  G  G  GA+  PG +G  G +GL G
Sbjct:  160 GQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGS---------------------------KGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDG 511          

HSP 2 Score: 83.9593 bits (206), Expect = 4.456e-16
Identity = 134/336 (39.88%), Postives = 164/336 (48.81%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
             G  G +GA G +G  G PG  G +G +G +G KG +G              G KG  G  GA G  G PG +GD G +G   P G  G +G PG  G  G  GADG  G  G PG  G  G KG  G +G KG +G  GA G  G  G  G+ G  G  G++G PG+KG +G  G  G  G+ GA G PG     G +G KG  G +G +G  G  G  G  G+ G  G PG +GD G  G  G +G  G  G+ G  G  G  G+ GA G DG PG  G  G  G  GP+G +G  G PG  G  G  G  GQPG     G +G+ G  G  G+
Sbjct:  237 KGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADG------------TPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGA---KGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQ 557          

HSP 3 Score: 82.8037 bits (203), Expect = 1.156e-15
Identity = 126/338 (37.28%), Postives = 155/338 (45.86%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT------KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G  G  GA G +G  G PG  G +G +G++GPKG  G  G  G  G  G KG        GA G  G PG +GD G +G  G  G +G  G  G  G PGA G  G  G  G  G  GT      KG++G+ G KG +G DG PG  G     G+ GA G  G++G PGSKG +G  G +G  G  G  G  G     G+ G KGD G  G  G  G  G  G  G+ G  G PG++GD G                                G DG  G  GA+G PGS+G +G +G  G PG+ G  G  G  GQPG     G  G+ G +G  G+
Sbjct:  277 GSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGAD------GAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKG---DKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKG---EKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDK------------------------------GLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ 572          

HSP 4 Score: 80.1073 bits (196), Expect = 6.432e-15
Identity = 110/296 (37.16%), Postives = 130/296 (43.92%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNG------------EQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAP------GEHGSNGIPGSKGSQGGTGPQGIIGN-----AGATGRPGLDGMIGIQGVKGDSGPQG 1201
             KG     G++   G  GL GP G +G  G KG NG  G                          G  G  G  G +G  G PG  G +G +G++GPKG  G            E+G  G  G  G  G KG  G  GA G  G PG +GD G +G   P G  G +G PG  G  G  GADG  G  G PG     G KGD+G+ G KG +G DG PG  G  G  GD G P      GE G +G PG KG  G  G +G  G+      G  G+PG  G  G  G KGD G +G
Sbjct:  332 AKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGA------------------------KGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGS---KGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKG 600          

HSP 5 Score: 73.1738 bits (178), Expect = 1.036e-12
Identity = 105/290 (36.21%), Postives = 128/290 (44.14%), Query Frame = 2
Query:  761 ELGAAGPIGLPGI--RGDLGSQGPIGSHGPEGEPGVGGRIGFPGADG---------------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            + G  G  G PG+  +GD G+QGP G  G +G+ G       PGA G                 G  G PG  G  G KG++G  G  G +G  G  G DG  G  GD GA G  G++G PGSKG +G  G +G  GN G+ G  G  G  G  G KGD G  G  G  G  G  G  G+ G  G PG+                            G  G+ GA G DG PG  G  G+ G  GP+G +G  G PG  G  G  G  G  GA+  PG +G  G +GL G
Sbjct:   96 DKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGA------PGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGS---------------------------KGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDG 352          

HSP 6 Score: 69.707 bits (169), Expect = 1.127e-11
Identity = 91/218 (41.74%), Postives = 110/218 (50.46%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLM-----GSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS---KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGV---KGDSGPQGLN 1207
            G  G  G  G +G TG PG+      G+QGP G  G  G  G  G KG  G  G KG KG  GE G  G  G  G +G+ G +G  GS G +G+ G  G  G PG  G  G  G  G  G  G+KGD+G  G KG +G  G+ G  G  G  G  GA G+ G+NG PGS   KG +G  G +G  G  G+ G  G DG  G  G    KGD G +GL+
Sbjct:   89 GDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD 306          

HSP 7 Score: 68.1662 bits (165), Expect = 3.731e-11
Identity = 58/128 (45.31%), Postives = 69/128 (53.91%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPE---GSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG  G+ G +G  G  G DG PG +G  G  G DG +GD+G  G PG     GE G +G  G DG PG  G +GD G  GP+G  G +   GS G  G  GDIG+PGQKG  G  G  G  G +G  G
Sbjct:  432 DGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDG 559          

HSP 8 Score: 62.7734 bits (151), Expect = 1.433e-9
Identity = 54/129 (41.86%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQG---VPGVSGRDGERGDQGKLGVPGIP---GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DG  G +G  G  GLDG  G++G    PG  G  GE+G  G  G  G P   G+ G +G  G DG PG  G +G+ G  GP+G  G +G+ GA G  G+ G  G KG  G  G KG  G++G+ GP 
Sbjct:  385 GADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPK 513          

HSP 9 Score: 62.3882 bits (150), Expect = 1.965e-9
Identity = 50/112 (44.64%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---ERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 2896
            GLDG  G +G  G PG  G  G +G  G  G DG    +GD+G  G+ G  G+ G +GTPG     G  G +GD GQPG +G  G +G  G PG  G  G+PGQKG  G+ G
Sbjct:  463 GLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGS---KGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG 571          

HSP 10 Score: 62.003 bits (149), Expect = 2.985e-9
Identity = 53/132 (40.15%), Postives = 69/132 (52.27%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKL---------GVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DGN G +G  G+ G  G  G +G  G +G  G +GD+G+          G PG  G+ G +G  G DG PG  G +G+ G  GP+G  G +G+ GA G  GD G  G KG  G  G KG  G +G+ GP 
Sbjct:  223 GADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPK 354          

HSP 11 Score: 61.2326 bits (147), Expect = 5.025e-9
Identity = 56/133 (42.11%), Postives = 71/133 (53.38%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---PGLMGDIGKPGQ---KGKPGNTGPKGLTGNQGITGPM 2938
            DG  G+ G +G  G  G DG PG +G  G  G DG +GD+G  G PG     G+ G +G  G DG PG  G +G+ G  GP+G  G +G+ GA   PG  GD G+ G    KG  G  G KG  G +G+ GP 
Sbjct:  273 DGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPK 405          

HSP 12 Score: 59.3066 bits (142), Expect = 1.823e-8
Identity = 68/191 (35.60%), Postives = 84/191 (43.98%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKG--DRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL 1150
             G  G  GA G +G  G PG  G +G +G++GPKG  G                             G PG +GD G +G IG  G +G+ G  G+ G PG     G  G PG  G  G KG  ++G  G+ G +G DG PG  G  G  GD G PG+ G  G  G  G  G  G  G  G  G  G+PG 
Sbjct:  480 KGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKG---------------------------ADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPG---QKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 13 Score: 58.151 bits (139), Expect = 4.170e-8
Identity = 54/126 (42.86%), Postives = 63/126 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DGN GP+   G+ G DG  G  G PG  G  G  G +G  G PG  G+TG  G  G DG  G  G  G  G  G +G  G +G+ GA   PG  GD G  G KG  G  G KG  G +G+ GP 
Sbjct:  187 GADGNPGPK---GDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPK 309          

HSP 14 Score: 58.151 bits (139), Expect = 4.170e-8
Identity = 51/129 (39.53%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLG------VPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G+ G +G  G  G DG PG++G  G  G DG +GD+G  G       PG  G+ G  GT G  G  G  G +GD G+ G  GP G +G+ G PG  GD G+ G  G  G  G  G  G++G  G  
Sbjct:  319 GAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAK 447          

HSP 15 Score: 57.7658 bits (138), Expect = 6.333e-8
Identity = 52/123 (42.28%), Postives = 62/123 (50.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G DG  G +G PG+ G  G  G  G  G  G DG +G  G  G  G  GE G +G  G DG PG  G +G+ G  GP+G  G +G+ GA G  G+ G  G KG  G  G KG  G  G  G
Sbjct:  326 DKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKG 448          

HSP 16 Score: 56.6102 bits (135), Expect = 1.180e-7
Identity = 44/98 (44.90%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGD--QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQK 2875
            G +G  G  G DG PG +G  G  G+ G++GD  QG+ G  G PG+ G +G PG+    G  G +GD GQPG +G  G +G  G PG  G  G+PGQK
Sbjct:  538 GQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQ---KGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQK 632          

HSP 17 Score: 55.8398 bits (133), Expect = 2.144e-7
Identity = 50/125 (40.00%), Postives = 60/125 (48.00%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G  G  G  G PG+ G  G  G  G PG  G  G  G +G  G PG  G+ G +G  G DG PG  G  GD G+ G  G  G +G+ G PG  GD G+ G  G  G  G  G  G++G  G  
Sbjct:  164 DKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAK 288          

HSP 18 Score: 53.1434 bits (126), Expect = 1.658e-6
Identity = 51/127 (40.16%), Postives = 63/127 (49.61%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGS------TGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GLDG  G +G  G  G +G PG +G  G  G DG +G  G  G  G  GE G++G  G  G  G  G +GD G+ G  G  G +G+       GA G  G  G PGQKG  G  G  G  G++G  G
Sbjct:  349 GLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADG 475          

HSP 19 Score: 52.7582 bits (125), Expect = 1.745e-6
Identity = 51/128 (39.84%), Postives = 62/128 (48.44%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPG---RDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G DG  G  G PG  G  G  G  G  G  G  G +GD+G+ G+ G  G+ G +GTPG     G  G  G +G  G PG +G  G +G+ GA G  G  G  G+KG  G  G KG  G  G  G  
Sbjct:  356 DKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDK 483          

HSP 20 Score: 52.7582 bits (125), Expect = 1.884e-6
Identity = 51/135 (37.78%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---ERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGD---------TGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DG  G +G  G  GLDG  G++G  G  G +G    +GD+G+ G  G  G  G  G  G  G  G+ G +GD          G  G +G  G +G+ G PG  GD G  G KG  G  G KG  G +G+ GP 
Sbjct:  334 GADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPK 468          

HSP 21 Score: 51.6026 bits (122), Expect = 4.976e-6
Identity = 57/152 (37.50%), Postives = 73/152 (48.03%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGL--DGFPGNQGVPGVSGRDGERG---------------------DQGKLGVPG------IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G+ G +G  G PG+   G PG QG PG  G+DG++G                     ++G+ G PG        GE G NG+PG  G  G  G  G+ G  G +G  G +G+ G PG  GD G  G KG  GN G KG TG++G  G
Sbjct:   90 DKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKG 241          

HSP 22 Score: 51.2174 bits (121), Expect = 6.426e-6
Identity = 45/108 (41.67%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G +G PG  G  GE+G++G  G PG     GE G +G PG  G  G  G +G  G PG +G  G +G+ GA   PG  GD G  G+KG  G  G KG  G  G  G  
Sbjct:  154 GEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDK 261          

HSP 23 Score: 50.8322 bits (120), Expect = 6.938e-6
Identity = 46/122 (37.70%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 2594 EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G+ G+PG  G  G +G  G +G  G +GD+G+ G  G P         G  G +GTPG  G  G  G +G  G PG +G  G +G  G+ G  GD G  G  G  G+ G KG  G +G  G
Sbjct:  153 KGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADG 274          
BLAST of Fibrillar collagen vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 82.8037 bits (203), Expect = 8.708e-16
Identity = 123/332 (37.05%), Postives = 150/332 (45.18%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---------------KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPG 1525
             G  G +GA G +G  G PG  G +G +G +G KG +G              G KG  G  GA G  G PG +GD G +G   P G  G +G PG  G  G  GADG  G  G PG  G  G                KG++G+ G KG +G DG PG  G     G+ GA G  G++G PGSKG +G  G  G  G+ GA G PG     G +G KGD G  G  G  G  G  G PG  G  G PG +GD G  G                             G+DG PG  G +G+PG +G +G +G  G PG+ G  G  G  GQPG
Sbjct:  237 KGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADG------------TPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKG---DKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPG---SKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEK-------------------------GQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPG 525          

HSP 2 Score: 82.0333 bits (201), Expect = 1.465e-15
Identity = 128/353 (36.26%), Postives = 160/353 (45.33%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGE------PGVGGRIGFPGADGITGVSGMPGVIGPTGT---------------KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G+ G  G  G +G  G PG  G +G +G +G  GP G++G  G  G  G  G KG  G  GA G  G PG +GD G +G  GS G +G+      PG  G  G  GADG  G  G PG  G  G                KG++G+ G KG +G DG PG  G     G+ GA G  G++G PGSKG +G  G +G  G  G  G  G     G+ G KGD G  G  G  G  G  G  G+ G  G PG++GD G                                G DG  G  GA+G PGS+G +G +G  G PG+ G  G  G  GQPG     G  G+ G +G  G+
Sbjct:  160 GQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKG---DKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKG---EKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDK------------------------------GLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ 476          

HSP 3 Score: 71.2478 bits (173), Expect = 3.479e-12
Identity = 105/263 (39.92%), Postives = 128/263 (48.67%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGK---DGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
              GP G +G DG +G PG KG  G           GK G  G  G +G  G  G+ G  G  G +G  G PG  G +G +G +G  GP G++G  G  G  G  G KG  G  GA G  G PG +GD G +G  GS G +G+ G  G  G  G  G  G  G  G  G  G+KGD+G  G KG +G  G  G  G+   DG  GD GA G  G+ G  G KG+ G  G  G  G+ G  G  G  G  G  G KGD G +GL+
Sbjct:  116 AQGPPGEKGKDGDKGAPGAKGSKGDD---------GKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD 369          

HSP 4 Score: 70.0922 bits (170), Expect = 8.446e-12
Identity = 104/290 (35.86%), Postives = 126/290 (43.45%), Query Frame = 2
Query:  761 ELGAAGPIGLPGI--RGDLGSQGPIGSHGPEGEPGVGGRIGFPGADG---------------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            + G  G  G PG+  +GD G+QGP G  G +G+ G       PGA G                 G  G PG  G  G KG++G  G  G +G  G  G DG  G  GD GA G  G++G PGSKG +G  G +G  GN G+ G  G  G  G  G KGD G  G  G  G  G  G  G+ G  G PG+                            G  G+ GA G DG PG  G  G+ G  GP+G +G  G PG  G  G  G  G  GA+  PG +G  G  G  G
Sbjct:   96 DKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGA------PGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGS---------------------------KGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKG 352          

HSP 5 Score: 68.1662 bits (165), Expect = 2.891e-11
Identity = 58/128 (45.31%), Postives = 69/128 (53.91%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPE---GSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG  G+ G +G  G  G DG PG +G  G  G DG +GD+G  G PG     GE G +G  G DG PG  G +GD G  GP+G  G +   GS G  G  GDIG+PGQKG  G  G  G  G +G  G
Sbjct:  336 DGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDG 463          

HSP 6 Score: 62.7734 bits (151), Expect = 1.381e-9
Identity = 54/129 (41.86%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQG---VPGVSGRDGERGDQGKLGVPGIP---GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DG  G +G  G  GLDG  G++G    PG  G  GE+G  G  G  G P   G+ G +G  G DG PG  G +G+ G  GP+G  G +G+ GA G  G+ G  G KG  G  G KG  G++G+ GP 
Sbjct:  289 GADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPK 417          

HSP 7 Score: 62.7734 bits (151), Expect = 1.625e-9
Identity = 50/112 (44.64%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---ERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 2896
            GLDG  G +G  G PG  G  G +G  G  G DG    +GD+G  G+ G  G+ G +GTPG     G  G +GD GQPG +G  G +G  G PG  G  G+PGQKG  G+ G
Sbjct:  367 GLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGS---KGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG 475          

HSP 8 Score: 60.4622 bits (145), Expect = 7.419e-9
Identity = 96/258 (37.21%), Postives = 117/258 (45.35%), Query Frame = 2
Query:  467 EGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLM-----GSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS---KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGV---KGDSGPQGLN 1207
            +G PG  G +G                             G  G  G  G +G TG PG+      G+QGP G  G  G  G  G KG  G  G KG KG  GE G  G  G  G +G+ G +G  GS G +G+ G  G  G PG  G  G  G  G  G  G+KGD+G  G KG +G  G+ G  G  G  G  GA G+ G+NG PGS   KG +G  G +G  G  G+ G  G DG  G  G    KGD G +GL+
Sbjct:   76 DGVPGTNGKDGTP---------------------------GDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD 306          

HSP 9 Score: 60.077 bits (144), Expect = 1.002e-8
Identity = 68/191 (35.60%), Postives = 84/191 (43.98%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKG--DRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL 1150
             G  G  GA G +G  G PG  G +G +G++GPKG  G                             G PG +GD G +G IG  G +G+ G  G+ G PG     G  G PG  G  G KG  ++G  G+ G +G DG PG  G  G  GD G PG+ G  G  G  G  G  G  G  G  G  G+PG 
Sbjct:  384 KGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKG---------------------------ADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPG---QKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 544          

HSP 10 Score: 58.151 bits (139), Expect = 3.686e-8
Identity = 48/123 (39.02%), Postives = 60/123 (48.78%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G+ G +G+ G+ G  G  G  G PG  G  GE+G  G  G  G PG  G  G  G  G  G  G +GD G+ G  GP G +G+ G PG  GD G+ G  G  G  G  G  G++G  G  
Sbjct:  229 GSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAK 351          

HSP 11 Score: 58.151 bits (139), Expect = 3.914e-8
Identity = 54/126 (42.86%), Postives = 63/126 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DGN GP+   G+ G DG  G  G PG  G  G  G +G  G PG  G+TG  G  G DG  G  G  G  G  G +G  G +G+ GA   PG  GD G  G KG  G  G KG  G +G+ GP 
Sbjct:  187 GADGNPGPK---GDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPK 309          

HSP 12 Score: 56.9954 bits (136), Expect = 8.756e-8
Identity = 44/98 (44.90%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGD--QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQK 2875
            G +G  G  G DG PG +G  G  G+ G++GD  QG+ G  G PG+ G +G PG+    G  G +GD GQPG +G  G +G  G PG  G  G+PGQK
Sbjct:  442 GQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQ---KGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQK 536          

HSP 13 Score: 56.9954 bits (136), Expect = 9.622e-8
Identity = 50/123 (40.65%), Postives = 64/123 (52.03%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  G +G  G+ G +G PG++G  G  G DG +G     G PG  G+ G +G  G DG PG  G +G+ G  GP+G  G +G+ GA G  G+ G  G KG  G  G KG  G  G  G
Sbjct:  233 DTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKG---ADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKG 352          

HSP 14 Score: 56.225 bits (134), Expect = 1.737e-7
Identity = 50/125 (40.00%), Postives = 60/125 (48.00%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G  G  G  G PG+ G  G  G  G PG  G  G  G +G  G PG  G+ G +G  G DG PG  G  GD G+ G  G  G +G+ G PG  GD G+ G  G  G  G  G  G++G  G  
Sbjct:  164 DKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAK 288          

HSP 15 Score: 51.6026 bits (122), Expect = 4.052e-6
Identity = 57/152 (37.50%), Postives = 73/152 (48.03%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGL--DGFPGNQGVPGVSGRDGERG---------------------DQGKLGVPG------IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G+ G +G  G PG+   G PG QG PG  G+DG++G                     ++G+ G PG        GE G NG+PG  G  G  G  G+ G  G +G  G +G+ G PG  GD G  G KG  GN G KG TG++G  G
Sbjct:   90 DKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKG 241          

HSP 16 Score: 51.2174 bits (121), Expect = 5.061e-6
Identity = 49/121 (40.50%), Postives = 61/121 (50.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGI 2926
            D G  G  G +G  G PG  G  G  G  G  G  G++GD+G+ G+ G  G+ G +GTPG  G  G  G  G  G  G  G  G +G+ GA G  G  G+ G KG+ G  GPKG  G  G 
Sbjct:  260 DKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGT 380          

HSP 17 Score: 51.2174 bits (121), Expect = 5.466e-6
Identity = 45/106 (42.45%), Postives = 55/106 (51.89%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +G PG  G  GE+G++G  G PG     GE G +G PG  G  G  G +G  G PG +G  G +G+ GA   PG  GD G  G+KG  G  G KG  G  G  G
Sbjct:  154 GEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKG 259          

HSP 18 Score: 51.2174 bits (121), Expect = 5.953e-6
Identity = 46/122 (37.70%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 2594 EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G+ G+PG  G  G +G  G +G  G +GD+G+ G  G P         G  G +GTPG  G  G  G +G  G PG +G  G +G  G+ G  GD G  G  G  G+ G KG  G +G  G
Sbjct:  153 KGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADG 274          
BLAST of Fibrillar collagen vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 80.4925 bits (197), Expect = 8.091e-15
Identity = 89/206 (43.20%), Postives = 109/206 (52.91%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  G +G  G  G  G+PG+ G QG  G NG  G  GE G  G  G PG  G  G  G  G  G +G PG  GD G+ G  G  G  G  G+ G  G+PG  G+ G  G PG  G  G  G  GI GKKG +G  G  G DG  G  G+ GAPG++G +G PG+ G QG  G  G  G  G +G PG DG++G  G++G+ G  GL
Sbjct:  510 GERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETG-FGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGL 714          

HSP 2 Score: 66.6254 bits (161), Expect = 1.406e-10
Identity = 56/121 (46.28%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  G  G PG  G DG PG  G+ G  G DG  G  G+ G PG  G  G  G PG  G  G+ G+RG  GQPG +G  G +G  G PG  G +G PG  G PG  G  G  GNQG  G
Sbjct:  853 GLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDG 973          

HSP 3 Score: 64.6994 bits (156), Expect = 6.162e-10
Identity = 61/133 (45.86%), Postives = 74/133 (55.64%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGS------TGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  G +G PG PGL      DGFPG+ G PG  G+ G  G++   G PGIPGE G+ G  G+DG+PG+ G  G  GQPG  G AG  G+       GAPG  GD G  G+ G+PG  G  G  G  G+ G
Sbjct:  862 GLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEK---GYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPG 991          

HSP 4 Score: 64.3142 bits (155), Expect = 6.537e-10
Identity = 63/148 (42.57%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKG--SQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  GP G PG  G  G++G  G  G +G  G  G  G PG  G+ G+ G+PG+      KG+ GI G  G +G  G PG+ G  G  G  G PG  G +G PG  G  SQG  G +G  G +G  G PG  G  G++G KGD GP GL
Sbjct:   64 GQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGL------KGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGL 205          

HSP 5 Score: 63.5438 bits (153), Expect = 1.362e-9
Identity = 89/222 (40.09%), Postives = 106/222 (47.75%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG---------SHGPEGEPGVGGRIGFPGADGITGVSGM-PGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPG--SKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGD--SGPQGLN 1207
            +G +G  G  G  GP G PG++G  GP G  G KG  G+ G  G               + G  G  G+PG  G+ GSQG  G         + G  GEPG  GR GF G  G  G  G   G  GP G +G  G+QG KG  G DG PG  G  G VG PGAPG+ G +G+PG   KG +G  G  G  G  G  G PG  G  G  G+ G    GP GL+
Sbjct:  260 VGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAG---------------QRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLD 466          

HSP 6 Score: 63.5438 bits (153), Expect = 1.362e-9
Identity = 52/116 (44.83%), Postives = 66/116 (56.90%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQ------GVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGN 2890
            GL+G  G +G PG+PG  G+PG Q      G PG+ G +G  G +G+ G PG+ GE G++G PG  G  G  G  GD G PG     G  G +G  G PGL G+ G+PGQ G PG 
Sbjct:  877 GLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGR 992          

HSP 7 Score: 62.3882 bits (150), Expect = 2.677e-9
Identity = 60/136 (44.12%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  785 GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            G PG RG+ G  G  G  G +G PG  G+ G PG  G  G  G  G+ G  G  GD+G  G  G +G  G  GI G+DG VG PG  GEHG NG+PG +G  G  G +G+ G  G  G  G DG+ G+ G  G  G
Sbjct:  620 GQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPG 755          

HSP 8 Score: 62.003 bits (149), Expect = 3.278e-9
Identity = 59/134 (44.03%), Postives = 73/134 (54.48%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGE---TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI--------GKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DGL G  G  G  G PGL+G  G  G PG  G  G  G  G+ G+PG+PG+   +G NG PG  G+PG+ G RGD G PG  G  G  G  G  GL G +        G+PG+ G PG  G  GL G+ G++GP
Sbjct: 1082 DGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGP 1215          

HSP 9 Score: 61.2326 bits (147), Expect = 6.660e-9
Identity = 54/118 (45.76%), Postives = 63/118 (53.39%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGP---EGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G PG DG+PG  G+PG  G  GE G  G+ G PG P   GE+G+ G  G+ GR G  G RG  G PG  G AG     G  G PG  GD G PG  G+ G  GP G+ G  G+ G
Sbjct:  584 GAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVG 701          

HSP 10 Score: 60.4622 bits (145), Expect = 1.182e-8
Identity = 66/157 (42.04%), Postives = 75/157 (47.77%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGG---RIGFPGADGITGVSGMPG-----------VIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGP 1195
            G  G  GLPG+ G  G  G  G  G  G+PG+ G     GFPG DG+ G+ G PG           V  P G  G+ G  G+KG  G+ G  G+ G  G  G PGAPG  G  G PG  G  G  G QG  G AG TG PGL G  G  G  G   P
Sbjct: 1119 GYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAP 1275          

HSP 11 Score: 58.9214 bits (141), Expect = 2.967e-8
Identity = 53/110 (48.18%), Postives = 62/110 (56.36%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 2896
            DGL G VGP G  G PG  G PG  G+PG +    E+GD+G+ G PG  GE G+ G PG  G PG  G+ G   Q GP G  G  G  G PG+ GDIG PG  G+ G  G
Sbjct:  390 DGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT----EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQ-GPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPG 494          

HSP 12 Score: 58.5362 bits (140), Expect = 4.265e-8
Identity = 54/128 (42.19%), Postives = 69/128 (53.91%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQ-----PGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  G  G PG+PG  G  G  G+PG+ G +G  G  G  G PG+PG  G  G  G++G PG  G+ G  G+      G +G  G  G +G PGL G+ G PG KG  G+ GP GL G  G++G
Sbjct:   86 DMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSG 213          

HSP 13 Score: 57.7658 bits (138), Expect = 6.900e-8
Identity = 55/134 (41.04%), Postives = 68/134 (50.75%), Query Frame = 2
Query:  782 IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
             G+PG++G+ G  G  G  G +G PG  G  G  G DG  G  G PG  G  G +G++G  G  G  G+      DG PG+ G++G  G PG PG  G  G PG  G  G  G  G  GN G  G+PGL G  G
Sbjct:  849 TGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESG 982          

HSP 14 Score: 57.7658 bits (138), Expect = 7.017e-8
Identity = 53/127 (41.73%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKL------------GVPGIPGET---GMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG  G DG+PG  G+PG  G +GE G  G+             G+PG PGE    G++G  G DG PG  G+ G  G PG  G  G +G  GAPG  G  G PG++G PG  G +G +G+ G  G
Sbjct: 1017 GPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPG 1143          

HSP 15 Score: 57.7658 bits (138), Expect = 7.444e-8
Identity = 60/139 (43.17%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  830 GSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG------TGPQGIIGNAGATGRPGLDG--------MIGIQGVKGDSGPQGL 1204
            G+ G  G PG GG  G PGA G  G  G PG  G  G +GD G  G KG  G  G PG  G  G  G  G PG  G  GIPG  G+ G        GP G  G  G  GRPGL G          G +GVKG+SG  G+
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGV 181          

HSP 16 Score: 57.7658 bits (138), Expect = 7.831e-8
Identity = 55/137 (40.15%), Postives = 65/137 (47.45%), Query Frame = 2
Query: 2582 NVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM--------------------NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
             VGP+G PG PG  G  G  G PG+ G  G RG QG++G  GI G+ G                      G PG+ G PG  G  G  G PGP G  G +G  G PG  G+ G  GQ G PG  G +G +G  GI G
Sbjct:  499 KVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDG 635          

HSP 17 Score: 57.3806 bits (137), Expect = 9.039e-8
Identity = 105/271 (38.75%), Postives = 129/271 (47.60%), Query Frame = 2
Query:  431 AGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPG---IRGDLGSQGPIGSHGPEGEPGVGGRIGFP-----GADGITGVSGMPGVIGPTGTKGDRGIQGKKG--GEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG----TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             GP G+ G DGP G PG KG  G  G  G+ GK GK G  G  G +G  G  G  G  G  G +G  G+PG  G  G +G  GP+GP GE   +       G          G  G  GLPG   + G +G +GP+G+ G  G+PG+ G  G+      G DG  G +G PG+    G  GD G  G+ G  G  + G PG+DG+ G  G PG PG+ G  G  G KG  G      GP G  G  G  G  GL G  G+ G  G  G QG
Sbjct:  275 VGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFD--------GVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGL---PGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQG 534          

HSP 18 Score: 55.8398 bits (133), Expect = 2.800e-7
Identity = 57/136 (41.91%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  818 QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG------IPGSKGSQGGTGPQGIIGN-AGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            QGP+G  G +GE G  G +G PG  G+ G  G PG+ G  G  GD G +GK+G +GV G  G  G  G  G  G PG  G+ G       PG  G +G  GP+G +G   G  G  G  G  G+QG KG  G  GL
Sbjct:  257 QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGL 392          

HSP 19 Score: 55.8398 bits (133), Expect = 2.897e-7
Identity = 55/137 (40.15%), Postives = 65/137 (47.45%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLD---------------GFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DGL G  G  G+PG+PG                 G+PG +G+PG+ G+ G  G  G  GVPG+ G  G+ G  G DG PG  G  G  G PG RG  G  G  G  G  G  G PGQ G  G  G  G  G  G+ G
Sbjct: 1031 DGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDG 1167          

HSP 20 Score: 55.0694 bits (131), Expect = 5.185e-7
Identity = 59/142 (41.55%), Postives = 69/142 (48.59%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQP------------GPRGP-------AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G DG VGP G  G  G  G+PG +G  G  G  G+RG +GK GVPG  GE G  G  G  G PG  G +G  G+P            GP GP       AGP G+ G  G+ G  G PG  G PG  GP+G  G  G  G
Sbjct:  268 EKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPG 409          

HSP 21 Score: 54.6842 bits (130), Expect = 6.190e-7
Identity = 73/205 (35.61%), Postives = 94/205 (45.85%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG-----GEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQ--GVK 1180
            G  G  G  GP+G  G PG+ G++G  G  G KG  G++                           GLPG  G  G Q      G +G PG+ G  G PG +G  G  GMPG+ GP G  G  G  G+ G     GEG   + G  G  G  G  G PG  G++G PG KG++G  GP G+ G  G +   GL G +G++  GVK
Sbjct:   58 GHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDR---------------------------GLPGSPGHPGLQ------GLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVS---GLKGRMGVRTSGVK 226          

HSP 22 Score: 54.299 bits (129), Expect = 9.439e-7
Identity = 50/121 (41.32%), Postives = 60/121 (49.59%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVP------GVSGRDGERGD---------------QGKLGVPGIPGETGMN---GTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI 2857
            DG  G  G +G PG+PG DG+PG  G+P      G  G  GE GD               +G  GVPG PGE G +   G PG DG+PG  G  G+ G PG RG  G  G+   PG  GD+
Sbjct:  667 DGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDV 787          

HSP 23 Score: 53.9138 bits (128), Expect = 9.846e-7
Identity = 50/120 (41.67%), Postives = 65/120 (54.17%), Query Frame = 2
Query:  854 PGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGD---PGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            PG  G  G PG DG  G  G+PG  G  G +G  G++G  G +G  GAPG  G +G  G+   PG PG+ G +G  G  G+ G  G +G  G+ G  GR GLDG+ G  G +G  GP  +
Sbjct: 1064 PGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAM 1183          

HSP 24 Score: 53.5286 bits (127), Expect = 1.620e-6
Identity = 64/172 (37.21%), Postives = 78/172 (45.35%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDG-----------------------SVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  G  G+PG+ GD G  G     G+ G  G PG  G  G PG  G +G +G PG  G  G KG RG  G  G +G+DG PG  G++G                         G PG PG++G +G PG  G  G  G  G  G  G +G PG  G  G QG  G +G  GL
Sbjct: 1089 GVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGL 1260          

HSP 25 Score: 53.1434 bits (126), Expect = 1.777e-6
Identity = 55/129 (42.64%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQG--KLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G+ G  G PG PG+      DGFPG  G+ G+ GR G  G  G   + V   PG+ G NG PG  G PG+ G  G +G PG  G  G  G+ G PG  G  G PG  G  G  G  G TGN G+ G
Sbjct: 1134 GRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPG 1262          

HSP 26 Score: 53.1434 bits (126), Expect = 1.886e-6
Identity = 63/168 (37.50%), Postives = 76/168 (45.24%), Query Frame = 2
Query:  764 LGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIG--------------------PTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            +   GP G PG  G+ G  G  G  G  GEPG+ G+ G  G +GI G  G PG+ G                      G  G  G  G  G  G DG PG DG  G+ G PG  G +G +G PG  GS+G +G  GI G  G  G PG  G  G  G  G++G  G N
Sbjct:  497 VNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQN 664          

HSP 27 Score: 52.373 bits (124), Expect = 3.236e-6
Identity = 63/147 (42.86%), Postives = 79/147 (53.74%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G AG  G PG+ G  G+ G  G  G  G+ G+ G  G PG  G+ G  G  G+ G  G +G  G+ G  G  GV+G PG++G  G  G PGAPG  GSNG PG +G  G  G QG  G+ G  G PG  G+ G +G  G  G  GL+
Sbjct: 1020 GQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLD 1166          

HSP 28 Score: 52.373 bits (124), Expect = 3.550e-6
Identity = 54/135 (40.00%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP--------------------------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 2896
            G +G  G  G+ G PGL G  G  G PG  G  G+ G  G +G PG PGE G NG  GRDG+PG+ G  G  GQPG                            GP G  G  G PGL G  G PG  G+PG+ G
Sbjct:  913 GENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPG 1047          

HSP 29 Score: 51.9878 bits (123), Expect = 4.459e-6
Identity = 49/112 (43.75%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            GN G  G+PG+PG  G  G +G PG  G  G  GD G +G  G  G+ G+ G+P   G PG+ G+ G  G  G  G  G  G+ G PG+ G  G PGQ G+ GN G  GL+G
Sbjct:   49 GNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSP---GHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSG 157          

HSP 30 Score: 51.9878 bits (123), Expect = 4.496e-6
Identity = 86/211 (40.76%), Postives = 110/211 (52.13%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ------GKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGII---GNAGATGRPGLDGMIGIQGVKGDSG 1192
            G  G  G  G  G  G+PG  G  G  G++G KG +G  G +G  G PG  G  G  G+ G  G  G PG +G  GS G  G  GP G PG  G +GFPG  G  G +G+PG+ G  G +G RG+       G+ G +G+ G PG DG+ G VG+ G PG  G  G PG  G+    G  G +   G  G  G PG DG+ G+ G +GD+G
Sbjct:  605 GYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG 815          

HSP 31 Score: 51.9878 bits (123), Expect = 4.612e-6
Identity = 52/128 (40.62%), Postives = 65/128 (50.78%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPG--NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG----PKGLTGNQGIT 2929
            DDG  G  G +G PG PG +G PG     V    G+ GE G  G+ G PG+PG+ G++G PG+ G PG  G     G PGP G +G  G  G  G  G  G+ G  G PG  G    P G   ++G T
Sbjct: 1156 DDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGT---DGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGFT 1280          

HSP 32 Score: 50.8322 bits (120), Expect = 9.211e-6
Identity = 99/285 (34.74%), Postives = 120/285 (42.11%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG----GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDG---APGIDGKD-----------------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGI------IGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGAN 1531
            G +G  G PGI GD+G  G     G +G PG G    G  G+PG  G  G+ G+PG  G  G  G RG QG+ G  G+DG    PG+DG                   G VG PG  G+ G+ G+PG  G  G  G  G        G  G  G PG  G  G  G+ G  G +G +G  G  G  G PG  G  G PG                                     +G DG PG  G  G PGS G  G  G +G+PG+DG+VG  GL G+ G N
Sbjct:  467 GQSGRDGFPGIPGDIGDPG---YSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQ------------------------------------NGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDN 712          
BLAST of Fibrillar collagen vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 80.1073 bits (196), Expect = 1.287e-14
Identity = 89/206 (43.20%), Postives = 109/206 (52.91%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  G +G  G  G  G+PG+ G QG  G NG  G  GE G  G  G PG  G  G  G  G  G +G PG  GD G+ G  G  G  G  G+ G  G+PG  G+ G  G PG  G  G  G  GI GKKG +G  G  G DG  G  G+ GAPG++G +G PG+ G QG  G  G  G  G +G PG DG++G  G++G+ G  GL
Sbjct:  767 GERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETG-FGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGL 971          

HSP 2 Score: 66.2402 bits (160), Expect = 1.855e-10
Identity = 56/121 (46.28%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  G  G PG  G DG PG  G+ G  G DG  G  G+ G PG  G  G  G PG  G  G+ G+RG  GQPG +G  G +G  G PG  G +G PG  G PG  G  G  GNQG  G
Sbjct: 1110 GLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDG 1230          

HSP 3 Score: 64.3142 bits (155), Expect = 7.585e-10
Identity = 63/148 (42.57%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKG--SQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  GP G PG  G  G++G  G  G +G  G  G  G PG  G+ G+ G+PG+      KG+ GI G  G +G  G PG+ G  G  G  G PG  G +G PG  G  SQG  G +G  G +G  G PG  G  G++G KGD GP GL
Sbjct:   64 GQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGL------KGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGL 205          

HSP 4 Score: 64.3142 bits (155), Expect = 8.322e-10
Identity = 61/133 (45.86%), Postives = 74/133 (55.64%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGS------TGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  G +G PG PGL      DGFPG+ G PG  G+ G  G++   G PGIPGE G+ G  G+DG+PG+ G  G  GQPG  G AG  G+       GAPG  GD G  G+ G+PG  G  G  G  G+ G
Sbjct: 1119 GLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEK---GYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPG 1248          

HSP 5 Score: 63.1586 bits (152), Expect = 1.870e-9
Identity = 52/116 (44.83%), Postives = 66/116 (56.90%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQ------GVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGN 2890
            GL+G  G +G PG+PG  G+PG Q      G PG+ G +G  G +G+ G PG+ GE G++G PG  G  G  G  GD G PG     G  G +G  G PGL G+ G+PGQ G PG 
Sbjct: 1134 GLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGR 1249          

HSP 6 Score: 62.003 bits (149), Expect = 3.403e-9
Identity = 60/136 (44.12%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  785 GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            G PG RG+ G  G  G  G +G PG  G+ G PG  G  G  G  G+ G  G  GD+G  G  G +G  G  GI G+DG VG PG  GEHG NG+PG +G  G  G +G+ G  G  G  G DG+ G+ G  G  G
Sbjct:  877 GQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPG 1012          

HSP 7 Score: 62.003 bits (149), Expect = 3.610e-9
Identity = 59/134 (44.03%), Postives = 73/134 (54.48%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGE---TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI--------GKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DGL G  G  G  G PGL+G  G  G PG  G  G  G  G+ G+PG+PG+   +G NG PG  G+PG+ G RGD G PG  G  G  G  G  GL G +        G+PG+ G PG  G  GL G+ G++GP
Sbjct: 1339 DGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGP 1472          

HSP 8 Score: 60.8474 bits (146), Expect = 8.390e-9
Identity = 54/118 (45.76%), Postives = 63/118 (53.39%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGST---GAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G PG DG+PG  G+PG  G  GE G  G+ G PG P   GE+G+ G  G+ GR G  G RG  G PG  G AG  G     G PG  GD G PG  G+ G  GP G+ G  G+ G
Sbjct:  841 GAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVG 958          

HSP 9 Score: 60.4622 bits (145), Expect = 1.137e-8
Identity = 59/123 (47.97%), Postives = 69/123 (56.10%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP---GQKGKPGN----TGPKGLTG 2914
            DGL G VGP G  G PG  G PG  G+PG +    E+GD+G+ G PG  GE G+ G PG  G PG  G+ G   Q GP G  G  G  G PG+ GDIG P   G+KG PG      GP G+TG
Sbjct:  390 DGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT----EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQ-GPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTG 507          

HSP 10 Score: 60.4622 bits (145), Expect = 1.196e-8
Identity = 66/158 (41.77%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGG---RIGFPGADGITGVSGMPG-----------VIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQ 1198
            G  G  GLPG+ G  G  G  G  G  G+PG+ G     GFPG DG+ G+ G PG           V  P G  G+ G  G+KG  G+ G  G+ G  G  G PGAPG  G  G PG  G  G  G QG  G AG TG PGL G  G  G  G   P 
Sbjct: 1376 GYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPS 1533          

HSP 11 Score: 60.077 bits (144), Expect = 1.675e-8
Identity = 61/153 (39.87%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG-----GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGE-GVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G  GL GI G  G QG +G  G +G PG       G  G+ G  G  G+ G+PG  GP G      I  +  G+ GVDG PG+ G  G+ G PG PG  G +G PG+ G +G  G  G  G  G  G  G  G +G  G+ GD G  GL+
Sbjct:  656 GLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLD 808          

HSP 12 Score: 58.151 bits (139), Expect = 5.056e-8
Identity = 54/128 (42.19%), Postives = 69/128 (53.91%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQ-----PGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  G  G PG+PG  G  G  G+PG+ G +G  G  G  G PG+PG  G  G  G++G PG  G+ G  G+      G +G  G  G +G PGL G+ G PG KG  G+ GP GL G  G++G
Sbjct:   86 DMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSG 213          

HSP 13 Score: 57.7658 bits (138), Expect = 7.971e-8
Identity = 53/127 (41.73%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKL------------GVPGIPGET---GMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG  G DG+PG  G+PG  G +GE G  G+             G+PG PGE    G++G  G DG PG  G+ G  G PG  G  G +G  GAPG  G  G PG++G PG  G +G +G+ G  G
Sbjct: 1274 GPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPG 1400          

HSP 14 Score: 57.3806 bits (137), Expect = 8.600e-8
Identity = 55/134 (41.04%), Postives = 68/134 (50.75%), Query Frame = 2
Query:  782 IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
             G+PG++G+ G  G  G  G +G PG  G  G  G DG  G  G PG  G  G +G++G  G  G  G+      DG PG+ G++G  G PG PG  G  G PG  G  G  G  G  GN G  G+PGL G  G
Sbjct: 1106 TGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESG 1239          

HSP 15 Score: 57.3806 bits (137), Expect = 9.515e-8
Identity = 61/142 (42.96%), Postives = 70/142 (49.30%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---------------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G VGP+G PG PG  G  G  G PG+ G  G RG QG++G  GI                     PGETG  G PG+ G PG  G  G  G PGP G  G +G  G PG  G+ G  GQ G PG  G +G +G  GI G
Sbjct:  752 GLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF-GFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDG 892          

HSP 16 Score: 57.3806 bits (137), Expect = 9.677e-8
Identity = 60/139 (43.17%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  830 GSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG------TGPQGIIGNAGATGRPGLDG--------MIGIQGVKGDSGPQGL 1204
            G+ G  G PG GG  G PGA G  G  G PG  G  G +GD G  G KG  G  G PG  G  G  G  G PG  G  GIPG  G+ G        GP G  G  G  GRPGL G          G +GVKG+SG  G+
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGV 181          

HSP 17 Score: 56.225 bits (134), Expect = 2.192e-7
Identity = 57/136 (41.91%), Postives = 73/136 (53.68%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPG------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI-GKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            GL G+ G  G PG PG             +GFPG QG PG++G DG+RG QG LG+PG+ G  G +  PG+ G PG  G RG  G PG  G  GP G      ++  + G+PG  G PG  G +G  G  G+ GP+
Sbjct:  623 GLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPG-DSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPV 757          

HSP 18 Score: 55.4546 bits (132), Expect = 3.370e-7
Identity = 58/139 (41.73%), Postives = 71/139 (51.08%), Query Frame = 2
Query:  818 QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGD---------PGAPGEHGSNGIPGSKGSQGGTGPQGIIGN-AGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            QGP+G  G +GE G  G +G PG  G+ G  G PG+    G KGD G  G++G  G DG PG  G+ GS G+         PG  G  G  G PG  G +G  GP+G +G   G  G  G  G  G+QG KG  G  GL
Sbjct:  257 QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGL---KGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGL 392          

HSP 19 Score: 55.4546 bits (132), Expect = 3.399e-7
Identity = 56/137 (40.88%), Postives = 67/137 (48.91%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLD---------------GFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DGL G  G  G+PG+PG                 G+PG +G+PG+ G+ G  G  G  GVPG+ G  G+ G  G DG PG  G  G  G PG RG  G  G  G     GD G PG  G+PG  GP+G  G  G  G
Sbjct: 1288 DGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGR---SGDNGYPGAPGQPGIKGPRGDDGFPGRDG 1421          

HSP 20 Score: 54.6842 bits (130), Expect = 6.081e-7
Identity = 59/142 (41.55%), Postives = 69/142 (48.59%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQP------------GPRGP-------AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G DG VGP G  G  G  G+PG +G  G  G  G+RG +GK GVPG  GE G  G  G  G PG  G +G  G+P            GP GP       AGP G+ G  G+ G  G PG  G PG  GP+G  G  G  G
Sbjct:  268 EKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPG 409          

HSP 21 Score: 54.6842 bits (130), Expect = 7.137e-7
Identity = 69/199 (34.67%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            G  G  G  GP+G  G PG+ G++G  G  G KG  G++                           GLPG  G  G Q      G +G PG+ G  G PG +G  G  GMPG+ GP G  G  G  G+ G  G  G  G++    S G  G  GE G +G+PG  G+ G  G +G  G+ G  G PG  G+ G++G  G
Sbjct:   58 GHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDR---------------------------GLPGSPGHPGLQ------GLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVN----SQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMG 219          

HSP 22 Score: 54.299 bits (129), Expect = 9.191e-7
Identity = 95/275 (34.55%), Postives = 114/275 (41.45%), Query Frame = 2
Query:  398 GPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGI--------DGKDGSVGDPGAPGEHGSNGIPGSKGSQGG--TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GPA + G +   GP G  G  G +G PG  G  G                          G +G +G+ G  G  G  G  G  GSQG QG+ G  G  G +G                    G  G  G PG  GD G +GP+G     GE G  G  GF G  G  G+ G  G+ GP G +G  G  G  G  G+DG PG         DG  G  G+PG PGE G  G PG  G  G    GP G+ G +G  G PG+ G IG  G  G+ G
Sbjct:  261 GPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQK------------------------GDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGA------------------GEPGYPGRPGFEGDCGPEGPLGEG--TGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKG 491          

HSP 23 Score: 53.9138 bits (128), Expect = 9.832e-7
Identity = 50/120 (41.67%), Postives = 65/120 (54.17%), Query Frame = 2
Query:  854 PGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGD---PGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            PG  G  G PG DG  G  G+PG  G  G +G  G++G  G +G  GAPG  G +G  G+   PG PG+ G +G  G  G+ G  G +G  G+ G  GR GLDG+ G  G +G  GP  +
Sbjct: 1321 PGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAM 1440          

HSP 24 Score: 53.9138 bits (128), Expect = 1.245e-6
Identity = 50/121 (41.32%), Postives = 60/121 (49.59%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVP------GVSGRDGERGD---------------QGKLGVPGIPGETGMN---GTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI 2857
            DG  G  G +G PG+PG DG+PG  G+P      G  G  GE GD               +G  GVPG PGE G +   G PG DG+PG  G  G+ G PG RG  G  G+   PG  GD+
Sbjct:  924 DGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDV 1044          

HSP 25 Score: 53.1434 bits (126), Expect = 1.819e-6
Identity = 64/172 (37.21%), Postives = 78/172 (45.35%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDG-----------------------SVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  G  G+PG+ GD G  G     G+ G  G PG  G  G PG  G +G +G PG  G  G KG RG  G  G +G+DG PG  G++G                         G PG PG++G +G PG  G  G  G  G  G  G +G PG  G  G QG  G +G  GL
Sbjct: 1346 GVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGL 1517          

HSP 26 Score: 53.1434 bits (126), Expect = 1.850e-6
Identity = 64/167 (38.32%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIG--------------------PTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  GP G PG  G+ G  G  G  G  GEPG+ G+ G  G +GI G  G PG+ G                      G  G  G  G  G  G DG PG DG  G+ G PG  G +G +G PG  GS+G +G  GI G  G  G PG  G  G  G  G++G  G N
Sbjct:  755 GPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQN 921          

HSP 27 Score: 53.1434 bits (126), Expect = 1.946e-6
Identity = 55/129 (42.64%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQG--KLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G+ G  G PG PG+      DGFPG  G+ G+ GR G  G  G   + V   PG+ G NG PG  G PG+ G  G +G PG  G  G  G+ G PG  G  G PG  G  G  G  G TGN G+ G
Sbjct: 1391 GRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPG 1519          

HSP 28 Score: 52.7582 bits (125), Expect = 2.549e-6
Identity = 113/332 (34.04%), Postives = 134/332 (40.36%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGA-----------------PGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGAN 1531
            G+ G  G  G +G  G PGL G+QGP+G+  P                  +      G+ G  G  GLPG RG  G  G  G  GP+G PG  G  G  G  G  G+ G PG+ G  G  G  GI G  G  G+DG                  PG  G  G  GD GA G  G +G PG  G  G  G  G  G  G  G PG  G  G  G+ G  G +G +G  G  G  G PG  G  G PG                                     +G DG PG  G  G PGS G  G  G +G+PG+DG+VG  GL G+ G N
Sbjct:  691 GQPGTPGYKGERGADGLPGLPGAQGPRGIPAPL-----------------RIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQ------------------------------------NGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDN 969          

HSP 29 Score: 52.373 bits (124), Expect = 3.395e-6
Identity = 46/105 (43.81%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  893 GITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G  G+PG+    G +G  G+ G  G  GV+G PG++G  G  G PGAPG  GSNG PG +G  G  G QG  G+ G  G PG  G+ G +G  G  G  GL+
Sbjct: 1322 GYPGERGLPGL---DGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLD 1423          

HSP 30 Score: 51.9878 bits (123), Expect = 4.560e-6
Identity = 54/135 (40.00%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP--------------------------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 2896
            G +G  G  G+ G PGL G  G  G PG  G  G+ G  G +G PG PGE G NG  GRDG+PG+ G  G  GQPG                            GP G  G  G PGL G  G PG  G+PG+ G
Sbjct: 1170 GENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPG 1304          

HSP 31 Score: 51.6026 bits (122), Expect = 5.219e-6
Identity = 49/112 (43.75%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            GN G  G+PG+PG  G  G +G PG  G  G  GD G +G  G  G+ G+ G+P   G PG+ G+ G  G  G  G  G  G+ G PG+ G  G PGQ G+ GN G  GL+G
Sbjct:   49 GNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSP---GHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSG 157          

HSP 32 Score: 51.6026 bits (122), Expect = 5.398e-6
Identity = 52/128 (40.62%), Postives = 65/128 (50.78%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPG--NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG----PKGLTGNQGIT 2929
            DDG  G  G +G PG PG +G PG     V    G+ GE G  G+ G PG+PG+ G++G PG+ G PG  G     G PGP G +G  G  G  G  G  G+ G  G PG  G    P G   ++G T
Sbjct: 1413 DDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGT---DGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGFT 1537          

HSP 33 Score: 51.6026 bits (122), Expect = 6.125e-6
Identity = 86/211 (40.76%), Postives = 110/211 (52.13%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ------GKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGII---GNAGATGRPGLDGMIGIQGVKGDSG 1192
            G  G  G  G  G  G+PG  G  G  G++G KG +G  G +G  G PG  G  G  G+ G  G  G PG +G  GS G  G  GP G PG  G +GFPG  G  G +G+PG+ G  G +G RG+       G+ G +G+ G PG DG+ G VG+ G PG  G  G PG  G+    G  G +   G  G  G PG DG+ G+ G +GD+G
Sbjct:  862 GYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG 1072          
BLAST of Fibrillar collagen vs. Ensembl Celegans
Match: col-164 (COLlagen [Source:UniProtKB/TrEMBL;Acc:Q22651])

HSP 1 Score: 75.8702 bits (185), Expect = 6.888e-14
Identity = 79/187 (42.25%), Postives = 90/187 (48.13%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
            G  G  G+PG  G+ G  G +G  G N EQ                   +L  A P G PG+ G  G +GP G  G +G PG  GR G PG DG  G  G PG +GP G KG  G  GK   +G  G  G  G DG  GD G PGE G +   GS G+QG TGPQG  G  G  G PGL G  G  G
Sbjct:  110 GESGSAGEPGTDGTDGTPGKDGADGSN-EQTASQAG-------------DLCTACPAGPPGVAGYKGKRGPRGEKGDKGAPGNAGRDGAPGDDGPEGDHGHPGPMGPAGEKGTSGADGKGFAKGAPGPKGPTGMDGLAGDEGLPGERGED---GSAGAQGETGPQGPQGEKGPDGFPGLPGSAGASG 279          

HSP 2 Score: 55.8398 bits (133), Expect = 1.536e-7
Identity = 59/155 (38.06%), Postives = 70/155 (45.16%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGV----------------------PGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAG------------------PEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            G  G  G+PG  G DG PG  G                       PGV+G  G+RG +G+ G  G PG  G      RDG PG  G  GD G PGP GPAG                  P+G TG  GL GD G PG++G+ G+ G +G TG QG
Sbjct:  110 GESGSAGEPGTDGTDGTPGKDGADGSNEQTASQAGDLCTACPAGPPGVAGYKGKRGPRGEKGDKGAPGNAG------RDGAPGDDGPEGDHGHPGPMGPAGEKGTSGADGKGFAKGAPGPKGPTGMDGLAGDEGLPGERGEDGSAGAQGETGPQG 258          

HSP 3 Score: 55.4546 bits (132), Expect = 1.828e-7
Identity = 68/170 (40.00%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGV----------------SGMPGVIGPTGTKGDRGIQGKKGG---EGVDGAPGIDGKDGSVGDPGA---PGEHGSNGIPG---SKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             A  P   P    D    GP G  G  GEPG  G  G PG DG  G                 +G PGV G  G +G RG +G KG     G DGAPG DG +G  G PG     GE G++G  G   +KG+ G  GP G+ G AG  G PG  G  G  G +G++GPQG
Sbjct:   89 AATAPEASPVKIDDSCPAGPKGESGSAGEPGTDGTDGTPGKDGADGSNEQTASQAGDLCTACPAGPPGVAGYKGKRGPRGEKGDKGAPGNAGRDGAPGDDGPEGDHGHPGPMGPAGEKGTSGADGKGFAKGAPGPKGPTGMDGLAGDEGLPGERGEDGSAGAQGETGPQG 258          
BLAST of Fibrillar collagen vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 79.7221 bits (195), Expect = 2.218e-14
Identity = 95/221 (42.99%), Postives = 118/221 (53.39%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIR--GDLGSQGPIGSHGPEGEPGVGGRIGFPGADG------------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G  G  G  GP G PG+   +GP+G+NGP+G  G QG  G  G PG  G +G  G  G  GP G PGI   G +G  G  G  G +G+ G  G IGFPGADG            + GVSG PG++G  G  G  G  G  G  GV G  G+ G+DG+ G+PG+PG  G  G  G +G+ G  GP+G  G  GA G+ G  G+ G+ G KGD G  GL 
Sbjct:  783 GERGYTGLKGNTGPQGPPGV---EGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLT 1000          

HSP 2 Score: 69.707 bits (169), Expect = 2.523e-11
Identity = 96/241 (39.83%), Postives = 121/241 (50.21%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTG---KPGL----------MGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS--------------------HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            +G  G  GA GP+G  G   +PGL           GSQG +G  G KG  GE+G  G AG  G KG +G  G  GA+G  G+PG +GD+G +G IG                      G  G PG+ G  G PG  G  G+ G+PG IGP G+KG+RG+ G         +PG  G+DG    PGAPG  G  G  G KG +G  G +G  G+ G  G  G  G+ G+ G KGD+G  GLN
Sbjct: 1194 VGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAG---------SPGQPGQDGF---PGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN 1422          

HSP 3 Score: 65.4698 bits (158), Expect = 4.185e-10
Identity = 139/364 (38.19%), Postives = 164/364 (45.05%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGP---------------TGTKGDRGIQGKKGGEGVDGAP------GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL--DGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGAN---------GKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRG 1570
            +G  G  G  G  G +G+PG++G +G  G   P GP G  GP G  G  G +G  G  GE G+ G +G+PG +GD G+    GP G  G  G PG  G  G PG  G  G  G  G+ G                 G KGD+G+ G  G +G+DG P      G  G DG  G PG   E G  G PG  G +G TGP G  G  G  G PGL   G  G  G KGD G  G++GR GI G  G  G  G  G PG                                GS GA G  G PG+DG           G PG RG +G  GL+GLPG  G  GP GL G  GA   PGP+G+ G RG
Sbjct:  886 VGYPGDRGDAGLPGVSGRPGIVGEKGDVG---PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGE------------------------------KGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGA---PGPKGERGIRG 1213          

HSP 4 Score: 65.0846 bits (157), Expect = 5.123e-10
Identity = 58/137 (42.34%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR-----------------PGVAGMRGDTGQPGPRGPA---GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            +DG  G  G  G  GN G  G PG +G  G++G  GE+G+QG +GVPG PG+ G+ G PGR+G+                 PG+ G++G+ G  GP GP    G +GS G PG  GD G PG  G+PG  G KG  G
Sbjct:  778 EDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG 914          

HSP 5 Score: 64.6994 bits (156), Expect = 6.543e-10
Identity = 116/283 (40.99%), Postives = 137/283 (48.41%), Query Frame = 2
Query:  401 PAPL--TGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGS------QGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGF-------PGADGITGVSGMPGV---IGPTGT-KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            P PL  TG +   G  G++GP G +G+ G  GP G  G +G+ G  G  G  G  G QGP G  G  G NG  G  G  G PGL G       +G  G  G KG  GE   +      G KG  G  G  G AGP G PG +G+ G  GP G+ GP GE G+ G  G        PGA GI G  G P     + PT T  G RG  G+KG  G+ G  G  G +G  G  G  GE G  G PG +G QG  GP G  G  G  G PGL+G+ G  G KG+ G
Sbjct:   94 PGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPG 376          

HSP 6 Score: 64.6994 bits (156), Expect = 8.356e-10
Identity = 63/136 (46.32%), Postives = 74/136 (54.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQG---VPGVSGR---DGERGDQGKLG---------VPGIPGETGMNGTPGRDGRPGVAGM---RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            + G  G  GP G PG  G  G+PG++G   +PGVSGR    GE+GD G +G         VPGI G  G +G  G  G PG+ GM   +GD G PG  GP G  G TGAPG  G  G PG  G  G+ G  GLTGN
Sbjct:  867 EKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGN 1002          

HSP 7 Score: 62.3882 bits (150), Expect = 3.303e-9
Identity = 123/354 (34.75%), Postives = 151/354 (42.66%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPI----GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS----------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRG-----------PRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G++GA GP G  G PG  G  G  G  GP G  GE G  G  G  G  G      +L    P+    G PG  G  G QG  G+ G  G PG  G  GF G  G++G  G  G  G  G  G  GI G+     + G PG  G+DG+ GD G+ G  G  G PGS          KG++G  G  G+ G  G  G PG  G  G++G  G  GP G+ G  G+ G  G  G+ G +G PGN                                     G+DGL GI G NG+PG RG           P G  GL G  G  G  GP G  G  G+   PG +G  G  G++G+
Sbjct:  591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALC-DLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQS----IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNP------------------------------------GKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGR 903          

HSP 8 Score: 61.6178 bits (148), Expect = 5.961e-9
Identity = 65/165 (39.39%), Postives = 77/165 (46.67%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGF--------------------PGNQGVPGVSGRDGERGDQGK---LGVPG------IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGP---------------EGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  GN G  G PGNPG DG                     PG  G PG++G  GE+GD+G    +G PG       PG+ G  G PG  GRPG+ G +GD G  GP G AGP               +G  G+PGL+G  G  G +G PGN GPKG  G  G  G
Sbjct:  813 GEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPG 977          

HSP 9 Score: 61.6178 bits (148), Expect = 6.166e-9
Identity = 103/310 (33.23%), Postives = 132/310 (42.58%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPI---GLPGIRGD---LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGI------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN---------------------------------AGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            LTG   VAG  G +G  GP   PG  G NG+                               G  G  GP+G  G PG+   +G +G+ G  G NG QG                   +GA G I   GLPG+ G+   +G  GPIG  G +GE G+ G  G PG DG  G  G+ G  GP G KG+RG+      +G KG  G+ G  G+ G  G  GD G PG +G++G  G+ G +G TGP+G  G                                   G  GRPG  G+IGIQG +G+ G +GL
Sbjct: 1248 LTGPAGVAGAKGDRGLQGP---PGASGLNGI------------------------------PGAKGDIGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGL------------------IGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGL 1505          

HSP 10 Score: 61.2326 bits (147), Expect = 7.808e-9
Identity = 57/133 (42.86%), Postives = 67/133 (50.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G+ G  G PG  G  G  G+ G    S R G +GD+G  G+PGIPG+ G  G PG  G PG  G  G  GQ GP G  G +G TG PG  G+ GKP            G KG PG  G KG+ G +G  G
Sbjct:  543 GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEG 675          

HSP 11 Score: 60.8474 bits (146), Expect = 1.049e-8
Identity = 59/144 (40.97%), Postives = 68/144 (47.22%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGN-----QGVPGVSGRDGERGDQGKLGVPGI----------------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            + GL G  G +G PG  G DG+PG      +G PG  GRDG +GD+G  G  G                       PG+TGM G PG DG PG  G  G  G  GP+GP G EG  G  G  G+ G  G  G PGN G  GL G
Sbjct:  691 EKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRG 834          

HSP 12 Score: 59.3066 bits (142), Expect = 2.909e-8
Identity = 50/112 (44.64%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            G  G  G  G PG PG DGFPG  G+ G +G  G +G++G  G  G  G+ G  G  G  G PG+ G +GDTG PG  G  GP G+ G  G  G  G+ G+ G PG  G KG
Sbjct: 1345 GSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKG 1456          

HSP 13 Score: 59.3066 bits (142), Expect = 3.192e-8
Identity = 138/351 (39.32%), Postives = 161/351 (45.87%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVI--GPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------DPGAPGEHGSNGIPGSKGSQGGTGPQGIIG------------NAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  G+ G  GP G  G PG  G  G +G  GP+GP G +                        GP GL G RG+ G+QG +G     G PG  G  G PG +G  G  G PG+   GP G  G  G+QG+KG  G  G  G  G DGSVG      D G PG  G  GI G KG  G  GP G+ G              GA G PG  G++G+ G KGD G  G +G  G  G  G PG  GP G PG  G  G  G  G  G  G  G +GP G PG+ G  G  G  G PG  G +G PG +G +G  GL G PG  G     G  G+PG   P G +G  GP G  G
Sbjct:  765 GEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVE------------------------GPRGLNGPRGEKGNQGAVGV---PGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPG 1085          

HSP 14 Score: 58.9214 bits (141), Expect = 4.398e-8
Identity = 106/297 (35.69%), Postives = 133/297 (44.78%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGP--QGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXX-------------ELGAAGPIGLPGIRGDLGSQ------GPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGD--------------RGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGI---PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G  G +G +G  G PGPKG  G  G +G  G  G  G              GR+GR+G  G   Q   G+PG  G  G +G  G  G +GE+G  G       K P                  E G+ G  G  G++G+ G Q      GP G +GP GE G  G +G PG  G  G+ G+PG  G  G +G+               G+QG+KG  G  G  G  G DGSVG PG  G+ G  G+   PG  G +G  GP G  G AG  G PG+DG+ G  G KG+ G  GL
Sbjct:  664 AKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTP------------GRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGL 948          

HSP 15 Score: 58.9214 bits (141), Expect = 4.587e-8
Identity = 79/222 (35.59%), Postives = 96/222 (43.24%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGA------DGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGS------NGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMI-------GIQGVKGDSG 1192
            +   G  G  GP GPTG   L G  G  GM GP G  G++                     G  GP G    RGD G +G  G HG  G PGV G  G PGA      DG  G  G+PG+ G +G  G RG  G+ G +G  G P  +  D + G+ G PG  G+       G PG KG +G +GP G  G  G  G  G  G         G  G+KG+ G
Sbjct:   85 IAEKGNRGLPGPLGPTG---LKGEMGFPGMEGPSGDKGQK---------------------GDPGPYGQ---RGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKG 279          

HSP 16 Score: 58.9214 bits (141), Expect = 4.744e-8
Identity = 56/147 (38.10%), Postives = 73/147 (49.66%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG------------------------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI-GKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G+ G  G  G  G++G  G QG+ GV G+ GE+G  G  G+PG PG                        E G++G PG  G  G  G++G TG PGP+G  G  G  G P  + DI G  G +G+ G TG KG  G +G+TGP
Sbjct: 1105 GEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGP 1251          

HSP 17 Score: 58.5362 bits (140), Expect = 6.058e-8
Identity = 59/137 (43.07%), Postives = 71/137 (51.82%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI--------PGETGMNGTPGRDGRPGVAGMR------GDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G  G  G  G+ GL G PG  G+ G+ G  G+ G +G++G PG+        PG  G NG  G  G PG+ G R      G+ G  G  GP GP GS G  GL G  G+PGQ G PG  G KG TG QG  G
Sbjct: 1245 ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKG 1381          

HSP 18 Score: 57.7658 bits (138), Expect = 8.706e-8
Identity = 62/148 (41.89%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG--GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G+ G  G+PG  G  GS+G  G  G  G PG    GR G PGA G  G  G  G  G  G KGD GI+G  GG+      G  G  G+ G PG PG+ G+ G PG +G  G  G  GI G  G  G  G DG  G+ G  G+ G   L
Sbjct:  496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPAL 643          

HSP 19 Score: 57.3806 bits (137), Expect = 1.189e-7
Identity = 57/126 (45.24%), Postives = 70/126 (55.56%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG----LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  G+ G +G PG  G  G  G +G PG+ G+ G  G QG  G PG PG  G +G  G+DG PG+ G+   +G PGPRG AG  GS G  G      GD  K G+KG+PG  G  GL G QG  G
Sbjct:  112 EGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGL---SGMPGPRGYAGQLGSKGEKGEPAKENGDYAK-GEKGEPGWRGTAGLAGPQGFPG 233          

HSP 20 Score: 57.3806 bits (137), Expect = 1.240e-7
Identity = 86/229 (37.55%), Postives = 104/229 (45.41%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPG--VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ---------GKKGGEGVDGAPGIDGKD---------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG----VKGDSGPQG 1201
            G  G  GA G QG  G PG  G+QG  G++GP G  G+                    E G  G  G  G+RGD G  G  G  G +G PG  V GR G PG  G  G SG+ G  G  G KG++G+Q         G  G  G+ GAPG+DG           G  GD G  GE G +G+PG KG  G  G QG  G  G  G  G+ G  G+      ++GD G QG
Sbjct: 1022 GDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGD------------------ASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQG 1232          

HSP 21 Score: 56.225 bits (134), Expect = 3.032e-7
Identity = 57/150 (38.00%), Postives = 79/150 (52.67%), Query Frame = 2
Query: 2564 DDGLDGNVGP---EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG---------LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G +GP   +G+ G PG++G  G++G  G  G  G+RGD+G+ G PG+               PG  G+NG  G DG+ G+ G+ G +G PGPRG AG  GS G  G           G+ G+PG +G  G  GP+G  G +G  G
Sbjct:   90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERG 239          

HSP 22 Score: 55.8398 bits (133), Expect = 3.589e-7
Identity = 54/143 (37.76%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM---------------------NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            GL G VG +G  G PGL+G  G  G PG  G  G +G  G+ G PG+PG+ G                       G PGR G  G+ G++G+ G+ G RG  G  G+ G PG  GD G+PG++G  G  G  G  G  G   P
Sbjct: 1405 GLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAP 1547          

HSP 23 Score: 55.4546 bits (132), Expect = 4.393e-7
Identity = 56/142 (39.44%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGR---DGRPGVAGMRGDT---------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            + GL G  G  G+ G  G  G  G +G+PG++G  G  G  G +G  G  GE G+ G+PG+   DG PG  G++GDT               GQ G +G  G +G +G PGL+G  G  G  G  GN GP G  G +G TGP
Sbjct: 1298 EKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGP 1439          

HSP 24 Score: 55.4546 bits (132), Expect = 4.700e-7
Identity = 92/229 (40.17%), Postives = 113/229 (49.34%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG---------DPGAPGEHGSNGIPGS---------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            R GR G  GA G  G  G PGL G  G  G+ GP GP G +G +G AG PG  G  G  G  G  G  G  G +G+ G  G  G  G +G+ G+ G  G PG  G  G +G PG+    GP G  G+RG  G KG +G DG PG+ G+ G  G         +PG PG +G  G PG          +G +G  G +G+IG  G  GRPG  G  G  G +G  G  GL
Sbjct: 1307 RNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGL 1535          

HSP 25 Score: 55.4546 bits (132), Expect = 4.740e-7
Identity = 59/153 (38.56%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEH------GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  GP G  G +GD G  G  G  G  G PG+ G+ G PG  G  G  G PG+ G  G  G  GI G +G  G+ G  G  G+ GS G+ G P +       G  G PG +G+ G  GPQG  G  G  G  G  G  G +G  G  G +G +
Sbjct:  110 GMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS 262          

HSP 26 Score: 54.6842 bits (130), Expect = 7.348e-7
Identity = 63/141 (44.68%), Postives = 73/141 (51.77%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG--------------NQGVPGVSGRDG---ERGDQGKLGVPGIPGETG------MNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            GL G+ GP G PG PG  G PG              +QG  G+ GRDG   E+G+QG  GV G PGE G      + G PG DG PG AG  G  G PG RG  G  G +G PGL G+ G  G +G  G  GPKG  G +G
Sbjct: 1073 GLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRG 1213          

HSP 27 Score: 54.6842 bits (130), Expect = 7.664e-7
Identity = 111/278 (39.93%), Postives = 126/278 (45.32%), Query Frame = 2
Query:  425 YVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXE--LGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG--GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGK------------KGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG---LDGMIGIQGVKGDSG 1192
            YV  P G QG +G +G PGP+G NG  G                          G  GR G  GP      PG  G +G  G+NGPKG  G  G  G  GP G KG  G  G    G+ G  G+PG  G  GS+G  G  G  G PG    GR G PGA G  G  G  G  G  G KGD GI+G             KG +G  G PGI GKDG+ G P   G PGE G +GI G  G  G  G  G  G  GATG PG   L  +  I+ +KGD G
Sbjct:  411 YVGAP-GPQGLNGVDGLPGPQGYNGQKGG------------------------AGLPGRPGNEGP------PGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKG 657          

HSP 28 Score: 54.299 bits (129), Expect = 1.101e-6
Identity = 55/147 (37.41%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  809 LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG---IPGSKGSQGGTGPQGIIGNAGATGR------------PGLDGMIGIQGVKGDSGPQGL 1204
            +  +G  G  GP G  G+ G +GFPG +G +G  G  G  GP G +GD+G +G  G  G  G PG+ G  G+ G PG  G+ G +G   IPG +G  G  GP+G  G  G+ G              G  G  G +G  G +GPQG 
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGF 231          

HSP 29 Score: 53.9138 bits (128), Expect = 1.609e-6
Identity = 51/127 (40.16%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------GETGMNGTPGRDGRPGVAGMRGDTGQPGP--RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNT 2893
            +DG  G  G  G+PG P L      +   G++G PG  G  G +G +G  G+PGIP         GE G++G PG DG PG AG  G  G PG   +G  G  G  GA G  G  G+ G+KG+PG+ 
Sbjct:  625 EDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC 751          

HSP 30 Score: 53.5286 bits (127), Expect = 1.937e-6
Identity = 53/136 (38.97%), Postives = 70/136 (51.47%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIG---------------KPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G+ GP+G  G  GL+GF G +G        G+RG QG  G+PG+ G+ G  G PG +G  G  G  G+ G  GP+G  G +G+ G PG  G+ G               + G KG+PG  G +GL G QG  G
Sbjct: 1369 GLKGDTGPQGFKGERGLNGFEGQKG------DKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG 1498          

HSP 31 Score: 53.5286 bits (127), Expect = 2.072e-6
Identity = 51/129 (39.53%), Postives = 68/129 (52.71%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPG------PRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G+ G  G+ G PG+ G  GN G PG++G+DG  G  G      IPG  G++G PG  G  G  G +G+ G+P        +G  G  G  G  GL G  G PG+KG+ G++GP G  G +G  G
Sbjct:  132 DKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDG------IPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHG 254          

HSP 32 Score: 51.9878 bits (123), Expect = 4.774e-6
Identity = 59/155 (38.06%), Postives = 74/155 (47.74%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP------GIPGETGMNGTPGRDGRPG---------------VAGMRGDT------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG+ G  G +G+PG+PGL G PGN+G  G  G DG +G  G  G P      GIPG +G  G  G  G  G               + G++GD             G PG +G  G  G  G PGL GD  + GQKG+PG +G +G TG  G  G
Sbjct:  931 DGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085          
BLAST of Fibrillar collagen vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 79.7221 bits (195), Expect = 2.218e-14
Identity = 95/221 (42.99%), Postives = 118/221 (53.39%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIR--GDLGSQGPIGSHGPEGEPGVGGRIGFPGADG------------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G  G  G  GP G PG+   +GP+G+NGP+G  G QG  G  G PG  G +G  G  G  GP G PGI   G +G  G  G  G +G+ G  G IGFPGADG            + GVSG PG++G  G  G  G  G  G  GV G  G+ G+DG+ G+PG+PG  G  G  G +G+ G  GP+G  G  GA G+ G  G+ G+ G KGD G  GL 
Sbjct:  783 GERGYTGLKGNTGPQGPPGV---EGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLT 1000          

HSP 2 Score: 69.707 bits (169), Expect = 2.523e-11
Identity = 96/241 (39.83%), Postives = 121/241 (50.21%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTG---KPGL----------MGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS--------------------HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            +G  G  GA GP+G  G   +PGL           GSQG +G  G KG  GE+G  G AG  G KG +G  G  GA+G  G+PG +GD+G +G IG                      G  G PG+ G  G PG  G  G+ G+PG IGP G+KG+RG+ G         +PG  G+DG    PGAPG  G  G  G KG +G  G +G  G+ G  G  G  G+ G+ G KGD+G  GLN
Sbjct: 1194 VGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAG---------SPGQPGQDGF---PGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN 1422          

HSP 3 Score: 65.4698 bits (158), Expect = 4.185e-10
Identity = 139/364 (38.19%), Postives = 164/364 (45.05%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGP---------------TGTKGDRGIQGKKGGEGVDGAP------GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL--DGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGAN---------GKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRG 1570
            +G  G  G  G  G +G+PG++G +G  G   P GP G  GP G  G  G +G  G  GE G+ G +G+PG +GD G+    GP G  G  G PG  G  G PG  G  G  G  G+ G                 G KGD+G+ G  G +G+DG P      G  G DG  G PG   E G  G PG  G +G TGP G  G  G  G PGL   G  G  G KGD G  G++GR GI G  G  G  G  G PG                                GS GA G  G PG+DG           G PG RG +G  GL+GLPG  G  GP GL G  GA   PGP+G+ G RG
Sbjct:  886 VGYPGDRGDAGLPGVSGRPGIVGEKGDVG---PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGE------------------------------KGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGA---PGPKGERGIRG 1213          

HSP 4 Score: 65.0846 bits (157), Expect = 5.123e-10
Identity = 58/137 (42.34%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR-----------------PGVAGMRGDTGQPGPRGPA---GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            +DG  G  G  G  GN G  G PG +G  G++G  GE+G+QG +GVPG PG+ G+ G PGR+G+                 PG+ G++G+ G  GP GP    G +GS G PG  GD G PG  G+PG  G KG  G
Sbjct:  778 EDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG 914          

HSP 5 Score: 64.6994 bits (156), Expect = 6.543e-10
Identity = 116/283 (40.99%), Postives = 137/283 (48.41%), Query Frame = 2
Query:  401 PAPL--TGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGS------QGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGF-------PGADGITGVSGMPGV---IGPTGT-KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            P PL  TG +   G  G++GP G +G+ G  GP G  G +G+ G  G  G  G  G QGP G  G  G NG  G  G  G PGL G       +G  G  G KG  GE   +      G KG  G  G  G AGP G PG +G+ G  GP G+ GP GE G+ G  G        PGA GI G  G P     + PT T  G RG  G+KG  G+ G  G  G +G  G  G  GE G  G PG +G QG  GP G  G  G  G PGL+G+ G  G KG+ G
Sbjct:   94 PGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPG 376          

HSP 6 Score: 64.6994 bits (156), Expect = 8.356e-10
Identity = 63/136 (46.32%), Postives = 74/136 (54.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQG---VPGVSGR---DGERGDQGKLG---------VPGIPGETGMNGTPGRDGRPGVAGM---RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            + G  G  GP G PG  G  G+PG++G   +PGVSGR    GE+GD G +G         VPGI G  G +G  G  G PG+ GM   +GD G PG  GP G  G TGAPG  G  G PG  G  G+ G  GLTGN
Sbjct:  867 EKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGN 1002          

HSP 7 Score: 62.3882 bits (150), Expect = 3.303e-9
Identity = 123/354 (34.75%), Postives = 151/354 (42.66%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPI----GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS----------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRG-----------PRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G++GA GP G  G PG  G  G  G  GP G  GE G  G  G  G  G      +L    P+    G PG  G  G QG  G+ G  G PG  G  GF G  G++G  G  G  G  G  G  GI G+     + G PG  G+DG+ GD G+ G  G  G PGS          KG++G  G  G+ G  G  G PG  G  G++G  G  GP G+ G  G+ G  G  G+ G +G PGN                                     G+DGL GI G NG+PG RG           P G  GL G  G  G  GP G  G  G+   PG +G  G  G++G+
Sbjct:  591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALC-DLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQS----IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNP------------------------------------GKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGR 903          

HSP 8 Score: 61.6178 bits (148), Expect = 5.961e-9
Identity = 65/165 (39.39%), Postives = 77/165 (46.67%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGF--------------------PGNQGVPGVSGRDGERGDQGK---LGVPG------IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGP---------------EGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  GN G  G PGNPG DG                     PG  G PG++G  GE+GD+G    +G PG       PG+ G  G PG  GRPG+ G +GD G  GP G AGP               +G  G+PGL+G  G  G +G PGN GPKG  G  G  G
Sbjct:  813 GEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPG 977          

HSP 9 Score: 61.6178 bits (148), Expect = 6.166e-9
Identity = 103/310 (33.23%), Postives = 132/310 (42.58%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPI---GLPGIRGD---LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGI------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN---------------------------------AGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            LTG   VAG  G +G  GP   PG  G NG+                               G  G  GP+G  G PG+   +G +G+ G  G NG QG                   +GA G I   GLPG+ G+   +G  GPIG  G +GE G+ G  G PG DG  G  G+ G  GP G KG+RG+      +G KG  G+ G  G+ G  G  GD G PG +G++G  G+ G +G TGP+G  G                                   G  GRPG  G+IGIQG +G+ G +GL
Sbjct: 1248 LTGPAGVAGAKGDRGLQGP---PGASGLNGI------------------------------PGAKGDIGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGL------------------IGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGL 1505          

HSP 10 Score: 61.2326 bits (147), Expect = 7.808e-9
Identity = 57/133 (42.86%), Postives = 67/133 (50.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G+ G  G PG  G  G  G+ G    S R G +GD+G  G+PGIPG+ G  G PG  G PG  G  G  GQ GP G  G +G TG PG  G+ GKP            G KG PG  G KG+ G +G  G
Sbjct:  543 GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEG 675          

HSP 11 Score: 60.8474 bits (146), Expect = 1.049e-8
Identity = 59/144 (40.97%), Postives = 68/144 (47.22%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGN-----QGVPGVSGRDGERGDQGKLGVPGI----------------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            + GL G  G +G PG  G DG+PG      +G PG  GRDG +GD+G  G  G                       PG+TGM G PG DG PG  G  G  G  GP+GP G EG  G  G  G+ G  G  G PGN G  GL G
Sbjct:  691 EKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRG 834          

HSP 12 Score: 59.3066 bits (142), Expect = 2.909e-8
Identity = 50/112 (44.64%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            G  G  G  G PG PG DGFPG  G+ G +G  G +G++G  G  G  G+ G  G  G  G PG+ G +GDTG PG  G  GP G+ G  G  G  G+ G+ G PG  G KG
Sbjct: 1345 GSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKG 1456          

HSP 13 Score: 59.3066 bits (142), Expect = 3.192e-8
Identity = 138/351 (39.32%), Postives = 161/351 (45.87%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVI--GPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------DPGAPGEHGSNGIPGSKGSQGGTGPQGIIG------------NAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  G+ G  GP G  G PG  G  G +G  GP+GP G +                        GP GL G RG+ G+QG +G     G PG  G  G PG +G  G  G PG+   GP G  G  G+QG+KG  G  G  G  G DGSVG      D G PG  G  GI G KG  G  GP G+ G              GA G PG  G++G+ G KGD G  G +G  G  G  G PG  GP G PG  G  G  G  G  G  G  G +GP G PG+ G  G  G  G PG  G +G PG +G +G  GL G PG  G     G  G+PG   P G +G  GP G  G
Sbjct:  765 GEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVE------------------------GPRGLNGPRGEKGNQGAVGV---PGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPG 1085          

HSP 14 Score: 58.9214 bits (141), Expect = 4.398e-8
Identity = 106/297 (35.69%), Postives = 133/297 (44.78%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGP--QGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXX-------------ELGAAGPIGLPGIRGDLGSQ------GPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGD--------------RGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGI---PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G  G +G +G  G PGPKG  G  G +G  G  G  G              GR+GR+G  G   Q   G+PG  G  G +G  G  G +GE+G  G       K P                  E G+ G  G  G++G+ G Q      GP G +GP GE G  G +G PG  G  G+ G+PG  G  G +G+               G+QG+KG  G  G  G  G DGSVG PG  G+ G  G+   PG  G +G  GP G  G AG  G PG+DG+ G  G KG+ G  GL
Sbjct:  664 AKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTP------------GRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGL 948          

HSP 15 Score: 58.9214 bits (141), Expect = 4.587e-8
Identity = 79/222 (35.59%), Postives = 96/222 (43.24%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGA------DGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGS------NGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMI-------GIQGVKGDSG 1192
            +   G  G  GP GPTG   L G  G  GM GP G  G++                     G  GP G    RGD G +G  G HG  G PGV G  G PGA      DG  G  G+PG+ G +G  G RG  G+ G +G  G P  +  D + G+ G PG  G+       G PG KG +G +GP G  G  G  G  G  G         G  G+KG+ G
Sbjct:   85 IAEKGNRGLPGPLGPTG---LKGEMGFPGMEGPSGDKGQK---------------------GDPGPYGQ---RGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKG 279          

HSP 16 Score: 58.9214 bits (141), Expect = 4.744e-8
Identity = 56/147 (38.10%), Postives = 73/147 (49.66%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG------------------------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI-GKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G+ G  G  G  G++G  G QG+ GV G+ GE+G  G  G+PG PG                        E G++G PG  G  G  G++G TG PGP+G  G  G  G P  + DI G  G +G+ G TG KG  G +G+TGP
Sbjct: 1105 GEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGP 1251          

HSP 17 Score: 58.5362 bits (140), Expect = 6.058e-8
Identity = 59/137 (43.07%), Postives = 71/137 (51.82%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI--------PGETGMNGTPGRDGRPGVAGMR------GDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G  G  G  G+ GL G PG  G+ G+ G  G+ G +G++G PG+        PG  G NG  G  G PG+ G R      G+ G  G  GP GP GS G  GL G  G+PGQ G PG  G KG TG QG  G
Sbjct: 1245 ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKG 1381          

HSP 18 Score: 57.7658 bits (138), Expect = 8.706e-8
Identity = 62/148 (41.89%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG--GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G+ G  G+PG  G  GS+G  G  G  G PG    GR G PGA G  G  G  G  G  G KGD GI+G  GG+      G  G  G+ G PG PG+ G+ G PG +G  G  G  GI G  G  G  G DG  G+ G  G+ G   L
Sbjct:  496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPAL 643          

HSP 19 Score: 57.3806 bits (137), Expect = 1.189e-7
Identity = 57/126 (45.24%), Postives = 70/126 (55.56%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG----LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  G+ G +G PG  G  G  G +G PG+ G+ G  G QG  G PG PG  G +G  G+DG PG+ G+   +G PGPRG AG  GS G  G      GD  K G+KG+PG  G  GL G QG  G
Sbjct:  112 EGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGL---SGMPGPRGYAGQLGSKGEKGEPAKENGDYAK-GEKGEPGWRGTAGLAGPQGFPG 233          

HSP 20 Score: 57.3806 bits (137), Expect = 1.240e-7
Identity = 86/229 (37.55%), Postives = 104/229 (45.41%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPG--VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ---------GKKGGEGVDGAPGIDGKD---------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG----VKGDSGPQG 1201
            G  G  GA G QG  G PG  G+QG  G++GP G  G+                    E G  G  G  G+RGD G  G  G  G +G PG  V GR G PG  G  G SG+ G  G  G KG++G+Q         G  G  G+ GAPG+DG           G  GD G  GE G +G+PG KG  G  G QG  G  G  G  G+ G  G+      ++GD G QG
Sbjct: 1022 GDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGD------------------ASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQG 1232          

HSP 21 Score: 56.225 bits (134), Expect = 3.032e-7
Identity = 57/150 (38.00%), Postives = 79/150 (52.67%), Query Frame = 2
Query: 2564 DDGLDGNVGP---EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG---------LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G +GP   +G+ G PG++G  G++G  G  G  G+RGD+G+ G PG+               PG  G+NG  G DG+ G+ G+ G +G PGPRG AG  GS G  G           G+ G+PG +G  G  GP+G  G +G  G
Sbjct:   90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERG 239          

HSP 22 Score: 55.8398 bits (133), Expect = 3.589e-7
Identity = 54/143 (37.76%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM---------------------NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            GL G VG +G  G PGL+G  G  G PG  G  G +G  G+ G PG+PG+ G                       G PGR G  G+ G++G+ G+ G RG  G  G+ G PG  GD G+PG++G  G  G  G  G  G   P
Sbjct: 1405 GLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAP 1547          

HSP 23 Score: 55.4546 bits (132), Expect = 4.393e-7
Identity = 56/142 (39.44%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGR---DGRPGVAGMRGDT---------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            + GL G  G  G+ G  G  G  G +G+PG++G  G  G  G +G  G  GE G+ G+PG+   DG PG  G++GDT               GQ G +G  G +G +G PGL+G  G  G  G  GN GP G  G +G TGP
Sbjct: 1298 EKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGP 1439          

HSP 24 Score: 55.4546 bits (132), Expect = 4.700e-7
Identity = 92/229 (40.17%), Postives = 113/229 (49.34%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG---------DPGAPGEHGSNGIPGS---------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            R GR G  GA G  G  G PGL G  G  G+ GP GP G +G +G AG PG  G  G  G  G  G  G  G +G+ G  G  G  G +G+ G+ G  G PG  G  G +G PG+    GP G  G+RG  G KG +G DG PG+ G+ G  G         +PG PG +G  G PG          +G +G  G +G+IG  G  GRPG  G  G  G +G  G  GL
Sbjct: 1307 RNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGL 1535          

HSP 25 Score: 55.4546 bits (132), Expect = 4.740e-7
Identity = 59/153 (38.56%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEH------GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  GP G  G +GD G  G  G  G  G PG+ G+ G PG  G  G  G PG+ G  G  G  GI G +G  G+ G  G  G+ GS G+ G P +       G  G PG +G+ G  GPQG  G  G  G  G  G  G +G  G  G +G +
Sbjct:  110 GMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS 262          

HSP 26 Score: 54.6842 bits (130), Expect = 7.348e-7
Identity = 63/141 (44.68%), Postives = 73/141 (51.77%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG--------------NQGVPGVSGRDG---ERGDQGKLGVPGIPGETG------MNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            GL G+ GP G PG PG  G PG              +QG  G+ GRDG   E+G+QG  GV G PGE G      + G PG DG PG AG  G  G PG RG  G  G +G PGL G+ G  G +G  G  GPKG  G +G
Sbjct: 1073 GLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRG 1213          

HSP 27 Score: 54.6842 bits (130), Expect = 7.664e-7
Identity = 111/278 (39.93%), Postives = 126/278 (45.32%), Query Frame = 2
Query:  425 YVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXE--LGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG--GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGK------------KGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG---LDGMIGIQGVKGDSG 1192
            YV  P G QG +G +G PGP+G NG  G                          G  GR G  GP      PG  G +G  G+NGPKG  G  G  G  GP G KG  G  G    G+ G  G+PG  G  GS+G  G  G  G PG    GR G PGA G  G  G  G  G  G KGD GI+G             KG +G  G PGI GKDG+ G P   G PGE G +GI G  G  G  G  G  G  GATG PG   L  +  I+ +KGD G
Sbjct:  411 YVGAP-GPQGLNGVDGLPGPQGYNGQKGG------------------------AGLPGRPGNEGP------PGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKG 657          

HSP 28 Score: 54.299 bits (129), Expect = 1.101e-6
Identity = 55/147 (37.41%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  809 LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG---IPGSKGSQGGTGPQGIIGNAGATGR------------PGLDGMIGIQGVKGDSGPQGL 1204
            +  +G  G  GP G  G+ G +GFPG +G +G  G  G  GP G +GD+G +G  G  G  G PG+ G  G+ G PG  G+ G +G   IPG +G  G  GP+G  G  G+ G              G  G  G +G  G +GPQG 
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGF 231          

HSP 29 Score: 53.9138 bits (128), Expect = 1.609e-6
Identity = 51/127 (40.16%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------GETGMNGTPGRDGRPGVAGMRGDTGQPGP--RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNT 2893
            +DG  G  G  G+PG P L      +   G++G PG  G  G +G +G  G+PGIP         GE G++G PG DG PG AG  G  G PG   +G  G  G  GA G  G  G+ G+KG+PG+ 
Sbjct:  625 EDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC 751          

HSP 30 Score: 53.5286 bits (127), Expect = 1.937e-6
Identity = 53/136 (38.97%), Postives = 70/136 (51.47%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIG---------------KPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G+ GP+G  G  GL+GF G +G        G+RG QG  G+PG+ G+ G  G PG +G  G  G  G+ G  GP+G  G +G+ G PG  G+ G               + G KG+PG  G +GL G QG  G
Sbjct: 1369 GLKGDTGPQGFKGERGLNGFEGQKG------DKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG 1498          

HSP 31 Score: 53.5286 bits (127), Expect = 2.072e-6
Identity = 51/129 (39.53%), Postives = 68/129 (52.71%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPG------PRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G+ G  G+ G PG+ G  GN G PG++G+DG  G  G      IPG  G++G PG  G  G  G +G+ G+P        +G  G  G  G  GL G  G PG+KG+ G++GP G  G +G  G
Sbjct:  132 DKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDG------IPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHG 254          

HSP 32 Score: 51.9878 bits (123), Expect = 4.774e-6
Identity = 59/155 (38.06%), Postives = 74/155 (47.74%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP------GIPGETGMNGTPGRDGRPG---------------VAGMRGDT------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG+ G  G +G+PG+PGL G PGN+G  G  G DG +G  G  G P      GIPG +G  G  G  G  G               + G++GD             G PG +G  G  G  G PGL GD  + GQKG+PG +G +G TG  G  G
Sbjct:  931 DGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085          
BLAST of Fibrillar collagen vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079001)

HSP 1 Score: 79.7221 bits (195), Expect = 2.218e-14
Identity = 95/221 (42.99%), Postives = 118/221 (53.39%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIR--GDLGSQGPIGSHGPEGEPGVGGRIGFPGADG------------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G  G  G  GP G PG+   +GP+G+NGP+G  G QG  G  G PG  G +G  G  G  GP G PGI   G +G  G  G  G +G+ G  G IGFPGADG            + GVSG PG++G  G  G  G  G  G  GV G  G+ G+DG+ G+PG+PG  G  G  G +G+ G  GP+G  G  GA G+ G  G+ G+ G KGD G  GL 
Sbjct:  783 GERGYTGLKGNTGPQGPPGV---EGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLT 1000          

HSP 2 Score: 69.707 bits (169), Expect = 2.523e-11
Identity = 96/241 (39.83%), Postives = 121/241 (50.21%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTG---KPGL----------MGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS--------------------HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            +G  G  GA GP+G  G   +PGL           GSQG +G  G KG  GE+G  G AG  G KG +G  G  GA+G  G+PG +GD+G +G IG                      G  G PG+ G  G PG  G  G+ G+PG IGP G+KG+RG+ G         +PG  G+DG    PGAPG  G  G  G KG +G  G +G  G+ G  G  G  G+ G+ G KGD+G  GLN
Sbjct: 1194 VGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAG---------SPGQPGQDGF---PGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN 1422          

HSP 3 Score: 65.4698 bits (158), Expect = 4.185e-10
Identity = 139/364 (38.19%), Postives = 164/364 (45.05%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGP---------------TGTKGDRGIQGKKGGEGVDGAP------GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL--DGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGAN---------GKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRG 1570
            +G  G  G  G  G +G+PG++G +G  G   P GP G  GP G  G  G +G  G  GE G+ G +G+PG +GD G+    GP G  G  G PG  G  G PG  G  G  G  G+ G                 G KGD+G+ G  G +G+DG P      G  G DG  G PG   E G  G PG  G +G TGP G  G  G  G PGL   G  G  G KGD G  G++GR GI G  G  G  G  G PG                                GS GA G  G PG+DG           G PG RG +G  GL+GLPG  G  GP GL G  GA   PGP+G+ G RG
Sbjct:  886 VGYPGDRGDAGLPGVSGRPGIVGEKGDVG---PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGE------------------------------KGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGA---PGPKGERGIRG 1213          

HSP 4 Score: 65.0846 bits (157), Expect = 5.123e-10
Identity = 58/137 (42.34%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR-----------------PGVAGMRGDTGQPGPRGPA---GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            +DG  G  G  G  GN G  G PG +G  G++G  GE+G+QG +GVPG PG+ G+ G PGR+G+                 PG+ G++G+ G  GP GP    G +GS G PG  GD G PG  G+PG  G KG  G
Sbjct:  778 EDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG 914          

HSP 5 Score: 64.6994 bits (156), Expect = 6.543e-10
Identity = 116/283 (40.99%), Postives = 137/283 (48.41%), Query Frame = 2
Query:  401 PAPL--TGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGS------QGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGF-------PGADGITGVSGMPGV---IGPTGT-KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            P PL  TG +   G  G++GP G +G+ G  GP G  G +G+ G  G  G  G  G QGP G  G  G NG  G  G  G PGL G       +G  G  G KG  GE   +      G KG  G  G  G AGP G PG +G+ G  GP G+ GP GE G+ G  G        PGA GI G  G P     + PT T  G RG  G+KG  G+ G  G  G +G  G  G  GE G  G PG +G QG  GP G  G  G  G PGL+G+ G  G KG+ G
Sbjct:   94 PGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPG 376          

HSP 6 Score: 64.6994 bits (156), Expect = 8.356e-10
Identity = 63/136 (46.32%), Postives = 74/136 (54.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQG---VPGVSGR---DGERGDQGKLG---------VPGIPGETGMNGTPGRDGRPGVAGM---RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            + G  G  GP G PG  G  G+PG++G   +PGVSGR    GE+GD G +G         VPGI G  G +G  G  G PG+ GM   +GD G PG  GP G  G TGAPG  G  G PG  G  G+ G  GLTGN
Sbjct:  867 EKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGN 1002          

HSP 7 Score: 62.3882 bits (150), Expect = 3.303e-9
Identity = 123/354 (34.75%), Postives = 151/354 (42.66%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPI----GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS----------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRG-----------PRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G++GA GP G  G PG  G  G  G  GP G  GE G  G  G  G  G      +L    P+    G PG  G  G QG  G+ G  G PG  G  GF G  G++G  G  G  G  G  G  GI G+     + G PG  G+DG+ GD G+ G  G  G PGS          KG++G  G  G+ G  G  G PG  G  G++G  G  GP G+ G  G+ G  G  G+ G +G PGN                                     G+DGL GI G NG+PG RG           P G  GL G  G  G  GP G  G  G+   PG +G  G  G++G+
Sbjct:  591 GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALC-DLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQS----IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNP------------------------------------GKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGR 903          

HSP 8 Score: 61.6178 bits (148), Expect = 5.961e-9
Identity = 65/165 (39.39%), Postives = 77/165 (46.67%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGF--------------------PGNQGVPGVSGRDGERGDQGK---LGVPG------IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGP---------------EGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  GN G  G PGNPG DG                     PG  G PG++G  GE+GD+G    +G PG       PG+ G  G PG  GRPG+ G +GD G  GP G AGP               +G  G+PGL+G  G  G +G PGN GPKG  G  G  G
Sbjct:  813 GEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPG 977          

HSP 9 Score: 61.6178 bits (148), Expect = 6.166e-9
Identity = 103/310 (33.23%), Postives = 132/310 (42.58%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPI---GLPGIRGD---LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGI------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN---------------------------------AGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            LTG   VAG  G +G  GP   PG  G NG+                               G  G  GP+G  G PG+   +G +G+ G  G NG QG                   +GA G I   GLPG+ G+   +G  GPIG  G +GE G+ G  G PG DG  G  G+ G  GP G KG+RG+      +G KG  G+ G  G+ G  G  GD G PG +G++G  G+ G +G TGP+G  G                                   G  GRPG  G+IGIQG +G+ G +GL
Sbjct: 1248 LTGPAGVAGAKGDRGLQGP---PGASGLNGI------------------------------PGAKGDIGPRGEIGYPGVT-IKGEKGLPGRPGRNGRQGL------------------IGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGL 1505          

HSP 10 Score: 61.2326 bits (147), Expect = 7.808e-9
Identity = 57/133 (42.86%), Postives = 67/133 (50.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G+ G  G PG  G  G  G+ G    S R G +GD+G  G+PGIPG+ G  G PG  G PG  G  G  GQ GP G  G +G TG PG  G+ GKP            G KG PG  G KG+ G +G  G
Sbjct:  543 GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEG 675          

HSP 11 Score: 60.8474 bits (146), Expect = 1.049e-8
Identity = 59/144 (40.97%), Postives = 68/144 (47.22%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGN-----QGVPGVSGRDGERGDQGKLGVPGI----------------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            + GL G  G +G PG  G DG+PG      +G PG  GRDG +GD+G  G  G                       PG+TGM G PG DG PG  G  G  G  GP+GP G EG  G  G  G+ G  G  G PGN G  GL G
Sbjct:  691 EKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRG 834          

HSP 12 Score: 59.3066 bits (142), Expect = 2.909e-8
Identity = 50/112 (44.64%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            G  G  G  G PG PG DGFPG  G+ G +G  G +G++G  G  G  G+ G  G  G  G PG+ G +GDTG PG  G  GP G+ G  G  G  G+ G+ G PG  G KG
Sbjct: 1345 GSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKG 1456          

HSP 13 Score: 59.3066 bits (142), Expect = 3.192e-8
Identity = 138/351 (39.32%), Postives = 161/351 (45.87%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVI--GPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------DPGAPGEHGSNGIPGSKGSQGGTGPQGIIG------------NAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  G+ G  GP G  G PG  G  G +G  GP+GP G +                        GP GL G RG+ G+QG +G     G PG  G  G PG +G  G  G PG+   GP G  G  G+QG+KG  G  G  G  G DGSVG      D G PG  G  GI G KG  G  GP G+ G              GA G PG  G++G+ G KGD G  G +G  G  G  G PG  GP G PG  G  G  G  G  G  G  G +GP G PG+ G  G  G  G PG  G +G PG +G +G  GL G PG  G     G  G+PG   P G +G  GP G  G
Sbjct:  765 GEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVE------------------------GPRGLNGPRGEKGNQGAVGV---PGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPG---PSGLRGDTGPAGTPG 1085          

HSP 14 Score: 58.9214 bits (141), Expect = 4.398e-8
Identity = 106/297 (35.69%), Postives = 133/297 (44.78%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGP--QGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXX-------------ELGAAGPIGLPGIRGDLGSQ------GPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGD--------------RGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGI---PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G  G +G +G  G PGPKG  G  G +G  G  G  G              GR+GR+G  G   Q   G+PG  G  G +G  G  G +GE+G  G       K P                  E G+ G  G  G++G+ G Q      GP G +GP GE G  G +G PG  G  G+ G+PG  G  G +G+               G+QG+KG  G  G  G  G DGSVG PG  G+ G  G+   PG  G +G  GP G  G AG  G PG+DG+ G  G KG+ G  GL
Sbjct:  664 AKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTP------------GRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGL 948          

HSP 15 Score: 58.9214 bits (141), Expect = 4.587e-8
Identity = 79/222 (35.59%), Postives = 96/222 (43.24%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGA------DGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGS------NGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMI-------GIQGVKGDSG 1192
            +   G  G  GP GPTG   L G  G  GM GP G  G++                     G  GP G    RGD G +G  G HG  G PGV G  G PGA      DG  G  G+PG+ G +G  G RG  G+ G +G  G P  +  D + G+ G PG  G+       G PG KG +G +GP G  G  G  G  G  G         G  G+KG+ G
Sbjct:   85 IAEKGNRGLPGPLGPTG---LKGEMGFPGMEGPSGDKGQK---------------------GDPGPYGQ---RGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKG 279          

HSP 16 Score: 58.9214 bits (141), Expect = 4.744e-8
Identity = 56/147 (38.10%), Postives = 73/147 (49.66%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG------------------------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI-GKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G+ G  G  G  G++G  G QG+ GV G+ GE+G  G  G+PG PG                        E G++G PG  G  G  G++G TG PGP+G  G  G  G P  + DI G  G +G+ G TG KG  G +G+TGP
Sbjct: 1105 GEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGP 1251          

HSP 17 Score: 58.5362 bits (140), Expect = 6.058e-8
Identity = 59/137 (43.07%), Postives = 71/137 (51.82%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI--------PGETGMNGTPGRDGRPGVAGMR------GDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G  G  G  G+ GL G PG  G+ G+ G  G+ G +G++G PG+        PG  G NG  G  G PG+ G R      G+ G  G  GP GP GS G  GL G  G+PGQ G PG  G KG TG QG  G
Sbjct: 1245 ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKG 1381          

HSP 18 Score: 57.7658 bits (138), Expect = 8.706e-8
Identity = 62/148 (41.89%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG--GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G+ G  G+PG  G  GS+G  G  G  G PG    GR G PGA G  G  G  G  G  G KGD GI+G  GG+      G  G  G+ G PG PG+ G+ G PG +G  G  G  GI G  G  G  G DG  G+ G  G+ G   L
Sbjct:  496 GSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPAL 643          

HSP 19 Score: 57.3806 bits (137), Expect = 1.189e-7
Identity = 57/126 (45.24%), Postives = 70/126 (55.56%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG----LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  G+ G +G PG  G  G  G +G PG+ G+ G  G QG  G PG PG  G +G  G+DG PG+ G+   +G PGPRG AG  GS G  G      GD  K G+KG+PG  G  GL G QG  G
Sbjct:  112 EGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGL---SGMPGPRGYAGQLGSKGEKGEPAKENGDYAK-GEKGEPGWRGTAGLAGPQGFPG 233          

HSP 20 Score: 57.3806 bits (137), Expect = 1.240e-7
Identity = 86/229 (37.55%), Postives = 104/229 (45.41%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPG--VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ---------GKKGGEGVDGAPGIDGKD---------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG----VKGDSGPQG 1201
            G  G  GA G QG  G PG  G+QG  G++GP G  G+                    E G  G  G  G+RGD G  G  G  G +G PG  V GR G PG  G  G SG+ G  G  G KG++G+Q         G  G  G+ GAPG+DG           G  GD G  GE G +G+PG KG  G  G QG  G  G  G  G+ G  G+      ++GD G QG
Sbjct: 1022 GDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGD------------------ASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQG 1232          

HSP 21 Score: 56.225 bits (134), Expect = 3.032e-7
Identity = 57/150 (38.00%), Postives = 79/150 (52.67%), Query Frame = 2
Query: 2564 DDGLDGNVGP---EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG---------LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G +GP   +G+ G PG++G  G++G  G  G  G+RGD+G+ G PG+               PG  G+NG  G DG+ G+ G+ G +G PGPRG AG  GS G  G           G+ G+PG +G  G  GP+G  G +G  G
Sbjct:   90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERG 239          

HSP 22 Score: 55.8398 bits (133), Expect = 3.589e-7
Identity = 54/143 (37.76%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM---------------------NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            GL G VG +G  G PGL+G  G  G PG  G  G +G  G+ G PG+PG+ G                       G PGR G  G+ G++G+ G+ G RG  G  G+ G PG  GD G+PG++G  G  G  G  G  G   P
Sbjct: 1405 GLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAP 1547          

HSP 23 Score: 55.4546 bits (132), Expect = 4.393e-7
Identity = 56/142 (39.44%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGR---DGRPGVAGMRGDT---------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            + GL G  G  G+ G  G  G  G +G+PG++G  G  G  G +G  G  GE G+ G+PG+   DG PG  G++GDT               GQ G +G  G +G +G PGL+G  G  G  G  GN GP G  G +G TGP
Sbjct: 1298 EKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGP 1439          

HSP 24 Score: 55.4546 bits (132), Expect = 4.700e-7
Identity = 92/229 (40.17%), Postives = 113/229 (49.34%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG---------DPGAPGEHGSNGIPGS---------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            R GR G  GA G  G  G PGL G  G  G+ GP GP G +G +G AG PG  G  G  G  G  G  G  G +G+ G  G  G  G +G+ G+ G  G PG  G  G +G PG+    GP G  G+RG  G KG +G DG PG+ G+ G  G         +PG PG +G  G PG          +G +G  G +G+IG  G  GRPG  G  G  G +G  G  GL
Sbjct: 1307 RNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGL 1535          

HSP 25 Score: 55.4546 bits (132), Expect = 4.740e-7
Identity = 59/153 (38.56%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEH------GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  GP G  G +GD G  G  G  G  G PG+ G+ G PG  G  G  G PG+ G  G  G  GI G +G  G+ G  G  G+ GS G+ G P +       G  G PG +G+ G  GPQG  G  G  G  G  G  G +G  G  G +G +
Sbjct:  110 GMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS 262          

HSP 26 Score: 54.6842 bits (130), Expect = 7.348e-7
Identity = 63/141 (44.68%), Postives = 73/141 (51.77%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG--------------NQGVPGVSGRDG---ERGDQGKLGVPGIPGETG------MNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            GL G+ GP G PG PG  G PG              +QG  G+ GRDG   E+G+QG  GV G PGE G      + G PG DG PG AG  G  G PG RG  G  G +G PGL G+ G  G +G  G  GPKG  G +G
Sbjct: 1073 GLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRG 1213          

HSP 27 Score: 54.6842 bits (130), Expect = 7.664e-7
Identity = 111/278 (39.93%), Postives = 126/278 (45.32%), Query Frame = 2
Query:  425 YVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXE--LGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVG--GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGK------------KGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG---LDGMIGIQGVKGDSG 1192
            YV  P G QG +G +G PGP+G NG  G                          G  GR G  GP      PG  G +G  G+NGPKG  G  G  G  GP G KG  G  G    G+ G  G+PG  G  GS+G  G  G  G PG    GR G PGA G  G  G  G  G  G KGD GI+G             KG +G  G PGI GKDG+ G P   G PGE G +GI G  G  G  G  G  G  GATG PG   L  +  I+ +KGD G
Sbjct:  411 YVGAP-GPQGLNGVDGLPGPQGYNGQKGG------------------------AGLPGRPGNEGP------PGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKG 657          

HSP 28 Score: 54.299 bits (129), Expect = 1.101e-6
Identity = 55/147 (37.41%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  809 LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG---IPGSKGSQGGTGPQGIIGNAGATGR------------PGLDGMIGIQGVKGDSGPQGL 1204
            +  +G  G  GP G  G+ G +GFPG +G +G  G  G  GP G +GD+G +G  G  G  G PG+ G  G+ G PG  G+ G +G   IPG +G  G  GP+G  G  G+ G              G  G  G +G  G +GPQG 
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGF 231          

HSP 29 Score: 53.9138 bits (128), Expect = 1.609e-6
Identity = 51/127 (40.16%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGL------DGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------GETGMNGTPGRDGRPGVAGMRGDTGQPGP--RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNT 2893
            +DG  G  G  G+PG P L      +   G++G PG  G  G +G +G  G+PGIP         GE G++G PG DG PG AG  G  G PG   +G  G  G  GA G  G  G+ G+KG+PG+ 
Sbjct:  625 EDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC 751          

HSP 30 Score: 53.5286 bits (127), Expect = 1.937e-6
Identity = 53/136 (38.97%), Postives = 70/136 (51.47%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIG---------------KPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G+ GP+G  G  GL+GF G +G        G+RG QG  G+PG+ G+ G  G PG +G  G  G  G+ G  GP+G  G +G+ G PG  G+ G               + G KG+PG  G +GL G QG  G
Sbjct: 1369 GLKGDTGPQGFKGERGLNGFEGQKG------DKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERG 1498          

HSP 31 Score: 53.5286 bits (127), Expect = 2.072e-6
Identity = 51/129 (39.53%), Postives = 68/129 (52.71%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPG------PRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G+ G  G+ G PG+ G  GN G PG++G+DG  G  G      IPG  G++G PG  G  G  G +G+ G+P        +G  G  G  G  GL G  G PG+KG+ G++GP G  G +G  G
Sbjct:  132 DKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDG------IPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHG 254          

HSP 32 Score: 51.9878 bits (123), Expect = 4.774e-6
Identity = 59/155 (38.06%), Postives = 74/155 (47.74%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP------GIPGETGMNGTPGRDGRPG---------------VAGMRGDT------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG+ G  G +G+PG+PGL G PGN+G  G  G DG +G  G  G P      GIPG +G  G  G  G  G               + G++GD             G PG +G  G  G  G PGL GD  + GQKG+PG +G +G TG  G  G
Sbjct:  931 DGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPG 1085          
BLAST of Fibrillar collagen vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 64.6994 bits (156), Expect = 7.470e-10
Identity = 81/211 (38.39%), Postives = 103/211 (48.82%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXE------------LGAAGPIGLPGIRGDLGSQGPIGSH-----GPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGI 1168
            GR GR+GA G    T K  L+G  G  G+ G +G +G+ G KG  G P         GE             GA G  G  G+RG++G +GP G       G +G PG  G  G  GA G+ G  G PG+ G  G KG RG+ G++  +G  G PG  G  G  GD GAPG++G  G PG KG +G  GP G +G  G  G  G  G   +
Sbjct:  665 GRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLV 875          

HSP 2 Score: 64.6994 bits (156), Expect = 7.791e-10
Identity = 79/209 (37.80%), Postives = 104/209 (49.76%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADG--ITGVSGMPGVIGPTG---TKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +G  G +G  G+ GL G   P    GP+GP G++G  G  G  G +G       +G  GP G+ G++G+ G  G  G  GP G PG  G++G  G DG  I   S   G IG TG    +GD G  G+KG +G DG+ G  G+ G  GD G  G  G +G PG  G  G  G           G PG DG+ G +G  GD+G +G+ 
Sbjct:  507 GDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGA------IGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVK 709          

HSP 3 Score: 64.3142 bits (155), Expect = 8.694e-10
Identity = 50/113 (44.25%), Postives = 70/113 (61.95%), Query Frame = 2
Query: 2573 LDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLT 2911
            LDG  G +G+ G+PG +G PG  G+    G+ G+RG  G+ G PG PG  G+ G PGR+G   + G++G TG PGP+GP GP+G +G  GL       G+ G+ G+ GP+GL 
Sbjct: 1056 LDGVAGRKGEVGSPGPNGLPGRHGL---KGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNG---INGLKGATGFPGPQGPKGPQGESGVVGL------DGRNGQIGDQGPRGLI 1156          

HSP 4 Score: 63.929 bits (154), Expect = 1.371e-9
Identity = 105/302 (34.77%), Postives = 133/302 (44.04%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPG---IRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPG----------------------------------APGEHGSNGIPGSKGSQGGTGPQGII---------GNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP GL G DGP+G PG    NGL G +G+ G  G PG  G  G    +G  G  G +G  GP G  G PG  G +GP G + P                   G  G  GE+G+ GP GLPG   ++G  G +G  G  G  GEPG  G  G+PG +GI G+ G  G  GP         QG KG +G  G  G+DG++G +GD G                                    G  G  G+ G +G QG  GP G I         G+ G  G+ G DG  G++G +GD GP+G
Sbjct:  975 GPKGLSGDDGPDGYPGA---NGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQP----------------ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGP---------QGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG 1248          

HSP 5 Score: 63.5438 bits (153), Expect = 1.750e-9
Identity = 81/219 (36.99%), Postives = 97/219 (44.29%), Query Frame = 2
Query:  599 RNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGID---GKDGSVGDPGAPGEHGS------NGIPGSKGSQGGTGPQGIIGNAGATG--------RPGLDGMIGIQGVKGDSGPQGL 1204
            RNG   P G  G+ G +GS G  G NG                              A G IG  G RG LG+ G  G  G  G PG+ G IG  G  G  G +G  G IGP G  G+ G +G  G +G DG PG +   G+ G  G+PG PG  G+      +GI G  G  G TGP G  G  GA G        +P LDG+ G +G  G  GP GL
Sbjct:  886 RNGRQAPHGAKGQKGEVGSLGQNGQNG------------------------------AKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGL 1074          

HSP 6 Score: 62.003 bits (149), Expect = 4.772e-9
Identity = 81/221 (36.65%), Postives = 100/221 (45.25%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS--------HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGS------------VGDPGA---PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +G TG PG  G++G  G+ GP+G  G QG  G AG              G  GP G+PG  G +G+ GP G          G  G+ G  G  G  G DG  G  G  G  G  G  G RG  G  G +G DG PG DG+DG+            +G+PG     GE G +G  G KG +G   P  I  N G  G  G  G  G++G KG+ G  GL 
Sbjct:  540 GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAG------------HKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLR 748          

HSP 7 Score: 61.6178 bits (148), Expect = 6.409e-9
Identity = 94/266 (35.34%), Postives = 118/266 (44.36%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGI------TGVSGMPG------VIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP-----------------------------------GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG------------LDGMIGIQGVKGDSGPQGL 1204
            +G++G+NGA G  G +G+ GL+G+ G QG+ G  G  G                 G IGE+G  G IG  G +GD+G +GP G  GP+G  G  G  G+PGA+G+      TG  G PG      V   +G KGD G  G  G  G  GAPG  G+ G VGD                                    G PG+ G  G PG+KG  G  G  GI G  GATG PG            + G+ G  G  GD GP+GL
Sbjct:  905 LGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPG---------------LPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL 1155          

HSP 8 Score: 60.8474 bits (146), Expect = 1.045e-8
Identity = 80/205 (39.02%), Postives = 96/205 (46.83%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITG------VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAP---GEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GPQG  G PG  G  G  G+ GPKG  G+ G +G+ G  G          +G  G IG  G +G+ G  G  G  G  G PG  GR+G PG  G TG      + GM G++GP G  G           G  G PG+DG  G  GD GAP   G  G  G  G +G QG  G  G  G  G  G  G  G+ G  G++G  GPQG
Sbjct: 1306 GPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAI-------VGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 9 Score: 57.7658 bits (138), Expect = 1.088e-7
Identity = 56/134 (41.79%), Postives = 67/134 (50.00%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGD--------QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKG--------KPGNTGPKGLTGNQGITG 2932
            G+VG  G PG+ G  G  G +G  G  GR GERG+        QG +G  G  GE G +G  G  G PG+ G  G  G PGPRGP G  G  G  G+ G +G  GQ G        +PG+ G  GL G QG  G
Sbjct: 1309 GDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEG 1442          

HSP 10 Score: 56.9954 bits (136), Expect = 1.449e-7
Identity = 51/120 (42.50%), Postives = 66/120 (55.00%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  GN GL G PG+ G+PG+ G  GE G++G++G  G  G+ G  G  G  G  G++G  G  G PG  G  G +G TG PG     G+PG KG    +G KG  G  G+TGP+
Sbjct:  918 GFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFP---GRPGAKGVAAYSGIKGDDGESGLTGPI 1034          

HSP 11 Score: 56.6102 bits (135), Expect = 2.047e-7
Identity = 83/234 (35.47%), Postives = 104/234 (44.44%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPG---VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG--GE------GVDGAPGIDGKDGSVGDPGAPGE------------HGSNGIPGSKGSQGGTGP------QGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GR G +G+ G +G TG+ G  G  G QG +G  G +G  G  G               ++   G  G  GI+G+ G  G  G  G +GEP    +    G PG DG TG  G+ G  G  G  G RG  G +G  GE      G  G PG  G  G  G PG PG              G  G+PG +  QG  GP      +G  G+ GA G+ GL G  G +GVKG+ GP G
Sbjct:  632 GRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTP---------KVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDG 856          

HSP 12 Score: 56.225 bits (134), Expect = 2.485e-7
Identity = 106/262 (40.46%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGP---KGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG-----SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRG--IQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG--TGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            GP G  G  G +GR G    +GP GL G QG+ G+ G  G +G  G         RS   G  G QG  G+ G  G  GP G  GP G  GE+            G  G  G+LG  G  GL G +GD G +GP G       G EG  G+ GR G PG  G  G  G PG  GP G  G RG  IQG  G +G  G PG  G +G  G  G  GE G  G  G +G  G    G QG IG+ G  G PG DG  G QG  G
Sbjct: 1130 GPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENL--RDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGER------------GDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPG 1377          

HSP 13 Score: 56.225 bits (134), Expect = 2.614e-7
Identity = 51/124 (41.13%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2576 DGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGST-----GAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  GP+G  G+ G DG+PG  G+PG   R GE G+ G  G PG  G    +G  G DG  G+ G  G  G PG +G  GP G +     G  G  G++G PG  G PG  G KG  G++G+ G
Sbjct:  971 NGEFGPKGLSGDDGPDGYPGANGLPG---RKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPG 1091          

HSP 14 Score: 55.8398 bits (133), Expect = 3.631e-7
Identity = 56/131 (42.75%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI--PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA--------PGLMGDI---GKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +GP G  G  G  G+ G  G  G  G  G +GDQG  G PGI  P E G  G  G DGR G  G  G  G PGP G  GP G+ G         PG  GD+   G PG  G+ G  GPKG  G+ G  G
Sbjct: 1209 GFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQG 1339          

HSP 15 Score: 55.4546 bits (132), Expect = 4.877e-7
Identity = 60/155 (38.71%), Postives = 72/155 (46.45%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKP---------GNPGLDGFPGNQGVPGVSGRDGERGDQGKLG--------------VPGIPGETGMNG------TPGRDGRPGV------AGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            DDG  G  G +G+P         G PG DG+ G +GV G  G  G  G +G++G                G PG TG  G       PGRDG PG+       G RG  GQ   +G  GP G +G  G  GD+G PGQ G  G  GPKG+ G QG
Sbjct:  699 DDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQG 853          

HSP 16 Score: 55.0694 bits (131), Expect = 6.123e-7
Identity = 61/152 (40.13%), Postives = 75/152 (49.34%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPE--GEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG--------------VDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
            G  G  G PG  G+ G  G IG  GP+  G PG  G +GFPGA G  G  G+   IGP G  GD G QG++G  G                G PG DG  G  G PG PG++G  G P         GP+G  G+AG  G  G+DG++G +G
Sbjct: 1274 GHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGL---IGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAP---------GPRGPTGDAGWGGIDGMDGLVGPKG 1413          

HSP 17 Score: 54.6842 bits (130), Expect = 7.432e-7
Identity = 58/138 (42.03%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE--------RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQK---------GKPGNTGPKGLTGNQGITG 2932
            GL GN G  G  G PG  G PG  G  G +G DG+        +G+ G  G  G  G+TG +G  GRDG  G  G RG+TGQ G  G AG +G  G PG  G  G PG+          G+PG  G KG  G+ G TG
Sbjct:  567 GLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTG 704          

HSP 18 Score: 54.299 bits (129), Expect = 1.068e-6
Identity = 50/109 (45.87%), Postives = 57/109 (52.29%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPG---IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            GP G  G PG  G  G QG PG+ GRDGE G  G +G  G   +PG+  + G  G  GR G+ G  GD G PG  G AG  G  G  G  G  G  GQ G PGN G +G
Sbjct:  763 GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG 871          

HSP 19 Score: 54.299 bits (129), Expect = 1.232e-6
Identity = 62/152 (40.79%), Postives = 71/152 (46.71%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPG------NPGLDGFPGNQGVP---GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN------------------QGITGPM 2938
            DDG DG  G  G PG      NPG  G PG +GV    G+ G DGE G  G +G PG PG  G  G  G D +P + G+ G  G+ G  GP G  G  G  G  GD G PGQ+G+PG  G KGL G                   QG  GP 
Sbjct:  982 DDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVG-DSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQ 1132          

HSP 20 Score: 53.9138 bits (128), Expect = 1.264e-6
Identity = 90/237 (37.97%), Postives = 108/237 (45.57%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGM-----NGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP------------GIDGKDGSVGDPGAPGEHGSNG--------------IPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GR+G  G  GP G  G+PG +G+ GP G      +  KG  G+ G  G  G  G  G KG  G  G+ G  G  G RGD G     G  G +GEPG  GR G PG +  T    + G  G  G KG+RG  G  G +GV G P            G DG  G  G  GA GE G+ G              IPG  G++G  GP G  G  GA G PG DG  G+ G  G  G +G+
Sbjct:  573 GRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGD---AGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGV 806          

HSP 21 Score: 53.5286 bits (127), Expect = 1.770e-6
Identity = 79/222 (35.59%), Postives = 102/222 (45.95%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGP---IGSHGPEGEPGVGGRIGFPG-ADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGP-----------QGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GR G  GA G  G  G+ G+ G +G  G  GP+GP G Q                     G +G +GL G  G +G QGP   IG  G +GE G  G +G PG  + +   S   G  G  G +G+RG QG  G  G  G PG  G+ G +G  G  G  G+ G+ G +G QG  GP           +G+ G  G  GRPG  G  G  G  G++GP G
Sbjct: 1092 QQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQ---------------------GESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNG 1292          

HSP 22 Score: 53.1434 bits (126), Expect = 2.378e-6
Identity = 45/109 (41.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGF--PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPG 2887
            DG+DG VGP+G+PG         PG++G PG+ G  GE GD G  G+ G  G+ G              G RGD G+ G  G  GP+G  G  G MG  G PG +G PG
Sbjct: 1403 DGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG------------AVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG 1499          

HSP 23 Score: 52.7582 bits (125), Expect = 3.248e-6
Identity = 58/152 (38.16%), Postives = 65/152 (42.76%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQ---------GVPGVSGRDGERGDQGKLGVPGIPGE------------------TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPA--GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  G +G+PG  G DG PG           G PG  G  GERGD G  G  G+ GE                  TG  G  G  G  G  G+RG+ G  GP G    GP G+ G PG  GD G+ G  G PG  G  GL G  G  G
Sbjct:  651 DYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKG 802          

HSP 24 Score: 51.9878 bits (123), Expect = 5.206e-6
Identity = 60/159 (37.74%), Postives = 74/159 (46.54%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKL---------------------------GVPGIPGETGMNGTPGRDGRPGVA---GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK--------PGQKGKPGNTGPKGLTGNQGITG 2932
            GL GN G +G PG+PG+ G PG  G  G  G  G  G QG +                           G+PG  GETG  G PGR G  GVA   G++GD G+ G  GP G  G+ GA G  G +G          G+KG+ G+ GP GL G  G+ G
Sbjct:  924 GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG 1082          

HSP 25 Score: 51.2174 bits (121), Expect = 9.630e-6
Identity = 47/131 (35.88%), Postives = 66/131 (50.38%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGD------IGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G  G+ G  G  G  G DG  G++G  G +G+ G+ GD G  G  G PG  G +G PGR+       + G+ G  G +G  G +G TG  G+ G+          G+ G+ G TGPKG+ G +G  G +
Sbjct:  615 DTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAI 745          
BLAST of Fibrillar collagen vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 64.6994 bits (156), Expect = 7.470e-10
Identity = 81/211 (38.39%), Postives = 103/211 (48.82%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXE------------LGAAGPIGLPGIRGDLGSQGPIGSH-----GPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGI 1168
            GR GR+GA G    T K  L+G  G  G+ G +G +G+ G KG  G P         GE             GA G  G  G+RG++G +GP G       G +G PG  G  G  GA G+ G  G PG+ G  G KG RG+ G++  +G  G PG  G  G  GD GAPG++G  G PG KG +G  GP G +G  G  G  G  G   +
Sbjct:  665 GRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLV 875          

HSP 2 Score: 64.6994 bits (156), Expect = 7.791e-10
Identity = 79/209 (37.80%), Postives = 104/209 (49.76%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADG--ITGVSGMPGVIGPTG---TKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +G  G +G  G+ GL G   P    GP+GP G++G  G  G  G +G       +G  GP G+ G++G+ G  G  G  GP G PG  G++G  G DG  I   S   G IG TG    +GD G  G+KG +G DG+ G  G+ G  GD G  G  G +G PG  G  G  G           G PG DG+ G +G  GD+G +G+ 
Sbjct:  507 GDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGA------IGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVK 709          

HSP 3 Score: 64.3142 bits (155), Expect = 8.694e-10
Identity = 50/113 (44.25%), Postives = 70/113 (61.95%), Query Frame = 2
Query: 2573 LDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLT 2911
            LDG  G +G+ G+PG +G PG  G+    G+ G+RG  G+ G PG PG  G+ G PGR+G   + G++G TG PGP+GP GP+G +G  GL       G+ G+ G+ GP+GL 
Sbjct: 1056 LDGVAGRKGEVGSPGPNGLPGRHGL---KGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNG---INGLKGATGFPGPQGPKGPQGESGVVGL------DGRNGQIGDQGPRGLI 1156          

HSP 4 Score: 63.929 bits (154), Expect = 1.371e-9
Identity = 105/302 (34.77%), Postives = 133/302 (44.04%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPG---IRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPG----------------------------------APGEHGSNGIPGSKGSQGGTGPQGII---------GNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP GL G DGP+G PG    NGL G +G+ G  G PG  G  G    +G  G  G +G  GP G  G PG  G +GP G + P                   G  G  GE+G+ GP GLPG   ++G  G +G  G  G  GEPG  G  G+PG +GI G+ G  G  GP         QG KG +G  G  G+DG++G +GD G                                    G  G  G+ G +G QG  GP G I         G+ G  G+ G DG  G++G +GD GP+G
Sbjct:  975 GPKGLSGDDGPDGYPGA---NGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQP----------------ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGP---------QGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG 1248          

HSP 5 Score: 63.5438 bits (153), Expect = 1.750e-9
Identity = 81/219 (36.99%), Postives = 97/219 (44.29%), Query Frame = 2
Query:  599 RNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGID---GKDGSVGDPGAPGEHGS------NGIPGSKGSQGGTGPQGIIGNAGATG--------RPGLDGMIGIQGVKGDSGPQGL 1204
            RNG   P G  G+ G +GS G  G NG                              A G IG  G RG LG+ G  G  G  G PG+ G IG  G  G  G +G  G IGP G  G+ G +G  G +G DG PG +   G+ G  G+PG PG  G+      +GI G  G  G TGP G  G  GA G        +P LDG+ G +G  G  GP GL
Sbjct:  886 RNGRQAPHGAKGQKGEVGSLGQNGQNG------------------------------AKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGL 1074          

HSP 6 Score: 62.003 bits (149), Expect = 4.772e-9
Identity = 81/221 (36.65%), Postives = 100/221 (45.25%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS--------HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGS------------VGDPGA---PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +G TG PG  G++G  G+ GP+G  G QG  G AG              G  GP G+PG  G +G+ GP G          G  G+ G  G  G  G DG  G  G  G  G  G  G RG  G  G +G DG PG DG+DG+            +G+PG     GE G +G  G KG +G   P  I  N G  G  G  G  G++G KG+ G  GL 
Sbjct:  540 GQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAG------------HKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLR 748          

HSP 7 Score: 61.6178 bits (148), Expect = 6.409e-9
Identity = 94/266 (35.34%), Postives = 118/266 (44.36%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGI------TGVSGMPG------VIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP-----------------------------------GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG------------LDGMIGIQGVKGDSGPQGL 1204
            +G++G+NGA G  G +G+ GL+G+ G QG+ G  G  G                 G IGE+G  G IG  G +GD+G +GP G  GP+G  G  G  G+PGA+G+      TG  G PG      V   +G KGD G  G  G  G  GAPG  G+ G VGD                                    G PG+ G  G PG+KG  G  G  GI G  GATG PG            + G+ G  G  GD GP+GL
Sbjct:  905 LGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPG---------------LPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL 1155          

HSP 8 Score: 60.8474 bits (146), Expect = 1.045e-8
Identity = 80/205 (39.02%), Postives = 96/205 (46.83%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITG------VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAP---GEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GPQG  G PG  G  G  G+ GPKG  G+ G +G+ G  G          +G  G IG  G +G+ G  G  G  G  G PG  GR+G PG  G TG      + GM G++GP G  G           G  G PG+DG  G  GD GAP   G  G  G  G +G QG  G  G  G  G  G  G  G+ G  G++G  GPQG
Sbjct: 1306 GPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAI-------VGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 9 Score: 57.7658 bits (138), Expect = 1.088e-7
Identity = 56/134 (41.79%), Postives = 67/134 (50.00%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGD--------QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKG--------KPGNTGPKGLTGNQGITG 2932
            G+VG  G PG+ G  G  G +G  G  GR GERG+        QG +G  G  GE G +G  G  G PG+ G  G  G PGPRGP G  G  G  G+ G +G  GQ G        +PG+ G  GL G QG  G
Sbjct: 1309 GDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEG 1442          

HSP 10 Score: 56.9954 bits (136), Expect = 1.449e-7
Identity = 51/120 (42.50%), Postives = 66/120 (55.00%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  GN GL G PG+ G+PG+ G  GE G++G++G  G  G+ G  G  G  G  G++G  G  G PG  G  G +G TG PG     G+PG KG    +G KG  G  G+TGP+
Sbjct:  918 GFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFP---GRPGAKGVAAYSGIKGDDGESGLTGPI 1034          

HSP 11 Score: 56.6102 bits (135), Expect = 2.047e-7
Identity = 83/234 (35.47%), Postives = 104/234 (44.44%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPG---VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG--GE------GVDGAPGIDGKDGSVGDPGAPGE------------HGSNGIPGSKGSQGGTGP------QGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GR G +G+ G +G TG+ G  G  G QG +G  G +G  G  G               ++   G  G  GI+G+ G  G  G  G +GEP    +    G PG DG TG  G+ G  G  G  G RG  G +G  GE      G  G PG  G  G  G PG PG              G  G+PG +  QG  GP      +G  G+ GA G+ GL G  G +GVKG+ GP G
Sbjct:  632 GRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTP---------KVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDG 856          

HSP 12 Score: 56.225 bits (134), Expect = 2.485e-7
Identity = 106/262 (40.46%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGP---KGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG-----SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRG--IQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG--TGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            GP G  G  G +GR G    +GP GL G QG+ G+ G  G +G  G         RS   G  G QG  G+ G  G  GP G  GP G  GE+            G  G  G+LG  G  GL G +GD G +GP G       G EG  G+ GR G PG  G  G  G PG  GP G  G RG  IQG  G +G  G PG  G +G  G  G  GE G  G  G +G  G    G QG IG+ G  G PG DG  G QG  G
Sbjct: 1130 GPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENL--RDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGER------------GDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPG 1377          

HSP 13 Score: 56.225 bits (134), Expect = 2.614e-7
Identity = 51/124 (41.13%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2576 DGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGST-----GAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  GP+G  G+ G DG+PG  G+PG   R GE G+ G  G PG  G    +G  G DG  G+ G  G  G PG +G  GP G +     G  G  G++G PG  G PG  G KG  G++G+ G
Sbjct:  971 NGEFGPKGLSGDDGPDGYPGANGLPG---RKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPG 1091          

HSP 14 Score: 55.8398 bits (133), Expect = 3.631e-7
Identity = 56/131 (42.75%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI--PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA--------PGLMGDI---GKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +GP G  G  G  G+ G  G  G  G  G +GDQG  G PGI  P E G  G  G DGR G  G  G  G PGP G  GP G+ G         PG  GD+   G PG  G+ G  GPKG  G+ G  G
Sbjct: 1209 GFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQG 1339          

HSP 15 Score: 55.4546 bits (132), Expect = 4.877e-7
Identity = 60/155 (38.71%), Postives = 72/155 (46.45%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKP---------GNPGLDGFPGNQGVPGVSGRDGERGDQGKLG--------------VPGIPGETGMNG------TPGRDGRPGV------AGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            DDG  G  G +G+P         G PG DG+ G +GV G  G  G  G +G++G                G PG TG  G       PGRDG PG+       G RG  GQ   +G  GP G +G  G  GD+G PGQ G  G  GPKG+ G QG
Sbjct:  699 DDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQG 853          

HSP 16 Score: 55.0694 bits (131), Expect = 6.123e-7
Identity = 61/152 (40.13%), Postives = 75/152 (49.34%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPE--GEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG--------------VDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
            G  G  G PG  G+ G  G IG  GP+  G PG  G +GFPGA G  G  G+   IGP G  GD G QG++G  G                G PG DG  G  G PG PG++G  G P         GP+G  G+AG  G  G+DG++G +G
Sbjct: 1274 GHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGL---IGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAP---------GPRGPTGDAGWGGIDGMDGLVGPKG 1413          

HSP 17 Score: 54.6842 bits (130), Expect = 7.432e-7
Identity = 58/138 (42.03%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE--------RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQK---------GKPGNTGPKGLTGNQGITG 2932
            GL GN G  G  G PG  G PG  G  G +G DG+        +G+ G  G  G  G+TG +G  GRDG  G  G RG+TGQ G  G AG +G  G PG  G  G PG+          G+PG  G KG  G+ G TG
Sbjct:  567 GLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTG 704          

HSP 18 Score: 54.299 bits (129), Expect = 1.068e-6
Identity = 50/109 (45.87%), Postives = 57/109 (52.29%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPG---IPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            GP G  G PG  G  G QG PG+ GRDGE G  G +G  G   +PG+  + G  G  GR G+ G  GD G PG  G AG  G  G  G  G  G  GQ G PGN G +G
Sbjct:  763 GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG 871          

HSP 19 Score: 54.299 bits (129), Expect = 1.232e-6
Identity = 62/152 (40.79%), Postives = 71/152 (46.71%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPG------NPGLDGFPGNQGVP---GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN------------------QGITGPM 2938
            DDG DG  G  G PG      NPG  G PG +GV    G+ G DGE G  G +G PG PG  G  G  G D +P + G+ G  G+ G  GP G  G  G  G  GD G PGQ+G+PG  G KGL G                   QG  GP 
Sbjct:  982 DDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVG-DSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQ 1132          

HSP 20 Score: 53.9138 bits (128), Expect = 1.264e-6
Identity = 90/237 (37.97%), Postives = 108/237 (45.57%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGM-----NGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP------------GIDGKDGSVGDPGAPGEHGSNG--------------IPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GR+G  G  GP G  G+PG +G+ GP G      +  KG  G+ G  G  G  G  G KG  G  G+ G  G  G RGD G     G  G +GEPG  GR G PG +  T    + G  G  G KG+RG  G  G +GV G P            G DG  G  G  GA GE G+ G              IPG  G++G  GP G  G  GA G PG DG  G+ G  G  G +G+
Sbjct:  573 GRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGD---AGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGV 806          

HSP 21 Score: 53.5286 bits (127), Expect = 1.770e-6
Identity = 79/222 (35.59%), Postives = 102/222 (45.95%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGP---IGSHGPEGEPGVGGRIGFPG-ADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGP-----------QGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GR G  GA G  G  G+ G+ G +G  G  GP+GP G Q                     G +G +GL G  G +G QGP   IG  G +GE G  G +G PG  + +   S   G  G  G +G+RG QG  G  G  G PG  G+ G +G  G  G  G+ G+ G +G QG  GP           +G+ G  G  GRPG  G  G  G  G++GP G
Sbjct: 1092 QQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQ---------------------GESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNG 1292          

HSP 22 Score: 53.1434 bits (126), Expect = 2.378e-6
Identity = 45/109 (41.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGF--PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPG 2887
            DG+DG VGP+G+PG         PG++G PG+ G  GE GD G  G+ G  G+ G              G RGD G+ G  G  GP+G  G  G MG  G PG +G PG
Sbjct: 1403 DGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG------------AVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG 1499          

HSP 23 Score: 52.7582 bits (125), Expect = 3.248e-6
Identity = 58/152 (38.16%), Postives = 65/152 (42.76%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQ---------GVPGVSGRDGERGDQGKLGVPGIPGE------------------TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPA--GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  G +G+PG  G DG PG           G PG  G  GERGD G  G  G+ GE                  TG  G  G  G  G  G+RG+ G  GP G    GP G+ G PG  GD G+ G  G PG  G  GL G  G  G
Sbjct:  651 DYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKG 802          

HSP 24 Score: 51.9878 bits (123), Expect = 5.206e-6
Identity = 60/159 (37.74%), Postives = 74/159 (46.54%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKL---------------------------GVPGIPGETGMNGTPGRDGRPGVA---GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK--------PGQKGKPGNTGPKGLTGNQGITG 2932
            GL GN G +G PG+PG+ G PG  G  G  G  G  G QG +                           G+PG  GETG  G PGR G  GVA   G++GD G+ G  GP G  G+ GA G  G +G          G+KG+ G+ GP GL G  G+ G
Sbjct:  924 GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG 1082          

HSP 25 Score: 51.2174 bits (121), Expect = 9.630e-6
Identity = 47/131 (35.88%), Postives = 66/131 (50.38%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGD------IGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            D G  G+ G  G  G  G DG  G++G  G +G+ G+ GD G  G  G PG  G +G PGR+       + G+ G  G +G  G +G TG  G+ G+          G+ G+ G TGPKG+ G +G  G +
Sbjct:  615 DTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAI 745          
BLAST of Fibrillar collagen vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 139.428 bits (350), Expect = 1.316e-32
Identity = 80/256 (31.25%), Postives = 130/256 (50.78%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA-------------NILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYV-------IDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEKTE---YPAIIFT-DNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D+A+++             +I G  + I  P G++  PARSC  LK      K G Y++DPN G   DA +VFC METGETC+ P      + ++  S++   K++ +GE ++G   F Y            QL FL+++ST A Q I   C N++A +++       AI+    N+ E+  + +   +Y V++D C+  + + A+TV+   +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1168 DPLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDI---APMDIGGADQEFGVDIGAVCF 1420          

HSP 2 Score: 58.9214 bits (141), Expect = 5.292e-8
Identity = 90/217 (41.47%), Postives = 105/217 (48.39%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGK---PGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG---TGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            G  GA GP GP G+   PG  G  GPQG+ GP+G         P G  GP G AG  G  G +G  GE GA G  G  G RGD G +GP G+ G +G  G+       G  G  GA G TG  G  G  G  G  GDRG  G  G  G  G PG DG+ G+ G+ G  G+ G +G PG +G  G     GP G+ G  GA G  G  G  G  G  G
Sbjct:  621 GEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAG 837          

HSP 3 Score: 58.5362 bits (140), Expect = 7.111e-8
Identity = 57/123 (46.34%), Postives = 70/123 (56.91%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  GN G  G+ G  G  G PG++GVPG+SG  G  GD G+ G PG+PG  G+ G PG  G  G  G  G  G+ G  GP GP G+ G PG+MG  G  G  G+PG  G KGL G  G+ G
Sbjct:  442 ERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRG 564          

HSP 4 Score: 57.7658 bits (138), Expect = 1.200e-7
Identity = 53/131 (40.46%), Postives = 64/131 (48.85%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP------------------------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G+SG  G+RGD G+ G  G P                        GETG  G+ G  G  G  G RG+ G PGP G AGP G+ G PG  G+ G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  682 LQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPT 812          

HSP 5 Score: 57.7658 bits (138), Expect = 1.374e-7
Identity = 52/112 (46.43%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG+ GFPG +G  G  G+ GE+G  G+ G+ G+PG+ G  G  G  G  G  G RG+ GQPGP   +G  GP G+ G PG  GD G PG+ G  G TGP+G  G  G  G
Sbjct:  531 GQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERG 642          

HSP 6 Score: 56.6102 bits (135), Expect = 2.722e-7
Identity = 102/274 (37.23%), Postives = 117/274 (42.70%), Query Frame = 2
Query:  794 GIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPG------------SKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G RG+ GS GP+G   P GE G  G  GFPG DG+ G  G PG  G  G  G +G  G  G  G  G PG  G  G  GD GA G+ G+ G PG            ++G  G  G  G  G  G  G+PG  G++G  G++G  G  G  G SG  G VG  G  G  G PG                                      G  GLPG  GA G+PG  G    QG+ G  G  G  GP G  G PG     GPQG  GPRGL G
Sbjct:  426 GPRGEPGSAGPLG---PPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPG------------------------------------PSGFQGLPGPTGAPGEPGKPG---DQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPG 657          

HSP 7 Score: 54.299 bits (129), Expect = 1.485e-6
Identity = 56/129 (43.41%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  815 SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GP+G  G  G+PG+ G  G  G  G  GV G  G  GP+G +G RG +G+ G  G  G PG  G  G+ G PG  G  G+ G PG +G  G +GP+G  G+ G  G PGL G  G+ G  GD+G QG
Sbjct:  379 ATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQG 507          

HSP 8 Score: 53.5286 bits (127), Expect = 2.637e-6
Identity = 56/138 (40.58%), Postives = 63/138 (45.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGF---------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G  G                 G  G  G  G  G RG  G  G  G PG  G  G PG DG+PG  G +G++GQ G  G  GP+G +GAPG +G  G  G KG  G  G  G TG  G  G
Sbjct:  700 DRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAG 837          

HSP 9 Score: 52.7582 bits (125), Expect = 4.338e-6
Identity = 120/267 (44.94%), Postives = 135/267 (50.56%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
              G R  AGP GLQGP G  G PG  GP G  GP G  G  G PG  G  G +G  G  G  G  G  G +GP G PG  GS         +G  G  GP G +GP G KG  GPIG +GA G  G PG RG++G+ GP G  GP         +GE G  G+ G  GA G  G SG PG +GPTG    KG RG QG  G  G  GA G  G  G  G+PGA G  G +G  G KG +G  GP G  G+AG  G PG  G  G  G
Sbjct:  637 FPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGS---------RGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGDAGLRGPPGAPGEKGEAG 894          

HSP 10 Score: 52.373 bits (124), Expect = 4.720e-6
Identity = 62/159 (38.99%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSG------------------RDGERGDQGKLGVPGIPGETGMNGTPGRDG---------RPGVAGMRGDTGQPGPRGPAGPEGSTGAP---------GLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G+ GP G  GNPG DG PG +G  G SG                    G  G +G+ G PGIPG  G  G  G  G           G  G RG  G+PG  GP GP G  GAP         GL G  G PG +G PG +GPKG TG+ G  G
Sbjct:  328 EAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPG 486          
BLAST of Fibrillar collagen vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 136.732 bits (343), Expect = 9.758e-32
Identity = 80/256 (31.25%), Postives = 130/256 (50.78%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA-------------NILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYV-------IDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEKTE---YPAIIFT-DNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D+A+++             +I G  + I  P G++  PARSC  LK      K G Y++DPN G   DA +VFC METGETC+ P      + ++  S++   K++ +GE ++G   F Y            QL FL+++ST A Q I   C N++A +++       AI+    N+ E+  + +   +Y V++D C+  + + A+TV+   +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1238 DPLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDI---APMDIGGADQEFGVDIGAVCF 1490          

HSP 2 Score: 59.3066 bits (142), Expect = 4.667e-8
Identity = 90/217 (41.47%), Postives = 105/217 (48.39%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGK---PGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG---TGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            G  GA GP GP G+   PG  G  GPQG+ GP+G         P G  GP G AG  G  G +G  GE GA G  G  G RGD G +GP G+ G +G  G+       G  G  GA G TG  G  G  G  G  GDRG  G  G  G  G PG DG+ G+ G+ G  G+ G +G PG +G  G     GP G+ G  GA G  G  G  G  G  G
Sbjct:  691 GEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGLQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAG 907          

HSP 3 Score: 58.5362 bits (140), Expect = 6.486e-8
Identity = 57/123 (46.34%), Postives = 70/123 (56.91%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  GN G  G+ G  G  G PG++GVPG+SG  G  GD G+ G PG+PG  G+ G PG  G  G  G  G  G+ G  GP GP G+ G PG+MG  G  G  G+PG  G KGL G  G+ G
Sbjct:  512 ERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRG 634          

HSP 4 Score: 57.7658 bits (138), Expect = 1.104e-7
Identity = 53/131 (40.46%), Postives = 64/131 (48.85%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP------------------------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G+SG  G+RGD G+ G  G P                        GETG  G+ G  G  G  G RG+ G PGP G AGP G+ G PG  G+ G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  752 LQGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPT 882          

HSP 5 Score: 57.7658 bits (138), Expect = 1.232e-7
Identity = 52/112 (46.43%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG+ GFPG +G  G  G+ GE+G  G+ G+ G+PG+ G  G  G  G  G  G RG+ GQPGP   +G  GP G+ G PG  GD G PG+ G  G TGP+G  G  G  G
Sbjct:  601 GQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERG 712          

HSP 6 Score: 56.6102 bits (135), Expect = 2.746e-7
Identity = 102/274 (37.23%), Postives = 117/274 (42.70%), Query Frame = 2
Query:  794 GIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPG------------SKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G RG+ GS GP+G   P GE G  G  GFPG DG+ G  G PG  G  G  G +G  G  G  G  G PG  G  G  GD GA G+ G+ G PG            ++G  G  G  G  G  G  G+PG  G++G  G++G  G  G  G SG  G VG  G  G  G PG                                      G  GLPG  GA G+PG  G    QG+ G  G  G  GP G  G PG     GPQG  GPRGL G
Sbjct:  496 GPRGEPGSAGPLG---PPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPG------------------------------------PSGFQGLPGPTGAPGEPGKPG---DQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPG 727          

HSP 7 Score: 54.299 bits (129), Expect = 1.436e-6
Identity = 56/129 (43.41%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  815 SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GP+G  G  G+PG+ G  G  G  G  GV G  G  GP+G +G RG +G+ G  G  G PG  G  G+ G PG  G  G+ G PG +G  G +GP+G  G+ G  G PGL G  G+ G  GD+G QG
Sbjct:  449 ATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQG 577          

HSP 8 Score: 53.5286 bits (127), Expect = 2.464e-6
Identity = 56/138 (40.58%), Postives = 63/138 (45.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGF---------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G  G                 G  G  G  G  G RG  G  G  G PG  G  G PG DG+PG  G +G++GQ G  G  GP+G +GAPG +G  G  G KG  G  G  G TG  G  G
Sbjct:  770 DRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAG 907          

HSP 9 Score: 53.5286 bits (127), Expect = 2.636e-6
Identity = 118/270 (43.70%), Postives = 134/270 (49.63%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGM---NGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
              G R  AGP GLQGP G  G PG  GP G  GP G  G  G PG              G  G  GA G  G  G  G  G +GP+G    +G +G  G  GP G +GP G KG  GPIG +GA G  G PG RG++G+ GP G  GP         +GE G  G+ G  GA G  G SG PG +GPTG    KG RG QG  G  G  GA G  G  G  G+PGA G  G +G  G KG +G  GP G  G+AG  G PG  G  G  G
Sbjct:  707 FPGERGGAGPQGLQGPRGLPGTPGTDGPKGAIGPAGAAGAQGPPGL------------QGMPGERGAVGISGAKGDRGDSGEKGPEGAPGKDGSRGLTGPIGPPGPSGPNGAKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGAAGPAGPSGKDGPKGVRGDAGPPGRAGDAGLRGPPGAPGEKGEAG 964          

HSP 10 Score: 52.373 bits (124), Expect = 5.133e-6
Identity = 62/159 (38.99%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSG------------------RDGERGDQGKLGVPGIPGETGMNGTPGRDG---------RPGVAGMRGDTGQPGPRGPAGPEGSTGAP---------GLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G+ GP G  GNPG DG PG +G  G SG                    G  G +G+ G PGIPG  G  G  G  G           G  G RG  G+PG  GP GP G  GAP         GL G  G PG +G PG +GPKG TG+ G  G
Sbjct:  398 EAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPG 556          
BLAST of Fibrillar collagen vs. Ensembl Zebrafish
Match: col1a1a (collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-9102])

HSP 1 Score: 135.576 bits (340), Expect = 2.085e-31
Identity = 82/254 (32.28%), Postives = 130/254 (51.18%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA--------NILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKIS-YSENPI--NKYISYGE--LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKTE---YPAIIFTDNNR-ELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            DP R   +DDAN            L S     ++I  P GTK  PAR+C  LK      K G Y+IDP+ G   DA +V+C METGETC++P +S+  K + Y+   I   K++ +GE    G Q F+Y  +       N QL FL+++ST A+Q I   C N++A +++       A++   +N  E+  + +   +Y V +D C + +    +TV+   +  + RLPI D+  +   +   EF +++  VCF
Sbjct: 1194 DPFRHFRADDANVMRDRDLEVDTTLKSLSQQIESIISPDGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCNQDAIKVYCNMETGETCVNPTESAIPKKNWYTSKNIKEKKHVWFGEAMTDGFQ-FEYGSEGSKPEDVNIQLTFLRLMSTEASQNITYHCKNSIAYMDQASGNLKKALLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1446          

HSP 2 Score: 62.3882 bits (150), Expect = 4.629e-9
Identity = 54/120 (45.00%), Postives = 65/120 (54.17%), Query Frame = 2
Query: 2585 VGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
             GP G+PG  G  G  G +G  G  G++GE G+ GK G PG    PG  G  G PG  G PG+ G RG +G  G +G AGP G  G PG       PG+ G PG  GP+GL G +G  GP
Sbjct:  186 TGPPGEPGEAGAPGPMGPRGAAGPPGKNGEDGESGKPGRPGERGPPGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGPKGEPGA------PGENGTPGAMGPRGLPGERGRAGP 299          

HSP 3 Score: 57.7658 bits (138), Expect = 1.235e-7
Identity = 47/100 (47.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G+ G  G RG  G+ G  G PG  G  G PG DG PG  G  GD G  G  G  GP G+TGAPG  G +G  G KG  G  GP G TG  G  G
Sbjct:  766 GESGAQGLVGPTGARGPPGERGETGAPGPAGFAGPPGADGLPGAKGEPGDNGAKGDAGAPGPAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAG 865          

HSP 4 Score: 55.8398 bits (133), Expect = 4.236e-7
Identity = 81/264 (30.68%), Postives = 104/264 (39.39%), Query Frame = 2
Query:  632 GKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDL---------------GSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGE------GVDGAPGIDGKDGSVGDP---------------GAPGEHGSNGIPGSKGSQGG------------------------------------TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G+PG+MG  GP+G  G  G  GE+G                   +GA G  G PG  GD+               G QG  G  G +G PG  G  G PG  G  G  G  G  GP+G++GDRG  G++G        G  G+PG  G DG+ G+                G PGE G+ G+PG KG +G                                     +G QG++G  GA G PG  G  G  G  G +GP G +
Sbjct:  559 GQPGVMGFPGPKGAAGEAGKPGERGV------------------MGAIGATGAPGKDGDVGAPGAPGPAGPAGERGEQGAAGPPGFQGLPGPQGATGEPGKSGEQGAPGEAGAPGPSGSRGDRGFPGERGAPGPAGPVGARGSPGSAGNDGAKGESGAAGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGKDGIRGMTGPIGPPGPAGAPGDKGESGAQGLVGPTGARGPPGERGETGAPGPAGFAGPPGAD 804          

HSP 5 Score: 55.8398 bits (133), Expect = 5.187e-7
Identity = 50/121 (41.32%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  782 IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRP 1144
             G PG  G+ G+ GP+G  G  G PG  G       DG +G  G PG  GP G +G RG  G  G  G+ G  G  G DG+ GD G  G  G  G PG  G+ G  GP+G+ G  G  G P
Sbjct:  186 TGPPGEPGEAGAPGPMGPRGAAGPPGKNGE------DGESGKPGRPGERGPPGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGPKGEPGAPGENGTPGAMGPRGLPGERGRAGPP 300          

HSP 6 Score: 55.4546 bits (132), Expect = 5.838e-7
Identity = 47/108 (43.52%), Postives = 57/108 (52.78%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPG 2887
            + G  G +GP G  G PG +G  G  G PG   R GERG  G  G  G PG  G+ G  G  G  G+ G +GD G  GP+G  G  G  G PG MG  G PG++G+ G
Sbjct:  194 EAGAPGPMGPRGAAGPPGKNGEDGESGKPG---RPGERGPPGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGPKGEPGAPGENGTPGAMGPRGLPGERGRAG 298          

HSP 7 Score: 55.4546 bits (132), Expect = 5.938e-7
Identity = 50/130 (38.46%), Postives = 62/130 (47.69%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------------------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG+ GFPG +G  G +G+ GERG  G +G  G P                     GE G  G PG  G PG  G  G+ G+ G +G  G  G+ G  G  GD G PG++G PG  GP G  G+ G  G
Sbjct:  559 GQPGVMGFPGPKGAAGEAGKPGERGVMGAIGATGAPGKDGDVGAPGAPGPAGPAGERGEQGAAGPPGFQGLPGPQGATGEPGKSGEQGAPGEAGAPGPSGSRGDRGFPGERGAPGPAGPVGARGSPGSAG 688          

HSP 8 Score: 55.0694 bits (131), Expect = 7.845e-7
Identity = 92/248 (37.10%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP------------------EGEPGVGGRIGFPGADGITGVSGMPG------VIGPTGTKG------------------DRGIQGKKGGEGVDGAPG---IDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            + G  G  GAGG +GPTG+ G  G++G  G +G  GP G  G +G  G  G KG  G  G  G  G  G  G+ G  GS GP G  GP                   G+PGV   +GFPG  G  G +G PG       IG TG  G                  +RG QG  G  G  G PG     G+ G  G+ GAPGE G+ G  GS+G +G  G +G  G AG  G  G  G  G  G KG+S
Sbjct:  452 KRGPRGEPGAGGARGPTGERGAPGARGFPGADGAAGPRGAPGERGGPGVVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGPGGAPGQDGRPGPPGPVGARGQPGV---MGFPGPKGAAGEAGKPGERGVMGAIGATGAPGKDGDVGAPGAPGPAGPAGERGEQGAAGPPGFQGLPGPQGATGEPGKSGEQGAPGEAGAPGPSGSRGDRGFPGERGAPGPAGPVGARGSPGSAGNDGAKGES 696          

HSP 9 Score: 55.0694 bits (131), Expect = 8.183e-7
Identity = 86/249 (34.54%), Postives = 102/249 (40.96%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------------EGEPGVGGRIGFPGADGI------------------------------------TGVSGMPGVIGPTGTKG---DRGIQGKKGGEGVDGAPGIDG---------KDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNA---GATGRPGLDGMI 1162
            GPQG TG+PG  G QG  G  G  GP+G +G +G  G            E GA GP G  G RG  GS G  G+ G                +G PG  G  G PG  G                                      G SG  G++GPTG +G   +RG  G  G  G  G PG DG          +G+ GD GAPG  G+ G PG +G  G TGP+G  G A   GATG PG  G +
Sbjct:  631 GPQGATGEPGKSGEQGAPGEAGAPGPSGSRGDRGFPG------------ERGAPGPAGPVGARGSPGSAGNDGAKGESGAAGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGKDGIRGMTGPIGPPGPAGAPGDKGESGAQGLVGPTGARGPPGERGETGAPGPAGFAGPPGADGLPGAKGEPGDNGAKGDAGAPGPAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRV 867          
BLAST of Fibrillar collagen vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 135.576 bits (340), Expect = 2.195e-31
Identity = 80/256 (31.25%), Postives = 130/256 (50.78%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA-------------NILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYV-------IDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEKTE---YPAIIFT-DNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D+A+++             +I G  + I  P G++  PARSC  LK      K G Y++DPN G   DA +VFC METGETC+ P      + ++  S++   K++ +GE ++G   F Y            QL FL+++ST A Q I   C N++A +++       AI+    N+ E+  + +   +Y V++D C+  + + A+TV+   +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1100 DPLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDI---APMDIGGADQEFGVDIGAVCF 1352          

HSP 2 Score: 59.6918 bits (143), Expect = 2.734e-8
Identity = 45/93 (48.39%), Postives = 54/93 (58.06%), Query Frame = 2
Query: 2576 DGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA 2836
            +G  GP G+PG+      PG  G PGN+G PG  G  G +G  G  GVPG+ G  G  G PGR G PG+ G RG TG+PG  G  G  G+TGA
Sbjct:  386 EGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGA 478          

HSP 3 Score: 55.0694 bits (131), Expect = 7.365e-7
Identity = 56/129 (43.41%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  815 SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GP+G  G  G+PG+ G  G  G  G  GV G  G  GP+G +G RG +G+ G  G  G PG  G  G+ G PG  G  G+ G PG +G  G +GP+G  G+ G  G PGL G  G+ G  GD+G QG
Sbjct:  343 ATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQG 471          

HSP 4 Score: 53.1434 bits (126), Expect = 2.892e-6
Identity = 61/156 (39.10%), Postives = 70/156 (44.87%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSG------------------RDGERGDQGKLGVPGIPGETGMNGTPGRDG---------RPGVAGMRGDTGQPGPRGPAGPEGSTGAP---------GLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            + G  G+ GP G  GNPG DG PG +G  G SG                    G  G +G+ G PGIPG  G  G  G  G           G  G RG  G+PG  GP GP G  GAP         GL G  G PG +G PG +GPKG TG+ G
Sbjct:  292 EAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPG 447          

HSP 5 Score: 52.373 bits (124), Expect = 5.683e-6
Identity = 66/171 (38.60%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV------------------------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G+ G  G  G RG  G+QGP G  G  G PG  G  G PG DGI G  G  G                         +GP G  GD GI G KG  G  G  G+ G  G  G  G  G+ G  G PGS G  G  G +G  GN    G PG DG+ G +G  GD G  GL+
Sbjct:  270 GSKGEAGPTGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGN---RGFPGQDGLAGAKGAPGDRGVPGLS 437          

HSP 6 Score: 52.373 bits (124), Expect = 5.878e-6
Identity = 53/133 (39.85%), Postives = 67/133 (50.38%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSG------------RDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +GP+G+ G+PG+ GF G  G  G  G             +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RG    +GP+G TG PG  G+ G PG +G  G  G  G  G  G TG
Sbjct:  345 GPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATG 477          

HSP 7 Score: 51.9878 bits (123), Expect = 6.132e-6
Identity = 49/115 (42.61%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  794 GIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATG 1138
            G RG+ GS GP+G   P GE G  G  GFPG DG+ G  G P         GDRG+            PG+ G  G  GDPG PGE    G+PG++G  G  G  G  G  GATG
Sbjct:  390 GPRGEPGSAGPLG---PPGERGAPGNRGFPGQDGLAGAKGAP---------GDRGV------------PGLSGPKGGTGDPGRPGE---PGLPGARGLTGRPGDAGAQGKVGATG 477          
BLAST of Fibrillar collagen vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 134.42 bits (337), Expect = 5.290e-31
Identity = 80/256 (31.25%), Postives = 130/256 (50.78%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA-------------NILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYV-------IDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEKTE---YPAIIFT-DNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D+A+++             +I G  + I  P G++  PARSC  LK      K G Y++DPN G   DA +VFC METGETC+ P      + ++  S++   K++ +GE ++G   F Y            QL FL+++ST A Q I   C N++A +++       AI+    N+ E+  + +   +Y V++D C+  + + A+TV+   +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1172 DPLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDI---APMDIGGADQEFGVDIGAVCF 1424          

HSP 2 Score: 59.3066 bits (142), Expect = 3.714e-8
Identity = 57/123 (46.34%), Postives = 70/123 (56.91%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  GN G  G+ G  G  G PG++GVPG+SG  G  GD G+ G PG+PG  G+ G PG  G  G  G  G  G+ G  GP GP G+ G PG+MG  G  G  G+PG  G KGL G  G+ G
Sbjct:  470 ERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRG 592          

HSP 3 Score: 58.5362 bits (140), Expect = 7.873e-8
Identity = 52/112 (46.43%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG+ GFPG +G  G  G+ GE+G  G+ G+ G+PG+ G  G  G  G  G  G RG+ GQPGP   +G  GP G+ G PG  GD G PG+ G  G TGP+G  G  G  G
Sbjct:  559 GQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERG 670          

HSP 4 Score: 55.0694 bits (131), Expect = 7.889e-7
Identity = 56/129 (43.41%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  815 SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GP+G  G  G+PG+ G  G  G  G  GV G  G  GP+G +G RG +G+ G  G  G PG  G  G+ G PG  G  G+ G PG +G  G +GP+G  G+ G  G PGL G  G+ G  GD+G QG
Sbjct:  407 ATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQG 535          

HSP 5 Score: 53.1434 bits (126), Expect = 3.230e-6
Identity = 61/156 (39.10%), Postives = 70/156 (44.87%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSG------------------RDGERGDQGKLGVPGIPGETGMNGTPGRDG---------RPGVAGMRGDTGQPGPRGPAGPEGSTGAP---------GLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            + G  G+ GP G  GNPG DG PG +G  G SG                    G  G +G+ G PGIPG  G  G  G  G           G  G RG  G+PG  GP GP G  GAP         GL G  G PG +G PG +GPKG TG+ G
Sbjct:  356 EAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPG 511          

HSP 6 Score: 52.7582 bits (125), Expect = 4.452e-6
Identity = 83/210 (39.52%), Postives = 96/210 (45.71%), Query Frame = 2
Query:  608 AGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            A GP GP G+ G  G  G +G  GPKG  G           G +GP GP GE G  GP      RG+ GS GP+G   P GE G  G  GFPG DG+ G  G PG  G  G  G +G  G  G  G  G PG  G  G  GD GA G+ G+ G P               G  G  G  GP+G  G  G  G  GL G  G++G+ G  G
Sbjct:  407 ATGPLGPKGQSGDPGIPGFKGEAGPKGERG---------VLGPQGPPGPSGEEGKRGP------RGEPGSAGPLG---PPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDG 598          

HSP 7 Score: 51.9878 bits (123), Expect = 6.454e-6
Identity = 66/171 (38.60%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV------------------------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G+ G  G  G RG  G+QGP G  G  G PG  G  G PG DGI G  G  G                         +GP G  GD GI G KG  G  G  G+ G  G  G  G  G+ G  G PGS G  G  G +G  GN    G PG DG+ G +G  GD G  GL+
Sbjct:  334 GSKGEAGPTGARGPEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGN---RGFPGQDGLAGAKGAPGDRGVPGLS 501          

HSP 8 Score: 51.9878 bits (123), Expect = 6.454e-6
Identity = 53/133 (39.85%), Postives = 67/133 (50.38%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSG------------RDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +GP+G+ G+PG+ GF G  G  G  G             +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RG    +GP+G TG PG  G+ G PG +G  G  G  G  G  G TG
Sbjct:  409 GPLGPKGQSGDPGIPGFKGEAGPKGERGVLGPQGPPGPSGEEGKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATG 541          

HSP 9 Score: 51.6026 bits (122), Expect = 8.526e-6
Identity = 54/131 (41.22%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQ---------GKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  G  G+PG PG  G  G  G+ G+ G+DGE G           G+ G  G PG +G  G PG  G PG  G  GD G PG  G AGP G  G  G  G+ G  G +G     GP+GL G  G  GP
Sbjct:  565 GFPGPKGANGEPGKPGEKGLVGRTGLRGLPGKDGETGPSGPPGPVGAVGERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGL---QGPRGLPGTPGTDGP 692          
BLAST of Fibrillar collagen vs. Ensembl Xenopus
Match: col1a1 (collagen, type I, alpha 1 [Source:NCBI gene;Acc:496414])

HSP 1 Score: 138.658 bits (348), Expect = 3.476e-32
Identity = 72/221 (32.58%), Postives = 123/221 (55.66%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPIN-KYISYGE-LSGIQRFDYVIDNT-------QLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            + I  P GT+  PAR+C  LK   S  K G Y+IDPN G + DA +V+C METGETC+ P Q+S ++ ++  S+NP   K++ +GE +S   +F+Y  + +       QL FL++++T A+Q I   C N++A +++     +   ++   N  E+  + +   +Y V++D C   + E  +TV+   +  + RLPI D+  +   +   EF + +  VCF
Sbjct: 1228 ENIQSPEGTRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCILDAIKVYCNMETGETCVYPTQNSIAQKNWYTSKNPREKKHVWFGEAMSDGFQFEYGSEGSDPADVAIQLTFLRLMATEASQNITYHCKNSVAYMDQATGNLKKALLLQGSNEIEIRAEGNSRFTYSVVEDGCTQHTGEWGKTVIDYKTTKTSRLPITDVAPMDIGAPDQEFGIDIGPVCF 1448          

HSP 2 Score: 60.8474 bits (146), Expect = 2.045e-8
Identity = 44/95 (46.32%), Postives = 55/95 (57.89%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            G  G  G  GR GERG  G  G  G+PG  G+ G  G  G  G+ G +GD+G  GP+G  G  G  GAPG +G  G PG++G+PG +GP G  GN
Sbjct:  216 GEDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFNGLDGAKGDSGPAGPKGEPGSPGENGAPGQVGPRGLPGERGRPGPSGPAGARGN 310          

HSP 3 Score: 55.8398 bits (133), Expect = 6.405e-7
Identity = 58/125 (46.40%), Postives = 69/125 (55.20%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            ++G  G  G +G+PG  G  G  G QG PG SG +G+RG +G+ G  G PG  G  G PG  G PG  G  G  G PG RGP GP G+ G+PG  G  G+PG  G  G TG  G  G  G TGP 
Sbjct:  418 NNGEPGAQGNKGEPGAKGESGPAGVQGPPGPSGEEGKRGSRGEPGPAGPPGPAGERGAPGSRGFPGSDGASGPKGGPGERGPVGPAGAKGSPGESGRPGEPGLPGAKGLTGSPGSPGPDGKTGPA 542          

HSP 4 Score: 55.8398 bits (133), Expect = 7.583e-7
Identity = 95/241 (39.42%), Postives = 108/241 (44.81%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGP---------------QGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHG---PEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRG---------------------IQGKKGGEGVDGAPGIDGKDGSVGDPG 1039
            GPAG  GP G +G+PG KG  G  G +G  G  G  GP G  GP G  G  G  G  GA GP G TG PG  G  GP                G  G KGP GE GP G  G            E GAAGP G PG +G  GS GP G+ G   P+G  G  G +G PG  G  G SG+PG +G  G +G  G                       G++G  G +GAPG DG  G  GD G
Sbjct:  795 GPAGFAGPPGADGQPGAKGEQGDAGAKGDAGPPGPAGPTGAPGPAGALGATGPKGARGAPGPPGATGFPGATGRVGPPGPAGNSGPPGPSGPAGKEGAKGPRGETGPAGRPG------------EPGAAGPSGPPGEKGSPGSDGPAGAPGIPGPQGVAGSRGTVGLPGMRGERGFSGLPGPVGEPGKQGPSGPSGERGPPGPSGPPGLAGPPGEAGREGAPGSEGAPGRDGAAGPKGDRG 1023          

HSP 5 Score: 53.9138 bits (128), Expect = 2.782e-6
Identity = 54/133 (40.60%), Postives = 61/133 (45.86%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQG------------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGD---IGKPGQKGKPGNTGPKG 2905
            G  G  G  G PG PG  GFPG  G                    G  G  G RG+ G  G PG PG  G +G PG  G PG  G  G  G PGP+G AG  G+ G PG+ G+    G PG  G+PG  GP G
Sbjct:  843 GATGPKGARGAPGPPGATGFPGATGRVGPPGPAGNSGPPGPSGPAGKEGAKGPRGETGPAGRPGEPGAAGPSGPPGEKGSPGSDGPAGAPGIPGPQGVAGSRGTVGLPGMRGERGFSGLPGPVGEPGKQGPSG 975          

HSP 6 Score: 53.1434 bits (126), Expect = 3.899e-6
Identity = 80/208 (38.46%), Postives = 95/208 (45.67%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGD------------------LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            GP GP G  G  G+ G +G +GP GP G              GP G  G+ GA G  G  G +GD                  LG+ GP G+ G  G PG     GFPGA G  G  G  G  GP G  G  G +G KG  G  G  G  G+ G+ G  G PGE GS G  G  G+ G  GPQG+ G+ G  G PG+ G  G  G+ G
Sbjct:  771 GPAGPAGPTGARGAPGERGESGPPGPAG------------FAGPPGADGQPGAKGEQGDAGAKGDAGPPGPAGPTGAPGPAGALGATGPKGARGAPGPPGA---TGFPGATGRVGPPGPAGNSGPPGPSGPAGKEGAKGPRGETGPAGRPGEPGAAGPSGPPGEKGSPGSDGPAGAPGIPGPQGVAGSRGTVGLPGMRGERGFSGLPG 963          

HSP 7 Score: 52.7582 bits (125), Expect = 6.150e-6
Identity = 43/96 (44.79%), Postives = 53/96 (55.21%), Query Frame = 2
Query:  836 HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN 1123
            +G +GE G  GR G  G  G  G  G+PG  G  G KG RG  G  G +G  G  G  G+ GS G+ GAPG+ G  G+PG +G  G +GP G  GN
Sbjct:  215 NGEDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFNGLDGAKGDSGPAGPKGEPGSPGENGAPGQVGPRGLPGERGRPGPSGPAGARGN 310          
BLAST of Fibrillar collagen vs. Ensembl Xenopus
Match: col1a1 (collagen, type I, alpha 1 [Source:NCBI gene;Acc:496414])

HSP 1 Score: 130.568 bits (327), Expect = 9.832e-30
Identity = 72/221 (32.58%), Postives = 123/221 (55.66%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPIN-KYISYGE-LSGIQRFDYVIDNT-------QLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            + I  P GT+  PAR+C  LK   S  K G Y+IDPN G + DA +V+C METGETC+ P Q+S ++ ++  S+NP   K++ +GE +S   +F+Y  + +       QL FL++++T A+Q I   C N++A +++     +   ++   N  E+  + +   +Y V++D C   + E  +TV+   +  + RLPI D+  +   +   EF + +  VCF
Sbjct: 1049 ENIQSPEGTRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCILDAIKVYCNMETGETCVYPTQNSIAQKNWYTSKNPREKKHVWFGEAMSDGFQFEYGSEGSDPADVAIQLTFLRLMATEASQNITYHCKNSVAYMDQATGNLKKALLLQGSNEIEIRAEGNSRFTYSVVEDGCTQHTGEWGKTVIDYKTTKTSRLPITDVAPMDIGAPDQEFGIDIGPVCF 1269          

HSP 2 Score: 56.9954 bits (136), Expect = 3.018e-7
Identity = 58/124 (46.77%), Postives = 69/124 (55.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            ++G  G  G +G+PG  G  G  G QG PG SG +G+RG +G+ G  G PG  G  G PG  G PG  G  G  G PG RGP GP G+ G+PG  G  G+PG  G  G TG  G  G  G TGP
Sbjct:  373 NNGEPGAQGNKGEPGAKGESGPAGVQGPPGPSGEEGKRGSRGEPGPAGPPGPAGERGAPGSRGFPGSDGASGPKGGPGERGPVGPAGAKGSPGESGRPGEPGLPGAKGLTGSPGSPGPDGKTGP 496          

HSP 3 Score: 54.299 bits (129), Expect = 2.037e-6
Identity = 36/79 (45.57%), Postives = 47/79 (59.49%), Query Frame = 2
Query: 2696 GVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G+PG  G+ G  G  G  G+ G +GD+G  GP+G  G  G  GAPG +G  G PG++G+PG +GP G  GN G  G
Sbjct:  216 GARGLPGTAGLPGMKGHRGFNGLDGAKGDSGPAGPKGEPGSPGENGAPGQVGPRGLPGERGRPGPSGPAGARGNDGAPG 294          

HSP 4 Score: 53.9138 bits (128), Expect = 2.392e-6
Identity = 55/140 (39.29%), Postives = 65/140 (46.43%), Query Frame = 2
Query: 2594 EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG---------------------------LMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  G PG  G PG +G  G +G DG +GD G  G  G PG  G NG PG+ G  G+ G R   G+PGP GPAG  G+ GAPG                           L+G  G PG  G+    G KG TG  GI G
Sbjct:  215 QGARGLPGTAGLPGMKGHRGFNGLDGAKGDSGPAGPKGEPGSPGENGAPGQVGPRGLPGER---GRPGPSGPAGARGNDGAPGGAGPNVSIKDPQLHTERDILSSCHNSKLLGLSGNPGSDGQ---AGAKGATGAPGIAG 348          
BLAST of Fibrillar collagen vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 130.568 bits (327), Expect = 1.098e-29
Identity = 68/234 (29.06%), Postives = 115/234 (49.15%), Query Frame = 2
Query: 3530 YSDDANAANILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVIDN-------TQLMFLKMVSTRANQEIKIAC-NNMAVVE----KTEYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            Y  DA   ++    +TI  P G+K  PAR+C  L+ +      G Y+IDPN G  +D+  VFC   TGETCI     S  + ++  S+    K++ +GE ++G  + +Y  +        TQ  F+++++  A+Q I   C N++A ++      +   ++   N+ EL  + +   ++ V++D C   + E   TV+   +    RLPI D+  L    D  EF L +  VCF
Sbjct: 1120 YEVDATLKSLNNQIETILTPEGSKKNPARTCRDLRLSHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGETCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFTFSVLEDGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1353          

HSP 2 Score: 81.2629 bits (199), Expect = 1.142e-14
Identity = 125/344 (36.34%), Postives = 146/344 (42.44%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGD------RGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGR------PGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G  G  G  G  G  G PG  G  G +G  GPKGP GE                      G+ G +G  G  G  G  GP G+ GP G+ G  G  GFPG  G TG  G  G++GP+G  G       RG +G  G  G  G  GI G  G +G+ G+ GE G  G PG+ G  G  G  GI G  GA G       PG +G  G  G  G +G +G +G  G  G  G  G  G  GNPGN G P                                 GRDGLPG+ G  G PG  GP GS G  G PG  G  G  G  G+PG     G  G  GPRG +G+
Sbjct:  703 GERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGES---------------------GSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPP---------------------------------GRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQ 992          

HSP 3 Score: 74.7146 bits (182), Expect = 1.267e-12
Identity = 114/292 (39.04%), Postives = 134/292 (45.89%), Query Frame = 2
Query:  398 GPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS------------------------QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GPA  TG R   G  G  G  GP GR G  GP G+ GP                         G +G  G  GP+GP G  G +G  G QG+ GP+G  GE+G  G++GP G  G  GP G LGA G  GLPG RG+ G+                         GP+GS G  G  G  GR G PG DG  G  G+PGV G  G  G  G  G  G  G  GA G  GK G+ G+PG  G  G+ G  G +G  G  G +G  G AG  G  GLDG  G  G++G  GP G
Sbjct:  760 GPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGP------------------------SGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAG 1027          

HSP 4 Score: 70.4774 bits (171), Expect = 2.546e-11
Identity = 112/266 (42.11%), Postives = 129/266 (48.50%), Query Frame = 2
Query:  431 AGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGR---IGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGP------QGIIGNAGATGRPGLD---GMIGIQGVKGDSG 1192
            AGP+GL GP G  G  G  GP G TG  G PG  G                 G  G  G  GP+G +G PG +G+ G  G  GP GP G  GP+GD G PG  G  GP G  GA GP G+ G  G  G  G  G  GP G+ G  GR    G  G  G+ G  G  G  GP G  G  G  G  G  G+ G PG  G+ G+ G PGA GE G  G  GS GS+G +GP       G+ G AG  G PG D   G  G+ GVKG+ G
Sbjct:  690 AGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAG---------------HTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERG 940          

HSP 5 Score: 67.781 bits (164), Expect = 1.391e-10
Identity = 118/277 (42.60%), Postives = 134/277 (48.38%), Query Frame = 2
Query:  431 AGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGK------------------PGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            AGP+G  GP G EGR GP G  G +GP G  G  G PG  G  GP G  G MG  G  GA GP G  G                   PG  GS GP G  GP GP G +G  G AG  G +G  G IG  G  GP G PG  GD GSQGP G+ G             PG DG  G  G PG+ G TG KG++G  G  G +G+ G  G  G+ G  G+ GAPG+ G  G  G +G +G  G  G  G  GA G  G  G  G  G KG+ G  GLN
Sbjct:  357 AGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRG------------APGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLN 621          

HSP 6 Score: 67.781 bits (164), Expect = 1.527e-10
Identity = 67/146 (45.89%), Postives = 76/146 (52.05%), Query Frame = 2
Query:  800 RGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------------DPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            RG+ G  GP G  GP G PG  G  G     G TG +G PG  G TG KG+RG +G KG  G  GA G  G  G  G            D GAPG   +NG PG  G  G  GP GI+G +GATG PG DG    +G +GDSGP G
Sbjct:  684 RGESGPAGPSGLAGPRGAPGERGEAG---PAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPG---ANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGP---RGPRGDSGPVG 820          

HSP 7 Score: 67.3958 bits (163), Expect = 1.839e-10
Identity = 111/291 (38.14%), Postives = 128/291 (43.99%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRP------------GPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPI---GSHGPEGEPGVGGRIGFPGADGITGVSGMPGV------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
              GP    G+  V G  G +GP G  G P            GP GP G T      G  G  G  G  G  GP GR G  G  G  GP G TG PG  G +GP+G +GP G  GEQ                     G  GP GL G +G  G  GP    G+ GP G  G  G  G PGA G  G  G PG        GP G+ G RG  G  G  G+ G  G  G+DG+ G+ G PG  G  G+ G +G  GGTGP G +   GA G PG  G  G  G +G+ GP G
Sbjct:  716 FAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTT------GPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQ---------------------GIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSL---GAVGAPGAVGPSGKSGNRGEPGPVG 976          

HSP 8 Score: 65.0846 bits (157), Expect = 9.714e-10
Identity = 56/126 (44.44%), Postives = 69/126 (54.76%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRD---GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
             GL G  G  G PG PG +G  G  G  G +G  G  G  G  G+ G+ GE G +G PG D   GR G+ G++G+ G PG  GPAG  G+ GAPG +G  GK G +G+PG  G  G  G  G  GP
Sbjct:  864 SGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGP 989          

HSP 9 Score: 62.003 bits (149), Expect = 8.518e-9
Identity = 56/126 (44.44%), Postives = 66/126 (52.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE---RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            GL G  G  G+ GNPG DG PG  G+PGV G  G     G  G LG  G PG  G +G  G  G PG  G  G  G  GPRGP+G +G+       GD G+ G++G  G  G KG  G QG+ GP 
Sbjct:  907 GLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGT------RGDKGEAGERGARGLDGRKGHNGLQGLPGPA 1026          

HSP 10 Score: 62.003 bits (149), Expect = 8.885e-9
Identity = 130/348 (37.36%), Postives = 155/348 (44.54%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGA---PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSG------------QPGANKPPGPQGKMGPRGLTGK 1582
             G  G  G+ GP GP G  G  G +GP G  G  GP G  G +G  G  G  GP       G AG +G PG RG   + GP G+ GP G+    GR G PG  G  G+ G  G  GP G +G  G QG +G  G  GA G  G+ GS+G PG     GE G NG  GS+G  G  G  G  GN GA G PGL G  G +G +G +G  G  G  G  G+ G  G  G  G PG+ G  G  G                             G  G PG  GA G  G+ GPRG  G  G  G  G  G  GL+G            + GA   PGP+G+ G  G +G+
Sbjct:  348 TGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPD------GRAGGMGAPGSRG---ASGPAGARGPNGD---AGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGP---------------------------RGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGE 656          

HSP 11 Score: 60.4622 bits (145), Expect = 2.642e-8
Identity = 54/123 (43.90%), Postives = 67/123 (54.47%), Query Frame = 2
Query:  833 SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + G  G+PGV G  G  GA G  G +G  G  GP+G +G RG  G+ G  G  G  GI G  G+ G PG  G  G  G PGS+G+ G  G +G  G+AG  G PGL G  G+ G  G +GP G
Sbjct:  332 ARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAG 454          

HSP 12 Score: 59.6918 bits (143), Expect = 4.030e-8
Identity = 53/121 (43.80%), Postives = 62/121 (51.24%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G  G  G+ G  G PG  G  GV G  G +G +G+ G PG  G  G +G  G +G  G  G RGD G PG  G  GP G TGAPG  G +G  G  G PG  GP+G  G+ G  G
Sbjct:  700 GAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVG 820          

HSP 13 Score: 59.3066 bits (142), Expect = 6.252e-8
Identity = 107/262 (40.84%), Postives = 127/262 (48.47%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGP------------------IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATG 1138
            G+R  +GPAG +GP+G  GRPG  G  G  G  G  G  G  G  GP GP       G  GR+G  G  GP G+PG +G  GP+G  G  G NG++G +G +G  G  GP G     GA GP GL G  GD G QGP                  +G HG  G PG  G  G  G  G  G  G  G  GP G  G RG  G  G +G  G PG  G +G++   G  G PGE G+ G+PG KG +G  G  G  GN G  G
Sbjct:  412 GSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGP------QGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNN---GAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDG 664          

HSP 14 Score: 58.151 bits (139), Expect = 1.371e-7
Identity = 57/130 (43.85%), Postives = 64/130 (49.23%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMR------GDTGQPGPRGPAGP---EGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +G  G  G  GN G+ G PG +G+PG  GR G  G  G  G  G  G  G NG  GR G PG+ G R      G TG  G  GPAGP   EG +G  G  G  G+PG  G PG  GP G  G  G  G
Sbjct:  373 GPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKG 502          

HSP 15 Score: 58.151 bits (139), Expect = 1.418e-7
Identity = 89/216 (41.20%), Postives = 103/216 (47.69%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGS------QGGTGPQGIIGN---AGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            GP GP G PG  G  G +G  G  G  G  G  G  G PG  GP GP G  G +G  G+ G +GD G++G  GS GP         EG  G  G  G  G  G  G+ G+PG  G  G  G  G  G  G  G  G  G  G +G  G PG PG  G+ G+PG  GS      +G  GPQGI G    AGA+G  G  G IG  G KG +G  G N
Sbjct:  283 GPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKN 498          

HSP 16 Score: 56.225 bits (134), Expect = 5.432e-7
Identity = 96/244 (39.34%), Postives = 116/244 (47.54%), Query Frame = 2
Query:  485 KGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
             G  G+ G +G  G  G+PG  GP GP GP+G  GR G NG  G  GP G  G+ G  G +G+ GP                            G AG +G PG R   G+ GP G+ GP G+    GR G PG  G  G+ G  G  GP G +G  G QG +G  G  GA G  G+ GS+G P   G  GE G NG  GS+G  G  G  G  GN GA G PGL G  G +G +G +G  G  
Sbjct:  336 SGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPD---------------------------GRAGGMGAPGSR---GASGPAGARGPNGD---AGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQ 546          

HSP 17 Score: 55.8398 bits (133), Expect = 6.653e-7
Identity = 75/196 (38.27%), Postives = 88/196 (44.90%), Query Frame = 2
Query:  641 GLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGL---PGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL------DGMIGIQGVKGDSGPQG 1201
            G  G  GP G+ GP+G  GE+G                  E G AG  G    PG  G  G +G  G  GP+GE       G PGA G  G  G  G  GP GT G RG           GAPG +G  G  G  GAPG  G  G  G+ G  G  GP+G  G++G  GRPG        G+IG +G  G+SGP G
Sbjct:  685 GESGPAGPSGLAGPRGAPGERG------------------EAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGE------SGSPGALGAVGSHGPAGPNGPAGTTGPRGD---------GGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAG 847          

HSP 18 Score: 55.8398 bits (133), Expect = 7.362e-7
Identity = 59/145 (40.69%), Postives = 71/145 (48.97%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDG------------FPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPG---------PRGPAG------PEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G VGP G  G+PG DG             PG QG+ G  G  GE+G  G+ G  G PG +G +G  G  G  G+ G RG+ G PG         P GPAG      P G  G+PGL G  G+ G+ G PGN GP G  G  G+ G
Sbjct:  793 GIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKG 937          

HSP 19 Score: 55.0694 bits (131), Expect = 1.050e-6
Identity = 53/122 (43.44%), Postives = 68/122 (55.74%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G  G  G  G  G PG  GFPG +G  G  G++G++G QG  G  G PG  G NG     G PG+AG  GD G+ GP G  G +G  G  G  G++GK G++G PG+ GP G  G +G  G
Sbjct:  465 EGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGA---QGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERG 583          

HSP 20 Score: 55.0694 bits (131), Expect = 1.264e-6
Identity = 54/121 (44.63%), Postives = 62/121 (51.24%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRP---GVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G +G+PG+ G  G  G  G  G  G +GE G  G  G  GI G  G  G PG DGR    G  G RG +G  G RGP G  G  G PGL+G  G PG  G  G  G +G  G QGI G
Sbjct:  346 GDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEG 466          

HSP 21 Score: 54.6842 bits (130), Expect = 1.447e-6
Identity = 54/127 (42.52%), Postives = 69/127 (54.33%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGS---TGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            +G  G+ GP G  G PG DG  G QG PG++G  G++G+QG  G PG  G  G  G  G  G+ G  G  GD G  GP GP G  G+   +GA G +G +G  G  G PG+ G KG  G  G+ G +
Sbjct:  498 NGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGAL 624          

HSP 22 Score: 53.9138 bits (128), Expect = 2.916e-6
Identity = 53/125 (42.40%), Postives = 65/125 (52.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGS---TGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G +G  GP G+ G PG  G  G  G  G  G+DG RG +G  G  G PGE G+ G  G  G  G +G  G  G PG  GP+G  G+   +G PG  G+ G PG  G  G +GP G  G+ G  GP
Sbjct:  775 GANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGP 899          

HSP 23 Score: 51.9878 bits (123), Expect = 9.039e-6
Identity = 56/124 (45.16%), Postives = 61/124 (49.19%), Query Frame = 2
Query: 2579 GNVGPEGKPGN---PGLDGFPGNQGVP---GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GN G  G PG    PG DG  G  G P   G SG  G RG  G  G PG PG  G  G PG  G  G AG  G  G  G  G +GP G++G  G  G IG PG KG  G  G  G  G+QG +G
Sbjct:  385 GNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSG 508          
BLAST of Fibrillar collagen vs. Ensembl Xenopus
Match: col1a1 (collagen, type I, alpha 1 [Source:NCBI gene;Acc:496414])

HSP 1 Score: 129.028 bits (323), Expect = 2.515e-29
Identity = 72/221 (32.58%), Postives = 123/221 (55.66%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPIN-KYISYGE-LSGIQRFDYVIDNT-------QLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            + I  P GT+  PAR+C  LK   S  K G Y+IDPN G + DA +V+C METGETC+ P Q+S ++ ++  S+NP   K++ +GE +S   +F+Y  + +       QL FL++++T A+Q I   C N++A +++     +   ++   N  E+  + +   +Y V++D C   + E  +TV+   +  + RLPI D+  +   +   EF + +  VCF
Sbjct:  901 ENIQSPEGTRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCILDAIKVYCNMETGETCVYPTQNSIAQKNWYTSKNPREKKHVWFGEAMSDGFQFEYGSEGSDPADVAIQLTFLRLMATEASQNITYHCKNSVAYMDQATGNLKKALLLQGSNEIEIRAEGNSRFTYSVVEDGCTQHTGEWGKTVIDYKTTKTSRLPITDVAPMDIGAPDQEFGIDIGPVCF 1121          

HSP 2 Score: 56.6102 bits (135), Expect = 3.591e-7
Identity = 58/124 (46.77%), Postives = 69/124 (55.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            ++G  G  G +G+PG  G  G  G QG PG SG +G+RG +G+ G  G PG  G  G PG  G PG  G  G  G PG RGP GP G+ G+PG  G  G+PG  G  G TG  G  G  G TGP
Sbjct:  275 NNGEPGAQGNKGEPGAKGESGPAGVQGPPGPSGEEGKRGSRGEPGPAGPPGPAGERGAPGSRGFPGSDGASGPKGGPGERGPVGPAGAKGSPGESGRPGEPGLPGAKGLTGSPGSPGPDGKTGP 398          
BLAST of Fibrillar collagen vs. Ensembl Xenopus
Match: col1a1 (collagen, type I, alpha 1 [Source:NCBI gene;Acc:496414])

HSP 1 Score: 128.642 bits (322), Expect = 3.449e-29
Identity = 72/221 (32.58%), Postives = 123/221 (55.66%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPIN-KYISYGE-LSGIQRFDYVIDNT-------QLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            + I  P GT+  PAR+C  LK   S  K G Y+IDPN G + DA +V+C METGETC+ P Q+S ++ ++  S+NP   K++ +GE +S   +F+Y  + +       QL FL++++T A+Q I   C N++A +++     +   ++   N  E+  + +   +Y V++D C   + E  +TV+   +  + RLPI D+  +   +   EF + +  VCF
Sbjct:  951 ENIQSPEGTRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCILDAIKVYCNMETGETCVYPTQNSIAQKNWYTSKNPREKKHVWFGEAMSDGFQFEYGSEGSDPADVAIQLTFLRLMATEASQNITYHCKNSVAYMDQATGNLKKALLLQGSNEIEIRAEGNSRFTYSVVEDGCTQHTGEWGKTVIDYKTTKTSRLPITDVAPMDIGAPDQEFGIDIGPVCF 1171          

HSP 2 Score: 55.8398 bits (133), Expect = 5.877e-7
Identity = 57/119 (47.90%), Postives = 66/119 (55.46%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G +G+PG  G  G  G QG PG SG +G+RG +G+ G  G PG  G  G PG  G PG  G  G  G PG RGP GP G+ G+PG  G  G+PG  G  G TG  G  G  G TGP
Sbjct:  284 GAQGNKGEPGAKGESGPAGVQGPPGPSGEEGKRGSRGEPGPAGPPGPAGERGAPGSRGFPGSDGASGPKGGPGERGPVGPAGAKGSPGESGRPGEPGLPGAKGLTGSPGSPGPDGKTGP 402          

HSP 3 Score: 52.7582 bits (125), Expect = 5.858e-6
Identity = 88/222 (39.64%), Postives = 101/222 (45.50%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXX-ELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPG---------------------VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGD 1186
            G  G NG  G +G +G  G  G  GPQG  GP GP G +G  G  G  G  GP   +  E GA G  G PG +G+ G  G  G  GP GE G                       G  GFPG+DG +G  G PG  GP G  G +G  G+ G  G  G PG  G  GS G PG  G+ G  G PG  G  G  GP G  G +G  G PG  G  G+ G  GD
Sbjct:  223 GHRGFNGLDGAKGDSGPAGPKGDAGPQGSRGPDGPQGGRGEPGAPGQAGAAGPSVSLKGEPGAQGNKGEPGAKGESGPAGVQGPPGPSGEEGKRGSRGEPGPAGPPGPAGERGAPGSRGFPGSDGASGPKGGPGERGPVGPAGAKGSPGESGRPGEPGLPGAKGLTGSPGSPGPDGKTGPAGAPGQDGRPGPPGPPGARGQSGVMGFPGPKGAAGLPGKDGD 444          
BLAST of Fibrillar collagen vs. Ensembl Mouse
Match: Col1a2 (collagen, type I, alpha 2 [Source:MGI Symbol;Acc:MGI:88468])

HSP 1 Score: 139.043 bits (349), Expect = 1.736e-32
Identity = 69/233 (29.61%), Postives = 116/233 (49.79%), Query Frame = 2
Query: 3530 YSDDANAANILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPK-QSSFSKISYSENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIACNNMAVVEKTEY-----PAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            Y  DA   ++    +T+  P G++  PAR+C  L+ +        Y+IDPN G   DA +V+C   TGETCI  +  ++ +K SYS    NK++  GE ++G  +F+Y ++        TQL F+++++ RA+Q I   C N       E        ++   N+ EL  + +   +Y V+ D C   ++E  +T++   +    RLP  D+  L       EFR+++  VCF
Sbjct: 1139 YEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCF 1371          

HSP 2 Score: 73.559 bits (179), Expect = 2.114e-12
Identity = 88/205 (42.93%), Postives = 102/205 (49.76%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG------PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN---AGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP G  G+ G  G  G  G  GP GP+GE+G +G  G            E G+AGP G PG+RG  GS+G        G  GP G  G  G  G  G +G  G  G PG++GP G  G  G  G  G EG  G PGIDG+ G +G  G  GE G+ G PG KG  G  G  G  G+   AGA G PG DG  G QG  G  G QG
Sbjct:  355 GPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPG------------EAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQG 547          

HSP 3 Score: 69.707 bits (169), Expect = 2.783e-11
Identity = 85/209 (40.67%), Postives = 100/209 (47.85%), Query Frame = 2
Query:  590 RSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            + G  G  G QGP G+ G  G+ GP G  G KGP+GE G  G                 G AGP GL G  G LG  G   S G  G PG+ G +G PG  GI+G  G  G    +G  G  G  G  G+ G  G DG PG DG+ G  G+ G PG  G  G  G+ G  G  GP G  GN G  G  G  G +G  G +G SGPQG+ 
Sbjct:  821 KEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAP---------------GTAGPQGLLGAPGILGLPG---SRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIR 1011          

HSP 4 Score: 67.3958 bits (163), Expect = 1.573e-10
Identity = 107/257 (41.63%), Postives = 121/257 (47.08%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQ 1198
             AGP GL G  G  G PG +G  GL G  G  G+ G  G  GP G +GP G +G  G NGA G  G  G PG   S GP G +G  G  GE+G                    G+ GP G  G  G  GS GP G HG  GEPG  G +G  GA G  G S      GP G +GD+G  G KG  G+   PG+ G  G  G PG  G HG  G PG  G  G  GP G  G  G  GR G  G +G  GV+G  G Q
Sbjct:  866 TAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPG---SDGPPGRDGQPGHKGERGYP------------------GSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPS------GPQGIRGDKGEPGDKGHRGL---PGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQ 1092          

HSP 5 Score: 67.0106 bits (162), Expect = 1.755e-10
Identity = 90/217 (41.47%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGI------------RGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G  GA G  G  G PG  GS GP G+ GP G  G  G  G  GP G  G  G +G  G  GP+GLPGI            RG+ G+ G  G  GP G+PG  G  G PG  G  G  G  G  G  G  G +G+QG KG +G  G PG  G  G  G  G  G+ G  G+PG  G  G  GP+G  G  G +G  G  G IG +G  G  GP G
Sbjct:  409 GSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDG 625          

HSP 6 Score: 64.3142 bits (155), Expect = 1.185e-9
Identity = 118/292 (40.41%), Postives = 138/292 (47.26%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGP---KGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG------GEGVDGAPGIDGKDGSVG------------DPGAPGEHGSNGIPGS---------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GNR   GPAG++GP+G  GRPG     GP GL G  G  G  GK GP+G           G  GR G  GP GP G+ G +G  GP+G +G  G  GE+G  G AG  G  GP G  G  G  GP G+ G +G+ G  GP G  G  G  G  G +G PG  G+ G  G+PG  GP G +G  G  G  G        G  GAPG DG  G  G              G PGE G+ GIPG          +G  G TG  G  G  GA G PG  G  G +G  G +GP G
Sbjct:  427 GNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLP---------GIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSG 709          

HSP 7 Score: 64.3142 bits (155), Expect = 1.246e-9
Identity = 55/118 (46.61%), Postives = 68/118 (57.63%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G PG  G DG PG+ G PG   RDG+ G +G+ G PG  G TG  G PG  G  G AG  G+ G+PGP G  GP G+ G  G  G  G  G KG+PG+ G +GL G +G +G
Sbjct:  919 GSPGVNGAPGEAGRDGNPGSDGPPG---RDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSG 1033          

HSP 8 Score: 63.929 bits (154), Expect = 1.606e-9
Identity = 58/124 (46.77%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR------PGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            G  G+VGP GK GN G  G  G+ G  G  G  G  G QG  G  G PG+ G  G PG  G       PG+AG+ GD G PGP GPAGP G  G     G +GK G+ G+PG  GP G+ G+QG
Sbjct:  970 GPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGP---SGPVGKDGRSGQPGPVGPAGVRGSQG 1090          

HSP 9 Score: 63.929 bits (154), Expect = 1.703e-9
Identity = 70/187 (37.43%), Postives = 86/187 (45.99%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            GP G PG +G+ GPQG  GP G  GE                              PG  G  G +GP GS G  GE G  G+ G PG  G+ G  G  G  G  G  G +G++G  G +G+ G PG  G  G   +PGAPGE   NG PG  G++G  G +G +G  G  G  G DG +G  G  G
Sbjct:  103 GPRGPPGAVGAPGPQGFQGPAGEPGE------------------------------PGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKG---EPGAPGE---NGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAG 253          

HSP 10 Score: 63.1586 bits (152), Expect = 2.711e-9
Identity = 60/136 (44.12%), Postives = 67/136 (49.26%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP---------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G VGP+G  G PG  G PG +GV G SG DG +G  G  GV G PG  G NGTPG+ G  G+ G RG  G PGP G  G +GS G  G  G IG                 G  G PG  GP G  G  G+ G
Sbjct:  160 GERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPG 295          

HSP 11 Score: 61.6178 bits (148), Expect = 8.696e-9
Identity = 59/124 (47.58%), Postives = 64/124 (51.61%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVA---GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G +G+PG+ G  G PG  G  G  G  GE G  G  G PG+ G  G  G PG DGR GV    G RG TG  G RGP G  G  G PGLMG  G PG    PGN GP G  G  G+ G
Sbjct:  358 GSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGS---PGNVGPSGKEGPVGLPG 478          

HSP 12 Score: 60.4622 bits (145), Expect = 1.813e-8
Identity = 67/157 (42.68%), Postives = 79/157 (50.32%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIG------------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GA G  GLPG+ G  G  GP G            + G  GEPG  G  G  G  G  G  G  G  GP+G +G RG  G+ G  G  G PG+ G  GS G PGA G  G  G PG++GS G  G +G  G+AG  G PGL G  G+ G  G+ GP G
Sbjct:  313 GAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSG 469          

HSP 13 Score: 60.077 bits (144), Expect = 2.416e-8
Identity = 61/143 (42.66%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL---------------MGDIGKPGQK------GKPGNTGPKGLTGNQGITGP 2935
            G  G  G  G  G PGL G PG++G+PG  GR G  G  G  G  G  G  G NG  GR G PG+ G RG  G PG  GP+G EG  G PG+                G+IG PG K      GKPG  G  GL G +G  GP
Sbjct:  388 GSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGP 530          

HSP 14 Score: 60.077 bits (144), Expect = 2.697e-8
Identity = 54/122 (44.26%), Postives = 66/122 (54.10%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG  G +GP G  G  G  GFPG +G  G  G+ GERG  G  G  G PG  G NG     G PG  G++G  G+ GP GP G +G  G  G  G++GKPG++G PG  G  G  G +G  G
Sbjct:  480 DGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGA---QGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERG 598          

HSP 15 Score: 60.077 bits (144), Expect = 2.837e-8
Identity = 50/120 (41.67%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRD---GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            GP G PG  G DG PG  G PG  G  G +G +G  G PG+PG  G+ G  G D   G+PG  G++G+ G P         G  G PG  G  G PG++G+ G  GP G  G+ G  GP+
Sbjct:  139 GPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAP---------GENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPV 249          

HSP 16 Score: 58.9214 bits (141), Expect = 5.481e-8
Identity = 56/140 (40.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGV---------------PGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  GP+G  G PG+ G PG++G  G+ G  G  G+ G LG+               PG+   PGE G +G PG DG PG  G  G  G+ G  G  GP G+ GAPG  G +G  G+ G  G  GP G  G  G  GP
Sbjct:  862 GAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGP 1001          

HSP 17 Score: 58.9214 bits (141), Expect = 6.222e-8
Identity = 58/125 (46.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGL---TGNQGITGP 2935
            G DG  G  G PGN G  G  G +G  G +GR GE G  G  G+PG PG  G +G  G  G PG+ G  G  G  GPRG AG  G  G  G  GD GKPG++G PG  G +G     GN G  GP
Sbjct:  415 GADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGP 539          

HSP 18 Score: 58.9214 bits (141), Expect = 6.490e-8
Identity = 56/128 (43.75%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  821 GPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GP+G  GP G PG  G  G  G  G  G  G PG  GP G +G  G  GK G +G  G PG  G+ G VG  GA G  G+ G+PG KG +G +G  G+ G  GA G  G  G  G  G  G +G +GL
Sbjct:   97 GPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGL 224          

HSP 19 Score: 58.151 bits (139), Expect = 1.007e-7
Identity = 116/282 (41.13%), Postives = 140/282 (49.65%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTK---------------GDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGV---KGDSGPQGLN 1207
            G R V GP G +G  G  G PG KG  G +G  G  G+ G  G  G  G  G NG  G++G  G  G +G  G PG  G++G  G  GP GP G  G  G  G PG  GPKG +G +G  GP G  G RG++G  G  G  GP G PG  G  G  GA G+ GV+G PG+ GP G                 G+ G  G KG  G  G P   G  G+ G PG  GE G  G PG  GS G  GP G+ G+ G+ G PG DG  G+ G    +G +GP G+ 
Sbjct:  160 GERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEP---GSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIR 438          

HSP 20 Score: 57.7658 bits (138), Expect = 1.143e-7
Identity = 95/254 (37.40%), Postives = 119/254 (46.85%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRM-------GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP---GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
            GP G +GP G  G  GP+G +G+ GP G PG  G PGP G   P G  G         G S   G  G  GP G PG +G+ GPQG  GP G  GE                              PG  G  G +GP GS G  GE G  G+ G PG  G+ G  G  G  G  G  G +G++G  G +G+ G P   G+ G+ G+ G+ G PG+ G+ G+PG +G  G  GP G  G+ G+ G  G  G IG
Sbjct:   33 GPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGE------------------------------PGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIG 256          

HSP 21 Score: 57.3806 bits (137), Expect = 1.818e-7
Identity = 55/125 (44.00%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG---NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  GP G PG PG  G PG    +G PG  G +G +G  G  GV G  GE G  G PG  G PG +G  G+ G+PG RG  G  G  G  G  G+ G PG+ G  G +GP G  G  G  GP
Sbjct:  499 GFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGP 623          

HSP 22 Score: 56.9954 bits (136), Expect = 1.995e-7
Identity = 118/272 (43.38%), Postives = 136/272 (50.00%), Query Frame = 2
Query:  470 GRP------GPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXEL---GAAGPIGLPGIRGDLGSQGP---------------IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G P      G  GP G+TG  G  G+ G PGP G  GP GP G  G+ G  G  G QGP G+ G  G+ GP G  G KGP+GE G  G  G  G +G  G  G L   G+ G  GLPGI G LG  GP               +GS G  G PG  GR G PG+DG  G  G P      G KG+RG  G  G  G  GAPG  G  G     G+ G PG  GS G  G+ G +G +GPQGI G+    G PG  G  G+ G+KG SG QGL
Sbjct:  775 GPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQP------GHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGD---KGEPGDKGHRGLPGLKGYSGLQGL 1037          

HSP 23 Score: 56.9954 bits (136), Expect = 2.284e-7
Identity = 140/359 (39.00%), Postives = 163/359 (45.40%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG------------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL---DGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGID---GANGKPGSRGPRGS------QGLAGLPGKDGVVGP---FGLSGQPGANKPPGPQGKMGPRGLTG 1579
             G SG  G  G  GP+G  G  GS G +G  GP GPNG  GP G AG PG KG      E G  GP G  GI G  GS G  G            S G  G PG+    GFPGA G TG  G  G+ GP G  G  G +G +G  G  G  G  G+ G+ G PG  GE G +G PG+ G+ G  GPQG++G  G  G PG     G+ GI G  G+ GP G++G  G  G  G  GS G  G PG                                      GRDG PG D   G +G+PG +G RG        G AG PG  G VGP    G  G+PG     GP G +GPRG +G
Sbjct:  693 AGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKG------EKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGM---TGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEA------------------------------------GRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSG 1006          

HSP 24 Score: 56.225 bits (134), Expect = 4.376e-7
Identity = 52/116 (44.83%), Postives = 63/116 (54.31%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRD---GERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G+PG  G  G  GN+G PG  G     G  G++GK G PG  G  G  G PG  G PG  G+ G  G+ G  GP G  GSTG  G+ G  G  G+ G+PG  GP+GL G+ G  GP
Sbjct:  352 GEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGP 467          

HSP 25 Score: 55.4546 bits (132), Expect = 6.399e-7
Identity = 56/133 (42.11%), Postives = 65/133 (48.87%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP------------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  GP G  G PG  GF G  G PG  G+ G  G +G  G PG  GE G  G PGR G  GV G +G  G PG              G  G +G  GA G+ G+ G PG+ G PG  G +GL G +G  G
Sbjct:  100 GLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVG 232          

HSP 26 Score: 55.0694 bits (131), Expect = 8.819e-7
Identity = 52/120 (43.33%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G  G+ G  G  G PG DG  G QG PG  G  G +G+QG  G PG  G  G +GT G  G+PG  G+ G+ G PGP GP G  G+ G  G  G  G  G +G  G  GP G  G  G  
Sbjct:  514 GERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAV 633          

HSP 27 Score: 54.299 bits (129), Expect = 1.427e-6
Identity = 153/406 (37.68%), Postives = 181/406 (44.58%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGI------------TGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG------------TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            GP G QGP G  G PG  GP G           G  G  G  G  G  G+ GR G  G  GPQG  G PG  G  G +G+ G  G +G +G  G  G  G  G  G  G  G AG  GLPG RG +G+ GP G+ G +G  G  G  G  G+ G              G  G PG  GP G +G+ G+ G  G  G  G PG +G  G+ G  G PG  G+ G+PG +G  G              G  G  G+ G +G  G  G +G QG  G SG +G  G  G  GS GP G  G  G+PG+RG PG                              ADGR G+ G  G  G  G  G RG  G AG PG+ G++GP GL G PG     GP GK GP GL G
Sbjct:  115 GPQGFQGPAGEPGEPGQTGPAG---------PRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPG------------------------------ADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNV---GPSGKEGPVGLPG 478          

HSP 28 Score: 53.5286 bits (127), Expect = 2.599e-6
Identity = 58/136 (42.65%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMR---GDTGQPGPRGPAGPEGSTGAPGLMGDIGK------PGQKGKP---GNTGPKGLTGNQGITGP 2935
            + G  G  GP G  G  G  G PG  G  G +G  G RG  G  G+PG  G  G+ G PG  G  G AG+R   GD G+PG  G  GP G  G+PG +G  GK      PG  G+P   G  GP+G  GN G  GP
Sbjct:  368 EPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGP 503          

HSP 29 Score: 53.1434 bits (126), Expect = 3.077e-6
Identity = 113/281 (40.21%), Postives = 137/281 (48.75%), Query Frame = 2
Query:  764 LGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKG------DRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGV---VGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            +G  GP G  G  G+ G  G +G+ GP G  G  G+ G PG  G  G +G PG+ G  G++G        G+ G  G  G  G  GI G +G  G PG PG  G  G+PGS G            N G +G+ G  G+ GI G  G  GP G  G +G IG  GP G  G  G PG RG PG  G  G  G  G  G+QGP GP G+ G  G  G  G PG  G  G  G+ G  G  G  GLPG+ G+    GP G  G PG +   GP G +G RG +G
Sbjct:  351 VGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPG------------NVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSG 619          
BLAST of Fibrillar collagen vs. Ensembl Mouse
Match: Col3a1 (collagen, type III, alpha 1 [Source:MGI Symbol;Acc:MGI:88453])

HSP 1 Score: 126.716 bits (317), Expect = 1.175e-28
Identity = 77/252 (30.56%), Postives = 125/252 (49.60%), Query Frame = 2
Query: 3524 PMYSDD-----ANAANILGS--------DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSEN--PINKYISYGE-LSGIQRFDY--------VIDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEK----TEYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            P Y DD      N   I+ S        +++  P G++  PAR+C  LK     LK G Y++DPN G   DA +VFC METGETCI+    +  +  +  +     K++ +GE ++G  +F Y        V+D  QL FL+++S+RA+Q I   C N++A +++     +    +   N  E   + +   +Y V++D C   + E ++TV    +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1216 PYYGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDSGAEKKHVWFGESMNGGFQFSYGPPDLPEDVVD-VQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPIIDI---APYDIGGPDQEFGVDIGPVCF 1463          

HSP 2 Score: 64.6994 bits (156), Expect = 9.653e-10
Identity = 114/272 (41.91%), Postives = 138/272 (50.74%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTG------KPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGP---IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G R + GP G++GP G  G PG KG  G  G  G+ G+ G PG  G           G  G NGA GP GP G      +PGL G+ G +G +G +G +G+ GP G  G  G  G  G  GE+G AG     G PG RG+ G QG  G+ GP G PG  G  G  G  G  G+ G PG+IG  G  G  G  G  G  G  G PG   K+G+ G+PGA GE G  G PG  G +G  G  G  G  GA G PG  G  G  G +G +GP G+
Sbjct:  239 GERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKG---------ENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPG---KNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGI 498          

HSP 3 Score: 60.8474 bits (146), Expect = 1.539e-8
Identity = 114/266 (42.86%), Postives = 129/266 (48.50%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG---------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVK 1180
            L G   + G  G  GP GP G PG +G  GL G  G  G DG  G  G  GP GP G  G  G  GA G  GP G PG  GS G +G  GP+G  G QGP G  G  G  G K      G  GP G+PG  G +G++GP G         + GP GEPG  G  G PGA G  G +G PG+ GP      +G  GK G  G  GA G+ G  G  G  G  G  G NGIPG KG  G  G  G  G  G  G PG DG  G  G++
Sbjct:  282 LKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGK------GEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGP------KGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIR 535          

HSP 4 Score: 55.8398 bits (133), Expect = 4.901e-7
Identity = 46/97 (47.42%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGM---RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G SGR G  G++G  G PGI G  GM G PG  G  G  G    +G+TG PG +G  G  G  GAPG MG  G PG++G+PG  G  G  GN G  G
Sbjct:  230 GESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARG 326          

HSP 5 Score: 55.4546 bits (132), Expect = 7.106e-7
Identity = 107/252 (42.46%), Postives = 123/252 (48.81%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG 1147
            +KG   L G+    GP G +G  G  GRP      GL G  G  G DG  G  G  GP GP G  G  G  GA G  GP G PG  GS G +G  GP+G  G QGP G  G  G  G K      G  GP G+PG  G +G++GP         PG  G  G P   G  G SG PG  G  G  G RG +G+ G  G+ G  G DGKDGS G+PGA      NG+PG+ G +   GP G  G AG  G PG
Sbjct:  282 LKGENGLPGDNGAPGPMGPRGAPGERGRP------GLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGK------GEMGPAGIPGAPGLIGARGP---------PGPAGTNGIP---GTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGA------NGLPGAAGER---GPSGFRGPAGPNGIPG 500          

HSP 6 Score: 53.9138 bits (128), Expect = 1.753e-6
Identity = 116/256 (45.31%), Postives = 139/256 (54.30%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRG---IQGKKGGEGVDGAPGIDGKDGSVG---------DPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVG 1498
            G  GP G+PG  G  G +G  G +G +GE G     G  G +G+ G +G PG +GP G  G+RG   + G  G  G DGA G DG+ G  G          PGA GE G  G PGS GS G  G  G  G+AGA G PG  G  G  G KG+ GP G+ G  G+IG+ GPPG  G  G PG RG  G  G  G +G PG +G +G  G PGI G  G DG+DG PG  GANG PG+ G RG  G  G  G +G+ G
Sbjct:  248 GIKGPAGMPGFPGMKGHRGFDGRNGEKGETGA---PGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPG 500          

HSP 7 Score: 53.9138 bits (128), Expect = 1.753e-6
Identity = 54/143 (37.76%), Postives = 67/143 (46.85%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE---------------RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPA------GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G VGP G PG+   +G PG +G PG  G  G                +G+ G  G+PG PG  G  G PG  G  G+ G RG +G+PG  G        G  G  G+PG+ G  G+ G+ G PG  G  GL G  G  GP
Sbjct:  347 GAKGEVGPAGSPGS---NGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGP 486          

HSP 8 Score: 52.373 bits (124), Expect = 6.430e-6
Identity = 47/107 (43.93%), Postives = 57/107 (53.27%), Query Frame = 2
Query: 2621 DGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRD---GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
             G  G  G+PG  G  G RG  G  G  GIPG  G +G PG++   G PG  G RG+ G PG  GP G +G  G+PG  G  G PG  G+ G +G +G  G  GI G
Sbjct:  394 KGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPG 500          
BLAST of Fibrillar collagen vs. Ensembl Mouse
Match: Col1a1 (collagen, type I, alpha 1 [Source:MGI Symbol;Acc:MGI:88467])

HSP 1 Score: 124.02 bits (310), Expect = 8.285e-28
Identity = 70/221 (31.67%), Postives = 111/221 (50.23%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPIN-KYISYGE-LSGIQRFDYVIDNT-------QLMFLKMVSTRANQEIKIACNNMAVVEKTEY----PAIIFTDNNR-ELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            + I  P G++  PAR+C  LK   S  K G Y+IDPN G   DA +V+C METG+TC+ P Q S  + ++  S NP   K++ +GE ++    F+Y  + +       QL FL+++ST A+Q I   C N       +      A++   +N  EL  + +   +Y  + D C + +    +TV+   +  + RLPI D+  L   +   EF L +   CF
Sbjct: 1232 ENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMTDGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPDQEFGLDIGPACF 1452          

HSP 2 Score: 60.4622 bits (145), Expect = 2.083e-8
Identity = 107/291 (36.77%), Postives = 129/291 (44.33%), Query Frame = 2
Query:  440 AGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEG------------------EPGVGGRIGFPGADGI---------------TGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---------DGAPGIDGKDGSVGDPGAPGEHGS---NGIPGSKGSQGGTGPQGIIGNAG---ATGRPGLDGMIGI 1168
            AG +GP G  G PGP GP G                          G  GR G  G  G +G TG PG   S GP G  GP GP G+ G  G AGPPG +G  G +G  G  G  G PG  G+ G  GP G+ GP G                  E G  G  G PG  G+                GV G  G  GP+G +G+RG  G++G +G          +GAPG DG  G  G PGAPG  G+    G+PG +G+ G  GP+G  G+AG   A G PG DG  G+
Sbjct:  491 AGPKGPSGERGAPGPAGPKG------------------------SPGEAGRPGEAGLPGAKGLTGSPG---SPGPDGKTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAGKDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGARGL 754          

HSP 3 Score: 60.4622 bits (145), Expect = 2.136e-8
Identity = 45/99 (45.45%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G+ G  G  GR GERG  G  G  G+PG  G+ G  G  G  G+ G +GD G  GP+G  G  G  GAPG MG  G PG++G+PG  G  G  GN G  
Sbjct:  219 GDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGPPGTAGARGNDGAV 317          
BLAST of Fibrillar collagen vs. Ensembl Mouse
Match: Col2a1 (collagen, type II, alpha 1 [Source:MGI Symbol;Acc:MGI:88452])

HSP 1 Score: 115.546 bits (288), Expect = 2.781e-25
Identity = 89/298 (29.87%), Postives = 143/298 (47.99%), Query Frame = 2
Query: 3377 NGEMGLMGPMGVTGRDGPSGPHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAA---------NILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDY-------VIDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            +GE G +GP G  G  GP GP G   +       G          DP + M +D+A++            L S     ++I  P G++  PAR+C  LK      K G Y+IDPN G   DA +VFC METGETC+ P  ++  + ++  S++   K+I +GE ++G   F Y          N Q+ FL+++ST  +Q I   C N++A +++     +   +I   N+ E+  + +   +Y  +KD C   + +  +TV+   S  + RLPI D+  +       EF + +  VCF
Sbjct: 1125 SGETGPVGPPGSPGPPGPPGPPGPGIDMSAFAGLGQREKGP----DPMQYMRADEADSTLRQHDVEVDATLKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1418          

HSP 2 Score: 72.7886 bits (177), Expect = 3.425e-12
Identity = 100/253 (39.53%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV---------------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNA---GATGRPGLDGMI---------------------GIQGVKGDSGPQG 1201
            G +G  G  GP+G  G PG  GS G QG+ GP+G         P G  GP G  G  G  G +G  GE GAAG  G  G RGD+G +GP G+ G +G  G+                G +G PG  G TG  G PG  G TG  G  G  G  G +G  GA G  G+ G  GD GAPG  G +G PG +G  G TGP+G  G     GATG PG  G +                     G +GV+GDSGP G
Sbjct:  619 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPG 871          

HSP 3 Score: 62.3882 bits (150), Expect = 5.792e-9
Identity = 60/129 (46.51%), Postives = 73/129 (56.59%), Query Frame = 2
Query:  815 SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GP+G  G  GEPG+ G  G  G  G TG +G  G  GP G +G RG +G+ GG G  G PG  G  G+ G PG  G  G  G PG +G  G TGP+G  G+ G  G PGL G  G+ G  GD+GPQG
Sbjct:  377 ATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQG 505          

HSP 4 Score: 61.2326 bits (147), Expect = 1.314e-8
Identity = 95/282 (33.69%), Postives = 111/282 (39.36%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLG------------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            GPAG  GP G +G+PG KG  G                             G+ G  GA GPQGP+G PG    QGP G+ GPKG  G Q                     G  G  G PG  G +G                    GP G  G  G PG  G  G  G  G  G  G PG  GP+G  G  G QG  G  G+ G PG  G+ G  G PG  GE G  G PG+             G  G  G  G  G+ GA G PG DG  G++G +G++
Sbjct:  763 GPAGFAGPPGADGQPGAKGDQG---------------------------EAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQ---------------------GPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 993          

HSP 5 Score: 59.6918 bits (143), Expect = 2.980e-8
Identity = 59/138 (42.75%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPG---------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G                +G  G  G PG SG  G RG  G+ G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  698 DRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAG 835          

HSP 6 Score: 58.9214 bits (141), Expect = 6.535e-8
Identity = 54/131 (41.22%), Postives = 65/131 (49.62%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG---------------MNGTPGRDGRP---------GVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G++G  G+RGD G+ G  G PG+ G                NG  G  G P         G  G RG+TG PGP G AGP G+ G PG  GD G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  680 LQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPT 810          

HSP 7 Score: 58.151 bits (139), Expect = 1.122e-7
Identity = 112/307 (36.48%), Postives = 128/307 (41.69%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---------------------------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R   G  GLQGP G  G PG  GP G  GP G PG  G PG              G  G  GA G  GP G  G +G +GP+G  G  G                NGE+G  G  GP G  G +G  GE G  GP G  G  G  G+ G  G+ G +GE G  G  G PG  G +G  G  G  G TG KG RG QG  G  G                            DG  G+ G  G  G  G PG  G  G PG KG  G  GP G+ G  G  G  G  G++G+ G +G+ G  GL
Sbjct:  635 FPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGL------------QGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGL 929          

HSP 8 Score: 56.225 bits (134), Expect = 3.946e-7
Identity = 118/310 (38.06%), Postives = 140/310 (45.16%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGA---------------DGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGI------------DGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDG------------MIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  GP G  G  G+ GS G  G  GP G PG  G  G  GA                G+ G  G  G+ GP G +GD G +G +G  G DG  G+            +G+ G VG PG  G  G+ G PG +G  G  GP G  G  GA G+PG  G              G QG  G  GPQG  G +G  G+ G  G  G  G PG  G  G  G  G  G  G  G  G +GP G+ G  G  GR G PG+ G  G PG +G  G  G +GL   DG  GP GL+GQ G    PG +G+ G  GL G
Sbjct:  625 GLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGL---DGPPGPQGLAGQRGIVGLPGQRGERGFPGLPG 931          

HSP 9 Score: 55.8398 bits (133), Expect = 4.633e-7
Identity = 78/208 (37.50%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP+G  G+PG+ G +G QG  G  GP G Q                     GA GP G  G RG  G  G  G  GP GE G  G  GFPG DG+ G  G PG  GP+G  G +G  G  G  G  G PG  G  G  GD G  G+ G +G P               G  G  G  GP+G  G  G  G  GL G  G++G+ G  G
Sbjct:  382 GPKGQAGEPGIAGFKGDQGPKGETGPAGPQ---------------------GAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDG 568          

HSP 10 Score: 53.5286 bits (127), Expect = 2.284e-6
Identity = 50/116 (43.10%), Postives = 57/116 (49.14%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGR---------------DGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQ 2920
              G PG  G PGVSG                DGE G  GK G  G+PG  G  G PG  G PGV G RG  G  G +G AG      APG+ G+ G PG+ G PG  GP+GL G +
Sbjct:  155 FQGNPGEPGEPGVSGPMGPRGPPGPAGKPGDDGEAGKPGKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAG------APGVKGESGSPGENGSPGPMGPRGLPGER 264          

HSP 11 Score: 53.1434 bits (126), Expect = 3.340e-6
Identity = 56/132 (42.42%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G +GP+G+ G PG+ GF G+QG             PG +G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP+G    TG  G  GD G+PG+ G PG    +GLTG  G  GP 
Sbjct:  379 GPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSG---LTGPKGANGDPGRPGEPGLPGA---RGLTGRPGDAGPQ 504          

HSP 12 Score: 53.1434 bits (126), Expect = 3.543e-6
Identity = 60/153 (39.22%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVS------GRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDT---------------------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            GL G  G  G PG PG  G PG QG PG S      G  G  G  G  G PG  G  G +G PGRDG  GV G RG+T                           G+ G +GP GP G  GA G+ G  G  G KG+ G  G +GL G++G T
Sbjct:  916 GLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRGFT 1068          

HSP 13 Score: 52.7582 bits (125), Expect = 3.920e-6
Identity = 126/369 (34.15%), Postives = 154/369 (41.73%), Query Frame = 2
Query:  593 SGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTG------------------TKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPR------------------GSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            +G  G  GP GP+G  G  G+ G +G  GP GP G              GP G  G+ GA G  G  G +GD G+   QGP G+ GP+G  GV G  G  GA G  G +G PG  G  G                    G +G++G  G  G  G PG+ G  G+ G+ G PG+ G +G+ G  G QG  G +GI+G  G  G  G  G+ G  G  G  G  G +G  G  G VGPPG  GP G PG  G                                 + G DG PG DGA G  G RG                    G  G  G  G+ G  GP G SG  GA    GPQG  G +G +G+
Sbjct:  732 NGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAG------------FAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREG---------------------------------SPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGE 1055          

HSP 14 Score: 52.7582 bits (125), Expect = 4.302e-6
Identity = 79/211 (37.44%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGIT---------------------GVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG 1147
            G +G  GA G +G TG PG  G  GP G +G  G  G+QG  G  G  G           G  GP G PG +G  G  GP G+ G +G PG     GFPGA G                       G  G+ G  GP G  GD G+QG  G  G  G PG DG  G  G P   G  G+ G  G+PG +G +G  G  G  G  G  G PG
Sbjct:  745 GSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAP---------GPQGPSGAPGPQGPTGVTGPKGARGAQGPPGA---TGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 943          

HSP 15 Score: 52.7582 bits (125), Expect = 4.487e-6
Identity = 60/120 (50.00%), Postives = 67/120 (55.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            D G  G  G  G PG  G  G PG QG  GV+G  G RG QG  G  G PG  G  G PG +G PG AG  G  G+ GP   RG +GP G  G PGL G  G PG+KG+PG+ GP GL G
Sbjct:  782 DQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDG 901          

HSP 16 Score: 52.7582 bits (125), Expect = 4.487e-6
Identity = 99/313 (31.63%), Postives = 120/313 (38.34%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQG------------------------KKGGEGVDGAPGIDGKDGSVGDPG------------APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP+GP G+T                           G  G  GA GP G TG PG  G                       GP+G+ G  GP G                    G+ G  GP G PG +G+ G  GP G  GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G                        ++G  G DG PG DG  G  GD G             PG  G  G  G +G +G  G QG +G +G  G  G+ G  G +G KG+SG QG
Sbjct:  790 GDAGAPGPQGPSGAPGPQGPTGVT---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGR------------------AGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQG 1057          
BLAST of Fibrillar collagen vs. Ensembl Mouse
Match: Col2a1 (collagen, type II, alpha 1 [Source:MGI Symbol;Acc:MGI:88452])

HSP 1 Score: 113.62 bits (283), Expect = 1.354e-24
Identity = 89/298 (29.87%), Postives = 143/298 (47.99%), Query Frame = 2
Query: 3377 NGEMGLMGPMGVTGRDGPSGPHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAA---------NILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDY-------VIDNTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            +GE G +GP G  G  GP GP G   +       G          DP + M +D+A++            L S     ++I  P G++  PAR+C  LK      K G Y+IDPN G   DA +VFC METGETC+ P  ++  + ++  S++   K+I +GE ++G   F Y          N Q+ FL+++ST  +Q I   C N++A +++     +   +I   N+ E+  + +   +Y  +KD C   + +  +TV+   S  + RLPI D+  +       EF + +  VCF
Sbjct: 1193 SGETGPVGPPGSPGPPGPPGPPGPGIDMSAFAGLGQREKGP----DPMQYMRADEADSTLRQHDVEVDATLKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1486          

HSP 2 Score: 73.1738 bits (178), Expect = 2.371e-12
Identity = 100/253 (39.53%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV---------------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNA---GATGRPGLDGMI---------------------GIQGVKGDSGPQG 1201
            G +G  G  GP+G  G PG  GS G QG+ GP+G         P G  GP G  G  G  G +G  GE GAAG  G  G RGD+G +GP G+ G +G  G+                G +G PG  G TG  G PG  G TG  G  G  G  G +G  GA G  G+ G  GD GAPG  G +G PG +G  G TGP+G  G     GATG PG  G +                     G +GV+GDSGP G
Sbjct:  687 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPG 939          

HSP 3 Score: 62.3882 bits (150), Expect = 5.375e-9
Identity = 60/129 (46.51%), Postives = 73/129 (56.59%), Query Frame = 2
Query:  815 SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + GP+G  G  GEPG+ G  G  G  G TG +G  G  GP G +G RG +G+ GG G  G PG  G  G+ G PG  G  G  G PG +G  G TGP+G  G+ G  G PGL G  G+ G  GD+GPQG
Sbjct:  445 ATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQG 573          

HSP 4 Score: 61.6178 bits (148), Expect = 8.129e-9
Identity = 95/282 (33.69%), Postives = 111/282 (39.36%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLG------------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            GPAG  GP G +G+PG KG  G                             G+ G  GA GPQGP+G PG    QGP G+ GPKG  G Q                     G  G  G PG  G +G                    GP G  G  G PG  G  G  G  G  G  G PG  GP+G  G  G QG  G  G+ G PG  G+ G  G PG  GE G  G PG+             G  G  G  G  G+ GA G PG DG  G++G +G++
Sbjct:  831 GPAGFAGPPGADGQPGAKGDQG---------------------------EAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQ---------------------GPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 1061          

HSP 5 Score: 60.077 bits (144), Expect = 2.650e-8
Identity = 59/138 (42.75%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPG---------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G                +G  G  G PG SG  G RG  G+ G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  766 DRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAG 903          

HSP 6 Score: 58.9214 bits (141), Expect = 5.570e-8
Identity = 54/131 (41.22%), Postives = 65/131 (49.62%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG---------------MNGTPGRDGRP---------GVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G++G  G+RGD G+ G  G PG+ G                NG  G  G P         G  G RG+TG PGP G AGP G+ G PG  GD G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  748 LQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPT 878          

HSP 7 Score: 58.5362 bits (140), Expect = 6.879e-8
Identity = 112/307 (36.48%), Postives = 128/307 (41.69%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---------------------------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R   G  GLQGP G  G PG  GP G  GP G PG  G PG              G  G  GA G  GP G  G +G +GP+G  G  G                NGE+G  G  GP G  G +G  GE G  GP G  G  G  G+ G  G+ G +GE G  G  G PG  G +G  G  G  G TG KG RG QG  G  G                            DG  G+ G  G  G  G PG  G  G PG KG  G  GP G+ G  G  G  G  G++G+ G +G+ G  GL
Sbjct:  703 FPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGL------------QGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGL 997          

HSP 8 Score: 56.6102 bits (135), Expect = 2.840e-7
Identity = 118/310 (38.06%), Postives = 140/310 (45.16%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGA---------------DGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGI------------DGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDG------------MIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  GP G  G  G+ GS G  G  GP G PG  G  G  GA                G+ G  G  G+ GP G +GD G +G +G  G DG  G+            +G+ G VG PG  G  G+ G PG +G  G  GP G  G  GA G+PG  G              G QG  G  GPQG  G +G  G+ G  G  G  G PG  G  G  G  G  G  G  G  G +GP G+ G  G  GR G PG+ G  G PG +G  G  G +GL   DG  GP GL+GQ G    PG +G+ G  GL G
Sbjct:  693 GLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGL---DGPPGPQGLAGQRGIVGLPGQRGERGFPGLPG 999          

HSP 9 Score: 56.225 bits (134), Expect = 3.477e-7
Identity = 78/208 (37.50%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP+G  G+PG+ G +G QG  G  GP G Q                     GA GP G  G RG  G  G  G  GP GE G  G  GFPG DG+ G  G PG  GP+G  G +G  G  G  G  G PG  G  G  GD G  G+ G +G P               G  G  G  GP+G  G  G  G  GL G  G++G+ G  G
Sbjct:  450 GPKGQAGEPGIAGFKGDQGPKGETGPAGPQ---------------------GAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDG 636          

HSP 10 Score: 53.9138 bits (128), Expect = 1.849e-6
Identity = 50/116 (43.10%), Postives = 57/116 (49.14%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGR---------------DGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQ 2920
              G PG  G PGVSG                DGE G  GK G  G+PG  G  G PG  G PGV G RG  G  G +G AG      APG+ G+ G PG+ G PG  GP+GL G +
Sbjct:  223 FQGNPGEPGEPGVSGPMGPRGPPGPAGKPGDDGEAGKPGKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAG------APGVKGESGSPGENGSPGPMGPRGLPGER 332          

HSP 11 Score: 53.9138 bits (128), Expect = 2.226e-6
Identity = 126/369 (34.15%), Postives = 154/369 (41.73%), Query Frame = 2
Query:  593 SGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTG------------------TKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPR------------------GSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            +G  G  GP GP+G  G  G+ G +G  GP GP G              GP G  G+ GA G  G  G +GD G+   QGP G+ GP+G  GV G  G  GA G  G +G PG  G  G                    G +G++G  G  G  G PG+ G  G+ G+ G PG+ G +G+ G  G QG  G +GI+G  G  G  G  G+ G  G  G  G  G +G  G  G VGPPG  GP G PG  G                                 + G DG PG DGA G  G RG                    G  G  G  G+ G  GP G SG  GA    GPQG  G +G +G+
Sbjct:  800 NGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAG------------FAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREG---------------------------------SPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGE 1123          

HSP 12 Score: 53.5286 bits (127), Expect = 2.505e-6
Identity = 56/132 (42.42%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G +GP+G+ G PG+ GF G+QG             PG +G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP+G    TG  G  GD G+PG+ G PG    +GLTG  G  GP 
Sbjct:  447 GPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQGAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSG---LTGPKGANGDPGRPGEPGLPGA---RGLTGRPGDAGPQ 572          

HSP 13 Score: 53.5286 bits (127), Expect = 2.916e-6
Identity = 99/313 (31.63%), Postives = 120/313 (38.34%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQG------------------------KKGGEGVDGAPGIDGKDGSVGDPG------------APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP+GP G+T                           G  G  GA GP G TG PG  G                       GP+G+ G  GP G                    G+ G  GP G PG +G+ G  GP G  GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G                        ++G  G DG PG DG  G  GD G             PG  G  G  G +G +G  G QG +G +G  G  G+ G  G +G KG+SG QG
Sbjct:  858 GDAGAPGPQGPSGAPGPQGPTGVT---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGR------------------AGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQG 1125          

HSP 14 Score: 53.5286 bits (127), Expect = 2.916e-6
Identity = 60/153 (39.22%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVS------GRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDT---------------------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            GL G  G  G PG PG  G PG QG PG S      G  G  G  G  G PG  G  G +G PGRDG  GV G RG+T                           G+ G +GP GP G  GA G+ G  G  G KG+ G  G +GL G++G T
Sbjct:  984 GLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRGFT 1136          

HSP 15 Score: 53.1434 bits (126), Expect = 2.966e-6
Identity = 79/211 (37.44%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGIT---------------------GVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP---GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPG 1147
            G +G  GA G +G TG PG  G  GP G +G  G  G+QG  G  G  G           G  GP G PG +G  G  GP G+ G +G PG     GFPGA G                       G  G+ G  GP G  GD G+QG  G  G  G PG DG  G  G P   G  G+ G  G+PG +G +G  G  G  G  G  G PG
Sbjct:  813 GSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAP---------GPQGPSGAPGPQGPTGVTGPKGARGAQGPPGA---TGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 1011          

HSP 16 Score: 53.1434 bits (126), Expect = 3.481e-6
Identity = 60/120 (50.00%), Postives = 67/120 (55.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            D G  G  G  G PG  G  G PG QG  GV+G  G RG QG  G  G PG  G  G PG +G PG AG  G  G+ GP   RG +GP G  G PGL G  G PG+KG+PG+ GP GL G
Sbjct:  850 DQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPGDDGPSGLDG 969          
BLAST of Fibrillar collagen vs. UniProt/SwissProt
Match: sp|P02466|CO1A2_RAT (Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3)

HSP 1 Score: 140.584 bits (353), Expect = 4.095e-32
Identity = 71/233 (30.47%), Postives = 121/233 (51.93%), Query Frame = 2
Query: 3530 YSDDANAANILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPK-QSSFSKISYSENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVE----KTEYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            Y  DA   ++    +T+  P G++  PAR+C  L+ +    K   Y+IDPN G   DA +V+C   TGETCI  +  ++ +K +YS    NK++  GE ++G  +F+Y  +        TQL F+++++ RA+Q I   C N++A ++    +     I+   N+ EL  + +   +Y V+ D C   ++E  +TV+   +    RLP  D+  L       EFR+++  VCF
Sbjct: 1139 YEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWKSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTPAKNAYSRAQANKHVWLGETINGGSQFEYNAEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGRLNKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWDKTVIEYKTNKPSRLPFLDIAPLDIGGTNQEFRVEVGPVCF 1371          

HSP 2 Score: 73.1738 bits (178), Expect = 1.889e-11
Identity = 93/220 (42.27%), Postives = 110/220 (50.00%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQG---------PQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHG------PEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN---AGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  GA GP+G  G+PG  GS+G           G  GP GP+GE+G +G  G            E G+AGP G PG+RG  GS+G  G+ G      P G  G  G  G  G +G  G  G PG++GP G  G  G  G  G EG  G PGIDG+ G +G  G  GE G+ G PG KG  G  G  G  G+   AGA G PG DG  G QG  G  G QG
Sbjct:  340 GAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPG------------EPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQG 547          

HSP 3 Score: 70.8626 bits (172), Expect = 8.649e-11
Identity = 118/270 (43.70%), Postives = 135/270 (50.00%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPE---GRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGR---IGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            L G R + GP G  G  GP    G PGP G  G TG +G+PG  G  GP GP G +G  G  G  G  G  GP G  G PG  G  G  G  G  GP G +G  G AG  G  G  G  GE G  GP GLPG  G++   GP G  GP G PG+ GR   IG  G  G  G  G PG  GP+G  G  G +G  G  G  GAPG DG +G+ G PG  G  G  G  G  G  G  G  G  G AG  G+PG  G+ G  G+ G +GP+G
Sbjct:  329 LPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNV---GPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRG 595          

HSP 4 Score: 70.4774 bits (171), Expect = 1.223e-10
Identity = 85/209 (40.67%), Postives = 101/209 (48.33%), Query Frame = 2
Query:  590 RSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            + G  G  G QGP G+ G +G+ GP G  G KGP+GE G  G                 G AGP GL G  G LG  G   S G  G+PG+ G +G PG  GI G  G  G    +G  G  G  G  G+ G  G DG PG DG+ G  G+ G PG  G  G  G+ G  G  GP G  GN G  G  G  G +G  G +G SGPQG+ 
Sbjct:  821 KEGIRGPRGDQGPVGRTGEIGASGPPGFAGEKGPSGEPGTTGPP---------------GTAGPQGLLGAPGILGLPG---SRGERGQPGIAGALGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIR 1011          

HSP 5 Score: 68.5514 bits (166), Expect = 4.344e-10
Identity = 89/196 (45.41%), Postives = 104/196 (53.06%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEG---EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP G PG  G  GP+G  G  G +G  GP G+ G  G  G KG  G  G AG  GLPG RG  G  G  G+ GP G   EPG  G  G  G  G  G +G  G  GP+G +G RG  G+ G  G  G PG+ G  GS G PGA G  G  G PG++GS G  G +G  G+AG  G PGL G  G+ G  G+ GP G
Sbjct:  274 GPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAG 469          

HSP 6 Score: 67.3958 bits (163), Expect = 1.187e-9
Identity = 91/225 (40.44%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLG---------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGV---KGDSGPQGLN 1207
            G++G  G  G +G  G PG  G++G  G  GP GP G  G  G  G PG  GPKG +G +G  GP G  G RG+ G               + G  G+ G  G PGV G  G PG  GI G  G  G  GP G  G+ G  G KG  G  G P   G  G+ G PG  GE G  G PG  GS G  GP G+ G+ G+ G PG DG  G+ G    +G +GP G+ 
Sbjct:  217 GQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEP---GSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVR 438          

HSP 7 Score: 66.2402 bits (160), Expect = 2.434e-9
Identity = 63/141 (44.68%), Postives = 71/141 (50.35%), Query Frame = 2
Query:  776 GPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQ 1198
            GP G  G  G  GS GP G HG  GEPG  G +G  GA G  G SG      P G +GD+G  G KG  G+   PG+ G +G  G PG  G HG  G PG  G  G  GP G  G  G  GR G  G +G  GV+G  G Q
Sbjct:  961 GPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSG------PQGIRGDKGEPGDKGARGL---PGLKGHNGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPIGKDGRSGHPGPVGPAGVRGSQGSQ 1092          

HSP 8 Score: 65.855 bits (159), Expect = 3.328e-9
Identity = 160/406 (39.41%), Postives = 187/406 (46.06%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGI------------TGVSGMPGVIGPTGTKGDRGIQG---KKGGEGVDGAPGIDGKDGSVGDPG---APGEHGSNGIPGSKGSQGGTGPQGIIG------NAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            GP G QGP G  G PG  GP G           G  GP G  G  G  G+ GR G  G  GPQG  G PG  G  G +G+ G  G +G +G  G  G  G  G  G  G  G AG  GLPG RG +G+ GP G+ G +G  G  G  G  G+ G              G  G PG  GP G +G+ G+ G     G  G  GA G+ G  G+ G PG   APG  G  GIPG  G+ G TGP+G++G      + G TG  G  G  G QG  G SG +G  G  G  GS GP G  G  G+PG+RG PG                              ADGR G+ G  G  G  G  G RG  G AG PG+ G++GP GL G PG     GP GK GP GL G
Sbjct:  115 GPQGFQGPAGEPGEPGQTGPAG---------SRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPG------------------------------ADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNV---GPAGKEGPVGLPG 478          

HSP 9 Score: 65.4698 bits (158), Expect = 3.841e-9
Identity = 70/184 (38.04%), Postives = 86/184 (46.74%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITG---VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
            GP G PG +G+ GPQG  GP G  GE                              PG  G  GS+GP G  G  GE G  G+ G PG  G+ G     G PG  G  G KG RG  G  G +G  GA G+ G+ G+ G+ G PG+ G+ G+PG +G  G  GP G  G+ G+ G  G  G IG
Sbjct:  103 GPRGPPGAVGAPGPQGFQGPAGEPGE------------------------------PGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIG 256          

HSP 10 Score: 64.3142 bits (155), Expect = 8.427e-9
Identity = 119/283 (42.05%), Postives = 143/283 (50.53%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGP---KGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKG---DRGIQGKKGGEGVDGAPGIDGKDGSVGDPGA---------------PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GNR   GPAG++GP+G  GRPG     GP GL G  G  G  GK GP+G           G  GR G  GP GP G+ G +G  GP+G +G  G  GE+G  G AG  G  GP G  G  G  GP G+ G +G+ G  GP G  G  G  G  G +G PG  G+ G  G+PG  GP G +G   + G  G  G  G+ G  G  G DG+ G+ GA               PGE G+ GIPG KG +G TG +G IGN G  G  G  G IG  G  G SG +G
Sbjct:  427 GNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLP---------GIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGIRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAIGAPGPAGASGDRG 700          

HSP 11 Score: 64.3142 bits (155), Expect = 1.041e-8
Identity = 59/124 (47.58%), Postives = 67/124 (54.03%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR------PGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            G  G+VGP GK GN G  G  G+ G  G  G  G  G QG  G  G PG+ G  G PG  G       PG+AG+ GD G PGP GPAGP G  G     G IGK G+ G PG  GP G+ G+QG
Sbjct:  970 GPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGARGLPGLKGHNGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGP---SGPIGKDGRSGHPGPVGPAGVRGSQG 1090          

HSP 12 Score: 62.3882 bits (150), Expect = 3.758e-8
Identity = 55/118 (46.61%), Postives = 67/118 (56.78%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G PG  G DG PG+ G PG   RDG+ G +G+ G PG  G TG  G PG  G  G AG  G+ G+PGP G  GP G+ G  G  G  G  G KG+PG+ G +GL G +G  G
Sbjct:  919 GSPGVNGAPGEAGRDGNPGSDGPPG---RDGQPGHKGERGYPGNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGARGLPGLKGHNG 1033          

HSP 13 Score: 61.6178 bits (148), Expect = 5.404e-8
Identity = 59/124 (47.58%), Postives = 64/124 (51.61%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVA---GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G +G+PG+ G  G PG  G  G  G  GE G  G  G PG+ G  G  G PG DGR GV    G RG TG  G RGP G  G  G PGLMG  G PG    PGN GP G  G  G+ G
Sbjct:  358 GSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGS---PGNVGPAGKEGPVGLPG 478          

HSP 14 Score: 60.8474 bits (146), Expect = 1.010e-7
Identity = 58/136 (42.65%), Postives = 67/136 (49.26%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP---------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G VGP+G  G PG  G PG +G+ G +G DG +G  G  GV G PG  G NGTPG+ G  G+ G RG  G PGP G  G +GS G  G  G IG                 G  G PG  GP G  G  G+ G
Sbjct:  160 GERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPG 295          

HSP 15 Score: 60.4622 bits (145), Expect = 1.415e-7
Identity = 63/143 (44.06%), Postives = 73/143 (51.05%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGD---------TGQPGPRG---------PAGPEGSTGAPG---LMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  GNVGP GK G  GL   PG  G PG  G  G RG+ G +G PG  G +G  G PG  G PG+AG RG           G PGP+G         PAGP G  G PG     G++GKPG++G PG  G  G  G +G  GP
Sbjct:  460 GSPGNVGPAGKEGPVGL---PGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGP 599          

HSP 16 Score: 60.077 bits (144), Expect = 1.733e-7
Identity = 62/143 (43.36%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL---------------MGDIGKPGQK------GKPGNTGPKGLTGNQGITGP 2935
            G  G  G  G  G PGL G PG++G+PG  GR G  G  G  G  G  G  G NG  GR G PG+ G RG  G PG  GPAG EG  G PG+                G+IG PG K      GKPG  G  GL G +G  GP
Sbjct:  388 GSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGP 530          

HSP 17 Score: 59.6918 bits (143), Expect = 2.556e-7
Identity = 51/123 (41.46%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM---NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G+ GP G PG  G DG PG  G PG  G  G +G +G  G PG+PG  G+   NG  G  G+PG  G++G+ G P         G  G PG  G  G PG++G+ G  GP G  G+ G  GP+
Sbjct:  136 GSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAP---------GENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPV 249          

HSP 18 Score: 59.3066 bits (142), Expect = 3.494e-7
Identity = 57/129 (44.19%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2570 GLDGNVGPEG---KPGNPGLDGFPGNQGVPGVSGRDGE---RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  GP G   +PG  G  G  GN+G PG +G  G     G++GK G PG PG  G  G PG  G PG  G+ G  G+ G  GP G  GSTG  G+ G  G  G+ G+PG  GP+GL G+ G  GP 
Sbjct:  340 GAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPA 468          

HSP 19 Score: 58.5362 bits (140), Expect = 5.109e-7
Identity = 59/125 (47.20%), Postives = 65/125 (52.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGL---TGNQGITGP 2935
            G DG  G  G PGN G  G  G +G  G +GR GE G  G  G+PG PG  G  G  G  G PG+ G  G  G  GPRG AG  G  G  G  GD GKPG+KG PG  G +G     GN G  GP
Sbjct:  415 GADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGP 539          

HSP 20 Score: 58.5362 bits (140), Expect = 6.050e-7
Identity = 55/125 (44.00%), Postives = 65/125 (52.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG---NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  GP G PG PG  G PG    +G PG  G +G +G  G  GV G  GE G  G PG  G PG +G  G+ G+PG RG  G  G  G  G  G+ G PG+ G  G +GP G+ G  G  GP
Sbjct:  499 GFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGIRGPSGAPGP 623          

HSP 21 Score: 58.151 bits (139), Expect = 6.257e-7
Identity = 56/128 (43.75%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  821 GPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GP+G  GP G PG  G  G  G  G  G  G PG  GP G++G  G  GK G +G  G PG  G+ G VG  GA G  G+ G+PG KG +G  G  G+ G  GA G  G  G  G  G  G +G +GL
Sbjct:   97 GPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGL 224          

HSP 22 Score: 57.7658 bits (138), Expect = 9.873e-7
Identity = 139/346 (40.17%), Postives = 160/346 (46.24%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL---DGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGID---GANGKPGSRGPRGS------QGLAGLPGKDGVVGPFGLS---GQPGANKPPGPQGKMGPRGLTG 1579
            G +G  G  GP GP G PG  G  GP G NG  GP G  G  G  G  G KGPKG  G +G  GP+G  G  G  G  GP GS G  G PG+    GFPGA G TG  G  G+ GP G  G  G +G +G  G  G  G  G+ G+ G PG  GE G +G PG+ G  G  GPQG++G  G  G PG     G  GI G  G+ GP G+ G  G  G  G  GS G  G PG                                      GRDG PG D   G +G+PG +G RG        G AG PG  G VGP G     G+PG     GP G +GPRG +G
Sbjct:  700 GEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGSAGQPGAKGEKGTKGPKGENGIVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGM---TGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGIRGPRGDQGPVGRTGEIGASGPPGFAGEKGPSGEPGTTGPPGTAGPQGLLGAPGILGLPGSRGERGQPGIAGALGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEA------------------------------------GRDGNPGSDGPPGRDGQPGHKGERGYPGNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSG 1006          

HSP 23 Score: 55.8398 bits (133), Expect = 3.166e-6
Identity = 55/137 (40.15%), Postives = 67/137 (48.91%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGV---------------PGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  GP+G  G PG+ G PG++G  G  G  G  G+ G LG+               PG+   PGE G +G PG DG PG  G  G  G+ G  G  GP G+ GAPG  G +G  G+ G  G  GP G  G  G  GP
Sbjct:  865 GTAGPQGLLGAPGILGLPGSRGERGQPGIAGALGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGP 1001          

HSP 24 Score: 55.4546 bits (132), Expect = 5.210e-6
Identity = 56/133 (42.11%), Postives = 65/133 (48.87%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP------------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  GP G  G PG  GF G  G PG  G+ G  G +G  G PG  GE G  G PGR G  GV G +G  G PG              G  G +G  GA G+ G+ G PG+ G PG  G +GL G +G  G
Sbjct:  100 GLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVG 232          

HSP 25 Score: 55.0694 bits (131), Expect = 6.435e-6
Identity = 55/118 (46.61%), Postives = 63/118 (53.39%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            G  G+ G  G  G PG DG  G QG PG  G  G +G+QG  G PG  G  G +GT G  G+PG  G+ G+ G PGP GP    GP G +GA G  G IG  G  G PG  G KG  G
Sbjct:  514 GEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGIRGPSGAPGPDGNKGEAG 631          
BLAST of Fibrillar collagen vs. UniProt/SwissProt
Match: sp|Q01149|CO1A2_MOUSE (Collagen alpha-2(I) chain OS=Mus musculus OX=10090 GN=Col1a2 PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.215e-31
Identity = 69/233 (29.61%), Postives = 116/233 (49.79%), Query Frame = 2
Query: 3530 YSDDANAANILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPK-QSSFSKISYSENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIACNNMAVVEKTEY-----PAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            Y  DA   ++    +T+  P G++  PAR+C  L+ +        Y+IDPN G   DA +V+C   TGETCI  +  ++ +K SYS    NK++  GE ++G  +F+Y ++        TQL F+++++ RA+Q I   C N       E        ++   N+ EL  + +   +Y V+ D C   ++E  +T++   +    RLP  D+  L       EFR+++  VCF
Sbjct: 1139 YEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCF 1371          

HSP 2 Score: 73.559 bits (179), Expect = 1.479e-11
Identity = 88/205 (42.93%), Postives = 102/205 (49.76%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG------PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGN---AGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP G  G+ G  G  G  G  GP GP+GE+G +G  G            E G+AGP G PG+RG  GS+G        G  GP G  G  G  G  G +G  G  G PG++GP G  G  G  G  G EG  G PGIDG+ G +G  G  GE G+ G PG KG  G  G  G  G+   AGA G PG DG  G QG  G  G QG
Sbjct:  355 GPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPG------------EAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQG 547          

HSP 3 Score: 69.707 bits (169), Expect = 1.946e-10
Identity = 85/209 (40.67%), Postives = 100/209 (47.85%), Query Frame = 2
Query:  590 RSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            + G  G  G QGP G+ G  G+ GP G  G KGP+GE G  G                 G AGP GL G  G LG  G   S G  G PG+ G +G PG  GI+G  G  G    +G  G  G  G  G+ G  G DG PG DG+ G  G+ G PG  G  G  G+ G  G  GP G  GN G  G  G  G +G  G +G SGPQG+ 
Sbjct:  821 KEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAP---------------GTAGPQGLLGAPGILGLPG---SRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIR 1011          

HSP 4 Score: 67.3958 bits (163), Expect = 1.100e-9
Identity = 107/257 (41.63%), Postives = 121/257 (47.08%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQ 1198
             AGP GL G  G  G PG +G  GL G  G  G+ G  G  GP G +GP G +G  G NGA G  G  G PG   S GP G +G  G  GE+G                    G+ GP G  G  G  GS GP G HG  GEPG  G +G  GA G  G S      GP G +GD+G  G KG  G+   PG+ G  G  G PG  G HG  G PG  G  G  GP G  G  G  GR G  G +G  GV+G  G Q
Sbjct:  866 TAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPG---SDGPPGRDGQPGHKGERGYP------------------GSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPS------GPQGIRGDKGEPGDKGHRGL---PGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQ 1092          

HSP 5 Score: 67.0106 bits (162), Expect = 1.228e-9
Identity = 90/217 (41.47%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGI------------RGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G  GA G  G  G PG  GS GP G+ GP G  G  G  G  GP G  G  G +G  G  GP+GLPGI            RG+ G+ G  G  GP G+PG  G  G PG  G  G  G  G  G  G  G +G+QG KG +G  G PG  G  G  G  G  G+ G  G+PG  G  G  GP+G  G  G +G  G  G IG +G  G  GP G
Sbjct:  409 GSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDG 625          

HSP 6 Score: 64.3142 bits (155), Expect = 8.286e-9
Identity = 118/292 (40.41%), Postives = 138/292 (47.26%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGP---KGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG------GEGVDGAPGIDGKDGSVG------------DPGAPGEHGSNGIPGS---------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GNR   GPAG++GP+G  GRPG     GP GL G  G  G  GK GP+G           G  GR G  GP GP G+ G +G  GP+G +G  G  GE+G  G AG  G  GP G  G  G  GP G+ G +G+ G  GP G  G  G  G  G +G PG  G+ G  G+PG  GP G +G  G  G  G        G  GAPG DG  G  G              G PGE G+ GIPG          +G  G TG  G  G  GA G PG  G  G +G  G +GP G
Sbjct:  427 GNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLP---------GIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSG 709          

HSP 7 Score: 64.3142 bits (155), Expect = 8.717e-9
Identity = 55/118 (46.61%), Postives = 68/118 (57.63%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G PG  G DG PG+ G PG   RDG+ G +G+ G PG  G TG  G PG  G  G AG  G+ G+PGP G  GP G+ G  G  G  G  G KG+PG+ G +GL G +G +G
Sbjct:  919 GSPGVNGAPGEAGRDGNPGSDGPPG---RDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSG 1033          

HSP 8 Score: 63.929 bits (154), Expect = 1.123e-8
Identity = 58/124 (46.77%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR------PGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            G  G+VGP GK GN G  G  G+ G  G  G  G  G QG  G  G PG+ G  G PG  G       PG+AG+ GD G PGP GPAGP G  G     G +GK G+ G+PG  GP G+ G+QG
Sbjct:  970 GPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGP---SGPVGKDGRSGQPGPVGPAGVRGSQG 1090          

HSP 9 Score: 63.929 bits (154), Expect = 1.191e-8
Identity = 70/187 (37.43%), Postives = 86/187 (45.99%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            GP G PG +G+ GPQG  GP G  GE                              PG  G  G +GP GS G  GE G  G+ G PG  G+ G  G  G  G  G  G +G++G  G +G+ G PG  G  G   +PGAPGE   NG PG  G++G  G +G +G  G  G  G DG +G  G  G
Sbjct:  103 GPRGPPGAVGAPGPQGFQGPAGEPGE------------------------------PGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKG---EPGAPGE---NGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAG 253          

HSP 10 Score: 63.1586 bits (152), Expect = 1.896e-8
Identity = 60/136 (44.12%), Postives = 67/136 (49.26%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP---------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G VGP+G  G PG  G PG +GV G SG DG +G  G  GV G PG  G NGTPG+ G  G+ G RG  G PGP G  G +GS G  G  G IG                 G  G PG  GP G  G  G+ G
Sbjct:  160 GERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPG 295          

HSP 11 Score: 61.6178 bits (148), Expect = 6.083e-8
Identity = 59/124 (47.58%), Postives = 64/124 (51.61%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVA---GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G +G+PG+ G  G PG  G  G  G  GE G  G  G PG+ G  G  G PG DGR GV    G RG TG  G RGP G  G  G PGLMG  G PG    PGN GP G  G  G+ G
Sbjct:  358 GSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGS---PGNVGPSGKEGPVGLPG 478          

HSP 12 Score: 60.4622 bits (145), Expect = 1.268e-7
Identity = 67/157 (42.68%), Postives = 79/157 (50.32%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIG------------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GA G  GLPG+ G  G  GP G            + G  GEPG  G  G  G  G  G  G  G  GP+G +G RG  G+ G  G  G PG+ G  GS G PGA G  G  G PG++GS G  G +G  G+AG  G PGL G  G+ G  G+ GP G
Sbjct:  313 GAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSG 469          

HSP 13 Score: 60.077 bits (144), Expect = 1.690e-7
Identity = 61/143 (42.66%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL---------------MGDIGKPGQK------GKPGNTGPKGLTGNQGITGP 2935
            G  G  G  G  G PGL G PG++G+PG  GR G  G  G  G  G  G  G NG  GR G PG+ G RG  G PG  GP+G EG  G PG+                G+IG PG K      GKPG  G  GL G +G  GP
Sbjct:  388 GSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGP 530          

HSP 14 Score: 60.077 bits (144), Expect = 1.886e-7
Identity = 54/122 (44.26%), Postives = 66/122 (54.10%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG  G +GP G  G  G  GFPG +G  G  G+ GERG  G  G  G PG  G NG     G PG  G++G  G+ GP GP G +G  G  G  G++GKPG++G PG  G  G  G +G  G
Sbjct:  480 DGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGA---QGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERG 598          

HSP 15 Score: 60.077 bits (144), Expect = 1.984e-7
Identity = 50/120 (41.67%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRD---GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            GP G PG  G DG PG  G PG  G  G +G +G  G PG+PG  G+ G  G D   G+PG  G++G+ G P         G  G PG  G  G PG++G+ G  GP G  G+ G  GP+
Sbjct:  139 GPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAP---------GENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPV 249          

HSP 16 Score: 58.9214 bits (141), Expect = 3.834e-7
Identity = 56/140 (40.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGV---------------PGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  GP+G  G PG+ G PG++G  G+ G  G  G+ G LG+               PG+   PGE G +G PG DG PG  G  G  G+ G  G  GP G+ GAPG  G +G  G+ G  G  GP G  G  G  GP
Sbjct:  862 GAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGP 1001          

HSP 17 Score: 58.9214 bits (141), Expect = 4.352e-7
Identity = 58/125 (46.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGL---TGNQGITGP 2935
            G DG  G  G PGN G  G  G +G  G +GR GE G  G  G+PG PG  G +G  G  G PG+ G  G  G  GPRG AG  G  G  G  GD GKPG++G PG  G +G     GN G  GP
Sbjct:  415 GADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGP 539          

HSP 18 Score: 58.9214 bits (141), Expect = 4.540e-7
Identity = 56/128 (43.75%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  821 GPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GP+G  GP G PG  G  G  G  G  G  G PG  GP G +G  G  GK G +G  G PG  G+ G VG  GA G  G+ G+PG KG +G +G  G+ G  GA G  G  G  G  G  G +G +GL
Sbjct:   97 GPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGL 224          

HSP 19 Score: 58.151 bits (139), Expect = 7.043e-7
Identity = 116/282 (41.13%), Postives = 140/282 (49.65%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTK---------------GDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGV---KGDSGPQGLN 1207
            G R V GP G +G  G  G PG KG  G +G  G  G+ G  G  G  G  G NG  G++G  G  G +G  G PG  G++G  G  GP GP G  G  G  G PG  GPKG +G +G  GP G  G RG++G  G  G  GP G PG  G  G  GA G+ GV+G PG+ GP G                 G+ G  G KG  G  G P   G  G+ G PG  GE G  G PG  GS G  GP G+ G+ G+ G PG DG  G+ G    +G +GP G+ 
Sbjct:  160 GERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEP---GSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIR 438          

HSP 20 Score: 57.7658 bits (138), Expect = 7.994e-7
Identity = 95/254 (37.40%), Postives = 119/254 (46.85%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRM-------GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP---GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
            GP G +GP G  G  GP+G +G+ GP G PG  G PGP G   P G  G         G S   G  G  GP G PG +G+ GPQG  GP G  GE                              PG  G  G +GP GS G  GE G  G+ G PG  G+ G  G  G  G  G  G +G++G  G +G+ G P   G+ G+ G+ G+ G PG+ G+ G+PG +G  G  GP G  G+ G+ G  G  G IG
Sbjct:   33 GPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGE------------------------------PGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIG 256          

HSP 21 Score: 57.3806 bits (137), Expect = 1.272e-6
Identity = 55/125 (44.00%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG---NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  GP G PG PG  G PG    +G PG  G +G +G  G  GV G  GE G  G PG  G PG +G  G+ G+PG RG  G  G  G  G  G+ G PG+ G  G +GP G  G  G  GP
Sbjct:  499 GFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGP 623          

HSP 22 Score: 56.9954 bits (136), Expect = 1.396e-6
Identity = 118/272 (43.38%), Postives = 136/272 (50.00%), Query Frame = 2
Query:  470 GRP------GPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXEL---GAAGPIGLPGIRGDLGSQGP---------------IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G P      G  GP G+TG  G  G+ G PGP G  GP GP G  G+ G  G  G QGP G+ G  G+ GP G  G KGP+GE G  G  G  G +G  G  G L   G+ G  GLPGI G LG  GP               +GS G  G PG  GR G PG+DG  G  G P      G KG+RG  G  G  G  GAPG  G  G     G+ G PG  GS G  G+ G +G +GPQGI G+    G PG  G  G+ G+KG SG QGL
Sbjct:  775 GPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQP------GHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGD---KGEPGDKGHRGLPGLKGYSGLQGL 1037          

HSP 23 Score: 56.9954 bits (136), Expect = 1.598e-6
Identity = 140/359 (39.00%), Postives = 163/359 (45.40%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG------------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGL---DGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGID---GANGKPGSRGPRGS------QGLAGLPGKDGVVGP---FGLSGQPGANKPPGPQGKMGPRGLTG 1579
             G SG  G  G  GP+G  G  GS G +G  GP GPNG  GP G AG PG KG      E G  GP G  GI G  GS G  G            S G  G PG+    GFPGA G TG  G  G+ GP G  G  G +G +G  G  G  G  G+ G+ G PG  GE G +G PG+ G+ G  GPQG++G  G  G PG     G+ GI G  G+ GP G++G  G  G  G  GS G  G PG                                      GRDG PG D   G +G+PG +G RG        G AG PG  G VGP    G  G+PG     GP G +GPRG +G
Sbjct:  693 AGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKG------EKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGM---TGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEA------------------------------------GRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSG 1006          

HSP 24 Score: 56.225 bits (134), Expect = 3.061e-6
Identity = 52/116 (44.83%), Postives = 63/116 (54.31%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRD---GERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G+PG  G  G  GN+G PG  G     G  G++GK G PG  G  G  G PG  G PG  G+ G  G+ G  GP G  GSTG  G+ G  G  G+ G+PG  GP+GL G+ G  GP
Sbjct:  352 GEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGP 467          

HSP 25 Score: 55.4546 bits (132), Expect = 4.476e-6
Identity = 56/133 (42.11%), Postives = 65/133 (48.87%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP------------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G  GP G  G PG  GF G  G PG  G+ G  G +G  G PG  GE G  G PGR G  GV G +G  G PG              G  G +G  GA G+ G+ G PG+ G PG  G +GL G +G  G
Sbjct:  100 GLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVG 232          

HSP 26 Score: 55.0694 bits (131), Expect = 6.169e-6
Identity = 52/120 (43.33%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G  G+ G  G  G PG DG  G QG PG  G  G +G+QG  G PG  G  G +GT G  G+PG  G+ G+ G PGP GP G  G+ G  G  G  G  G +G  G  GP G  G  G  
Sbjct:  514 GERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAV 633          

HSP 27 Score: 54.299 bits (129), Expect = 9.982e-6
Identity = 153/406 (37.68%), Postives = 181/406 (44.58%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGI------------TGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG------------TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            GP G QGP G  G PG  GP G           G  G  G  G  G  G+ GR G  G  GPQG  G PG  G  G +G+ G  G +G +G  G  G  G  G  G  G  G AG  GLPG RG +G+ GP G+ G +G  G  G  G  G+ G              G  G PG  GP G +G+ G+ G  G  G  G PG +G  G+ G  G PG  G+ G+PG +G  G              G  G  G+ G +G  G  G +G QG  G SG +G  G  G  GS GP G  G  G+PG+RG PG                              ADGR G+ G  G  G  G  G RG  G AG PG+ G++GP GL G PG     GP GK GP GL G
Sbjct:  115 GPQGFQGPAGEPGEPGQTGPAG---------PRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPG------------------------------ADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNV---GPSGKEGPVGLPG 478          
BLAST of Fibrillar collagen vs. UniProt/SwissProt
Match: sp|Q9YIB4|CO1A1_CYNPY (Collagen alpha-1(I) chain OS=Cynops pyrrhogaster OX=8330 GN=COL1A1 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.490e-31
Identity = 83/250 (33.20%), Postives = 123/250 (49.20%), Query Frame = 2
Query: 3521 RPMYSDDANAANI--LGSDT-----------ISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPIN-KYISYGE-LSGIQRFDY-------VIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEY----PAIIFTDNNR-ELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            R   +DDAN      L  DT           I  P GT+  PAR+C  LK   S  K G Y+IDPN G   DA +V C METGETC+ P Q+S S+ ++  S+NP   K++ +GE +S   +F+Y          N QL FL++++T A+Q I   C N       E      A++   +N  E+  + +   +Y V +D C   + E  +TV+   +  + RLPI D+  +   +   EF + +  VCF
Sbjct: 1200 RYFRADDANVVRDRDLEVDTTLKSLSAQIENIRSPEGTRKNPARTCRDLKMCHSDWKSGDYWIDPNQGCNLDAIKVHCNMETGETCVYPSQASISQKNWYTSKNPREKKHVWFGETMSDGFQFEYGGEGSDPADVNIQLTFLRLMATEASQNITYHCKNSVAYMDQETGNLKKAVLLQGSNEIEIRAEGNSRFTYGVTEDGCTQHTGEWGKTVIEYKTTKTSRLPIIDIAPMDVGTPDQEFGIDIGPVCF 1449          

HSP 2 Score: 72.0182 bits (175), Expect = 4.697e-11
Identity = 69/148 (46.62%), Postives = 82/148 (55.41%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPE---GEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  G PG RG  G QGP G+ GP+   GEPG  G  G PGA G  G +G+ G  GP+G +G RG +G+ G  G  G  G  G  GS G PG+ G  G  G PG +GS G  GP+G  G +G  G PGL G  G+ G  G  GP G
Sbjct:  390 GIAGAPGFPGARGAPGPQGPAGAPGPKGNNGEPGAQGNKGEPGAKGEPGPAGVQGPPGPSGEEGKRGSRGEPGPAGPPGPAGERGGPGSRGFPGSDGASGPKGAPGERGSVGPAGPKGSTGESGRPGEPGLPGAKGLTGSPGSPGPDG 537          

HSP 3 Score: 63.5438 bits (153), Expect = 1.465e-8
Identity = 98/222 (44.14%), Postives = 114/222 (51.35%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGA---AGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFP------------GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G+ GR G  GP GP G  GL G+ G  GM G +G NG  G KGD GP G KG  G  GE GA   AGP GLPG RG  G+ GP G+ G +G PG  G  G              GA G  G  G  G  GP G +G+ G  G  G  G  G PG DG+ G  G  G+PG  G+ G PG++G+ G  GP G  G  G  G PG  G  G  G KG+ GP G+ 
Sbjct:  222 GKPGRPGERGPSGPQGARGLPGTAGLPGMKGHRGFNGLDGAKGDNGPAGPKGEPGNPGENGAPGQAGPRGLPGERGRPGAPGPAGARGNDGSPGAAGPPGPTGPTGPPGFPGAVGAKGDAGPQGSRGSEGPQGARGEPGAPGPAGAAGPSGNPGTDGQPGGKGATGSPGIAGAPGFPGARGAPGPQGPAGAPGPKGNNGEPGAQGNKGEPGAKGEPGPAGVQ 443          

HSP 4 Score: 63.1586 bits (152), Expect = 2.107e-8
Identity = 47/96 (48.96%), Postives = 54/96 (56.25%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G +G  G RG  G+ G PG PG  G+ G PG DG+PG  G  GD G  G  G  GP G TGAPG  G++G PG KG  G  GP G TG  G  G +
Sbjct:  774 GPAGPTGARGSPGERGEPGAPGPAGICGPPGADGQPGAKGESGDAGPKGDAGAPGPAGPTGAPGPAGNVGAPGPKGTRGAAGPPGATGFPGAAGRL 869          

HSP 5 Score: 61.6178 bits (148), Expect = 5.851e-8
Identity = 53/125 (42.40%), Postives = 63/125 (50.40%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFP------------GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            G  GP G+PG PG  G              G+ G  G  GR GERG  G  G  G+PG  G+ G  G  G  G+ G +GD G  GP+G  G  G  GAPG  G  G PG++G+PG  GP G  GN
Sbjct:  186 GFQGPSGEPGEPGAAGALGPRGLPGPPGKNGDDGESGKPGRPGERGPSGPQGARGLPGTAGLPGMKGHRGFNGLDGAKGDNGPAGPKGEPGNPGENGAPGQAGPRGLPGERGRPGAPGPAGARGN 310          
BLAST of Fibrillar collagen vs. UniProt/SwissProt
Match: sp|O46392|CO1A2_CANLF (Collagen alpha-2(I) chain OS=Canis lupus familiaris OX=9615 GN=COL1A2 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.759e-31
Identity = 69/233 (29.61%), Postives = 114/233 (48.93%), Query Frame = 2
Query: 3530 YSDDANAANILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSF-SKISYSENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIACNNMAVVEKTEY-----PAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI-SEFRLKLSKVCF 4174
            Y  DA   ++    +T+  P G++  PAR+C  L+ +      G Y+IDPN G   DA +V+C   TGETCI  +  +  +K  Y  + + K+I  GE ++G  +F+Y ++        TQL F+++++  A+Q I   C N       E        I+   N+ EL  + +   +Y V+ D C   ++E  +T++   +    RLPI D+      D   EFR+ +  VCF
Sbjct: 1133 YEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365          

HSP 2 Score: 79.7221 bits (195), Expect = 2.102e-13
Identity = 88/217 (40.55%), Postives = 106/217 (48.85%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGP---QGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG------PIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            +G  G  G+ G  G  G+PG  G+QGP    G  G +GPNGE                      G+AGP G PG+RG  GS+G      P G  GP G  G  G  G  G +G +G  G PG++GP G  G  G  G  G EG  G PGIDG+ G +G  GA GE G+ G PG KG  G  G  G  G+AG  G  G  G  G  G +G  GPQG+ 
Sbjct:  345 VGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGE---------------------AGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQ 540          

HSP 3 Score: 70.4774 bits (171), Expect = 1.191e-10
Identity = 116/300 (38.67%), Postives = 134/300 (44.67%), Query Frame = 2
Query:  413 TGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHG------------PEGEPG---------VGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGAT---------------GRPGLDGMIGIQGVKGDSGPQGL 1204
            +GN+   G AG QGP GP G  G +GPNG  G  G  G  G  G              G  G  GA GP G  G PG  G+ GP G+ GP G +G  G  G  GP G  G  G +G  G  GP+GLPGI G  G  GP G+ G            P G+PG         + G  G PG DG  G  G PG   P G +G +G QG  G  G  G PG  G  G VG PG  G  G  G+PG  G +G  GP G  G AG +               G  G  G++G  G  G SGP GL
Sbjct:  357 SGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSP------------GSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPG---PQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGL 641          

HSP 4 Score: 69.3218 bits (168), Expect = 2.463e-10
Identity = 95/220 (43.18%), Postives = 113/220 (51.36%), Query Frame = 2
Query:  590 RSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELG---AAGPIGLPGIRGDLGSQGPIG---------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGK---DGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            + G  G  G QGP G+ G  G+ GP G  G KGP+GE G  G  G PG +G  G  G LG   + G  GLPG+ G +G  GP+G           G  G PGV G  G  G DG  G  G PG  G  G KG+RG  G  G  G  GAPG  G     G  G+ G PG  GS G  G+ G +G +GPQGI G+    G PG  G  G+ G+KG +G QGL
Sbjct:  815 KEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGD---KGEPGEKGPRGLPGLKGHNGLQGL 1031          

HSP 5 Score: 68.9366 bits (167), Expect = 3.855e-10
Identity = 62/141 (43.97%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            G  GP+G  G  G  G  GP G HG  GEPG  G +G  GA G  G SG      P G +GD+G  G+KG  G+   PG+ G +G  G PG  G+HG  G PGS G  G  GP G  G AG  GR G  G +G  G++G  
Sbjct:  952 GNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSG------PQGIRGDKGEPGEKGPRGL---PGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGTVGPAGIRGSQ 1083          

HSP 6 Score: 68.9366 bits (167), Expect = 4.055e-10
Identity = 109/300 (36.33%), Postives = 125/300 (41.67%), Query Frame = 2
Query:  410 LTGNRYVAGP---------------------------------AGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGR---IGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            L G R + GP                                 AG QGP GP G  G +GPNG  G  G  G  G  G              G  G  GA GP G  G PG  G+ GP G+ GP G +G                    GE G  GP G PG  G++   GP G  GP G PG+ GR   IG  GA G  G  G PG  GPTG  G  G +G  G  G  GAPG DG +G+ G PG  G  G  G  G  G  G  G  G  G AG  G+PG  G+ G  G+ G +GP+G
Sbjct:  323 LPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSP------------GSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRP------------------GEPGLMGPRGFPGAPGNV---GPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRG 589          

HSP 7 Score: 65.0846 bits (157), Expect = 5.201e-9
Identity = 92/206 (44.66%), Postives = 112/206 (54.37%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G++G  G  G +G  G PG  G++G  G  GP GP G  G  G  G PG  GPKG IG +G  GP G  G RG++G  G  G  GP G PG  G  G  GA G+ GV+G PG+ GP G  G  G  G  G  G+ G PG  G  G  G+ G PG  G+ G PG  G +G  GP G  G+AG +G PGL G  G +G+ G  GP G+
Sbjct:  211 GQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGV 416          

HSP 8 Score: 63.929 bits (154), Expect = 1.211e-8
Identity = 54/123 (43.90%), Postives = 69/123 (56.10%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DG  G +GP G  G PG  GFPG +G  G  G++G++G  G  G  G PG  G NG     G PG  G++G  G+ GP GP G +G  G  G  G++GKPG++G PG  G  G  G +G  GP
Sbjct:  474 DGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGA---QGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGP 593          

HSP 9 Score: 62.7734 bits (151), Expect = 2.890e-8
Identity = 53/112 (47.32%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG  G DG PGN G PG   RDG+ G +G+ G PG  G  G  G PG  G  G  G  G+ G+PGP G  GP G+ G  G  G  G  G KG+PG  GP+GL G +G  G
Sbjct:  919 GAPGEAGRDGNPGNDGPPG---RDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNG 1027          

HSP 10 Score: 62.3882 bits (150), Expect = 3.336e-8
Identity = 60/127 (47.24%), Postives = 69/127 (54.33%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGD---IGKPGQKGKPGNT---GPKGLTGNQGITG 2932
            G +G  G  G  G PGL G PG++G+PG  G  G  G  G  G  G  G  G NG  GR G PG+ G RG  G PG  GPAG EG  G PG+ G    IG  G +G+PGN    GPKG TG+ G  G
Sbjct:  382 GPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNG 508          

HSP 11 Score: 60.4622 bits (145), Expect = 1.402e-7
Identity = 58/136 (42.65%), Postives = 67/136 (49.26%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP---------------GQKGKPGNTGPKGLTGNQGITG 2932
            G  G VGP+G  G PG  G PG +G+ G +G DG +G  G  GV G PG  G NGTPG+ G  G+ G RG  G PGP G  G +GS G  G  G IG                 G  G PG  GP G  G  G+ G
Sbjct:  154 GERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPG 289          

HSP 12 Score: 59.6918 bits (143), Expect = 2.347e-7
Identity = 58/130 (44.62%), Postives = 66/130 (50.77%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGP---------EGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G +G+ GN G  G  G QG PG SG +G+RG  G+ G  G  G  G+ G+PG  G PG  G  G  G PGPRG  GP          G  G PGLMG  G PG    PGN GP G  G  G+ G
Sbjct:  346 GEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPG---APGNVGPAGKEGPMGLPG 472          

HSP 13 Score: 59.3066 bits (142), Expect = 3.318e-7
Identity = 108/277 (38.99%), Postives = 122/277 (44.04%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGDLGSQGP---IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            E G+AG  G PG  G+ G +GP    GS GP G PG+    G PG+ G+ G  G  GV+GP G +G  G  G +G  G  G PG  G  G  G PGAPG  G  G  G  G  G  G  G IG AGA G PG    IG  G KG +G  G NG  G  G  G  G+ GP GN G                                    A G  G  G+ G  G+ G  GP G QGL G  G  G VG  G  G PG    PGP G  G RG  G+
Sbjct:  362 EPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGL---RGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPG---NIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNG------------------------------------AQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGE 596          

HSP 14 Score: 58.5362 bits (140), Expect = 5.370e-7
Identity = 74/181 (40.88%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
            GP G PG  G+ GPQG  GP G  GE G  G AG  G  GP G  GE G  G  G PG RG +G QG                     A G  G  G+PG       KG RG  G  G +G  GAPG+ G+ G+ G+ G PG+ G+ G+PG +G  G  GP G  G+ G+ G  G  G IG
Sbjct:   97 GPRGPPGASGAPGPQGFQGPAGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQG---------------------ARGFPGTPGLPGF------KGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIG 250          

HSP 15 Score: 57.7658 bits (138), Expect = 8.989e-7
Identity = 57/123 (46.34%), Postives = 63/123 (51.22%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGR------PGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQ 2920
            G  G VGP GK GN G  G  G+ G  G  G  G  G QG  G  G PGE G  G PG  G       PG+AG  GD G PG  GPAGP G  G     G  GK G+ G+PG  GP G+ G+Q
Sbjct:  964 GPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGP---SGPAGKDGRTGQPGTVGPAGIRGSQ 1083          

HSP 16 Score: 55.4546 bits (132), Expect = 4.041e-6
Identity = 60/129 (46.51%), Postives = 63/129 (48.84%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGT------PGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G DG  G  G PG  G  G  G +G  G SGR GE G  G  G PG PG  G  G       PG DGRPG  G  G  G+PG  G  GP+G TG PG  GD G  G  G  G  GP G  G QG  GP 
Sbjct:  409 GADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQ 537          

HSP 17 Score: 54.6842 bits (130), Expect = 8.283e-6
Identity = 54/128 (42.19%), Postives = 64/128 (50.00%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQG------------KLGVPGI---PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G PG  GL G  G +G+PGV+G  GE G  G             +G PG+   PGE G +G PG DG PG  G  G  G+ G  G  GP G+ GAPG  G +G  G+ G  G  GP G  G  G  GP
Sbjct:  868 GAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGP 995          
BLAST of Fibrillar collagen vs. UniProt/SwissProt
Match: sp|P02458|CO2A1_HUMAN (Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3)

HSP 1 Score: 136.732 bits (343), Expect = 6.530e-31
Identity = 77/242 (31.82%), Postives = 123/242 (50.83%), Query Frame = 2
Query: 3527 MYSDDANAANILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            +   DA     L S     ++I  P G++  PAR+C  LK      K G Y+IDPN G   DA +VFC METGETC+ P  ++  K ++  S++   K+I +GE ++G   F Y  D       N Q+ FL+++ST  +Q I   C N++A +++     +   +I   N+ E+  + +   +Y  +KD C   + +  +TV+   S  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1248 LRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDI---APMDIGGPEQEFGVDIGPVCF 1486          

HSP 2 Score: 69.707 bits (169), Expect = 1.873e-10
Identity = 98/253 (38.74%), Postives = 117/253 (46.25%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGV---------------GGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNA---GATGRPGLDGMI---------------------GIQGVKGDSGPQG 1201
            G +G  G  GP+G  G PG  GS G QG+ GP+G         P G  GP G  G  G  G +G  GE GAAG  G  G RGD+G +GP G+ G +G  G+                G +G PG  G  G  G PG  G TG  G  G  G  G +G  GA G  G+ G  GD GAPG  G +G PG +G  G TGP+G  G     GATG PG  G +                     G +G +GDSGP G
Sbjct:  687 GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPG 939          

HSP 3 Score: 63.929 bits (154), Expect = 1.265e-8
Identity = 95/282 (33.69%), Postives = 113/282 (40.07%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLG------------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            GPAG  GP G +G+PG KG  G                             G+ G  GA GPQGP+G PG    QGP G+ GPKG  G Q                     G  G  G PG  G +G                    GP G+ G  G PG  G  G  G  G  G  G PG  GP+G +G  G QG  G  G+ G PG  G+ G  G PG  GE G  G PG+             G  G  G  G  G+ GA G PG DG  G++G +G++
Sbjct:  831 GPAGFAGPPGADGQPGAKGEQG---------------------------EAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQ---------------------GPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGET 1061          

HSP 4 Score: 59.6918 bits (143), Expect = 2.289e-7
Identity = 114/307 (37.13%), Postives = 131/307 (42.67%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---------------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPG---------------------IDGKDGSVGDPGAPGEHGSNGI------PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R   G  GLQGP G  G PG  GP G +GP G PG  G PG              G  G  GA G  GP G  G +G +GP+G  G  G                NGE+G  G  GP G  G +G  GE G  GP G  G  G  G+ G  G+ G +GE G  G  G PG  G +G  G  G  G TG KG RG QG  G  G  GA G                      DG  G+ GD G PG  G  G+      PG KG  G  GP G  G  G  G  G  G++G+ G +G+ G  GL
Sbjct:  703 FPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGL------------QGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGL 997          

HSP 5 Score: 59.6918 bits (143), Expect = 2.576e-7
Identity = 58/138 (42.03%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPG---------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG PG  G                +G  G  G PG +G  G RG  G+ G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  766 DRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAG 903          

HSP 6 Score: 58.5362 bits (140), Expect = 5.191e-7
Identity = 54/131 (41.22%), Postives = 66/131 (50.38%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG---------------MNGTPGRDGRPGVAGM---------RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            L G PG +G  G++G  G+RGD G+ G  G PG+ G                NG  G  G PG AG          RG+TG PGP G AGP G+ G PG  G+ G+ GQKG  G  GP+G +G  G  GP 
Sbjct:  748 LQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPT 878          

HSP 7 Score: 57.7658 bits (138), Expect = 8.687e-7
Identity = 79/208 (37.98%), Postives = 93/208 (44.71%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP+G TG+PG+ G +G QG  G  GP G Q                     GA GP G  G RG  G  G +G  GP GE G  G  GFPG DG+ G  G PG  GP+G  G +G  G  G  G  G PG  G  G  GD G  G+ G +G P               G  G  G  GP+G  G  G  G  GL G  G++G+ G  G
Sbjct:  450 GPKGQTGEPGIAGFKGEQGPKGEPGPAGPQ---------------------GAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDG 636          

HSP 8 Score: 55.0694 bits (131), Expect = 5.469e-6
Identity = 71/202 (35.15%), Postives = 84/202 (41.58%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGV---SGMPGV---------------------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVG------------------------DPGAPGEHGS---------NGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AGP G    RG  G+QGP G  G  G PG  G  G PG DGI G    +G PG+                     +GP G  G+ GI G KG +G  G PG  G  G+ G                        + GAPG  G           G PG +G  G  GP+G  G+ G  G PGL G  G+ G  GD+GPQG
Sbjct:  375 GEAGPTG---ARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQG 573          

HSP 9 Score: 55.0694 bits (131), Expect = 6.926e-6
Identity = 56/134 (41.79%), Postives = 73/134 (54.48%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKG---KPGNTGPKGLTGNQGI 2926
            G +GP+G+ G PG+ GF G QG             PG +G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP   AGP+G+ G PG  G+ G PG +G   +PG+ GP+G  G  G 
Sbjct:  447 GPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGA 580          

HSP 10 Score: 54.6842 bits (130), Expect = 8.699e-6
Identity = 103/304 (33.88%), Postives = 121/304 (39.80%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQG------------------------KKGGEGVDGAPGIDGKDGSVGDPG---APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP+GP G+T                           G  G  GA GP G TG PG  G                       GP+G  G  GP G                    GE G  GP G PG +G+ G  GP G+ GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G                        ++G  G DG PG DG  G  GD G   A G  G+ G PGS G  G TG QG  G AGA G  G  G  G +G++G  GP+G
Sbjct:  858 GDAGAPGPQGPSGAPGPQGPTGVT---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGR------------------AGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRG 1116          
BLAST of Fibrillar collagen vs. TrEMBL
Match: A0A4D6G2T3 (Collagen F-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=colF-5 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.202e-62
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM
Sbjct:   36 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 160          
BLAST of Fibrillar collagen vs. TrEMBL
Match: A0A0R3X7W1 (Fibrillar collagen NC1 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9621 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.214e-49
Identity = 86/228 (37.72%), Postives = 133/228 (58.33%), Query Frame = 2
Query: 3503 IIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLT---LGSDSDISEFRLKLSKVCFS 4177
            I YD     ++DD   A  +G+D+IS P G++ LPAR+C HL   + HL DG Y+IDPNGG + DA EV+C ++ GETC++PK+  F   SY +    +   + EL   + F+Y +   QL FLKM+S++A Q + + C   +  E     A + +DN+   ++D    SY V++DECQ+M      T++ V    +RLP+RD++   LG  S   E  ++LS VC++
Sbjct:  709 ITYDM---AFNDDTAQAQFIGTDSISKPDGSRKLPARTCKHLAQINPHLPDGLYWIDPNGGSIKDAIEVYCHIQMGETCVTPKEDDFEAKSYPDANNYEEHWFHELQSSKMFEYNVPGDQLAFLKMLSSKAKQNVTVVCRQSSQEE-----ARLLSDNDHYFSRDGELFSYNVLRDECQHMKDSYGYTIMEVVSRPQRLPLRDISFHDLGGQS--KEVGVRLSPVCYA 926          

HSP 2 Score: 66.2402 bits (160), Expect = 6.465e-7
Identity = 72/165 (43.64%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQ 1108
            GPQG  G+PG  G QGP+G  GP GP+G Q                     GA GPIG  G  GD G  G  G  G  G PG  G  G+PG  GI G+SG PG  GPTG KG  G  G  G +G  GA G  G  G  G  G PGE G  G  G  G  G  G Q
Sbjct:  531 GPQGVQGQPGERGPQGPEGEPGPAGPDGPQ---------------------GATGPIGPTGPVGDRGEPGSDGPEGQPGAPGEPGPRGYPGRAGIDGLSGRPGRPGPTGHKGWMGPPGDPGPKGQRGAKGTTGPRGHQGPTGLPGEQGPQGFEGPMGEMGYQGDQ 674          

HSP 3 Score: 63.1586 bits (152), Expect = 5.916e-6
Identity = 97/288 (33.68%), Postives = 117/288 (40.62%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG------------------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             KGP+   G +   GPAG+QGP G  G PGP+G                                    R G  G  G TG PG  G++GP G+ G  GP G    +                     GP G PG  G  G+QGP+G                    GP G  G  GR G    DG+ G  GM G  GP GT G  G  G     G DG  G  G DG++G PG  G  G +G PG +G++G  GP G IG  G +G  G DG+ G  G  G  GP+G
Sbjct:  219 AKGPSGKMGPQGNVGPAGVQGPPGARGLPGPRG------------------------------------RKGPSGKPGRTGPPGRDGNRGPPGIPGEDGPRGATMIQSAG--------------RALTGPQGPPGDTGYTGAQGPVGPVGAPGEMGPPGPPGANGEDGPVGPEGPRGRDGI---DGVPGRPGMRGRPGPRGTDGPAGPDGLP---GDDGPMGPRGPDGAMGAPGERGPAGPDGAPGEEGAKGPVGPVGPIGFRGPSGSAGKDGIKGPTGDPGPDGPKG 450          
BLAST of Fibrillar collagen vs. TrEMBL
Match: A0A0R3SR95 (Fibrillar collagen NC1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7666 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.239e-49
Identity = 98/275 (35.64%), Postives = 147/275 (53.45%), Query Frame = 2
Query: 3371 GPNGEMGLMGPMGVTGRDGPSG--PHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCFS 4177
            GP GEMG  G  G TG  GP+G               P  P     + YD     ++DDA  A  +G+++I  P G++ LPAR+C HL   + HL DG Y+IDPN G + DA EV+C+++TGETC+ PK   F   SY +    +   + EL G + FDY +   QL FLK++S++A Q + + C   +  E     A + +DN++  ++D     Y V++DECQ M      TV+ V    +RLP+RD++     D+     E  ++LS VC++
Sbjct: 1050 GPMGEMGYQGEQGPTGLPGPAGRDGPQGPPGPVGYPGPPGPPGPPAVTYDM---AFNDDAAQAQYIGTESIDKPDGSRKLPARTCKHLAHVNPHLPDGYYWIDPNAGSIKDAIEVYCQIQTGETCVKPKTDDFETKSYQDVSAGEEHWFHELQGSKLFDYNVPGDQLSFLKLLSSKAKQNVTVVCRQSSQDE-----ARLMSDNDQYFSRDGELFRYTVLRDECQYMKDSYGYTVMEVVSRPQRLPVRDISF---RDVGGTAKEVGVRLSSVCYA 1313          

HSP 2 Score: 70.4774 bits (171), Expect = 3.929e-8
Identity = 94/223 (42.15%), Postives = 106/223 (47.53%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGF------------------------PGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            G  G +GA GP GP G  G  G  G  G +G KGP G+ GP G  GP G  GP G  G  GA G  G PG  G  G QGP G  G +G+PG+ G+ G                          G DG  GV G PG  GP G +GD G  G    +G  GA G  G  G VG+ G PGE G +GIPG  G Q   GP+G  G AG  G PG  G  G  G KG
Sbjct:  792 GTPGEDGAKGPTGPVGPIGFRGPAGKPGKDGTKGPTGDIGPDGPKGPTGPSGPAGNDGPPGAQGVQGQPGRAGPQGRQGPAGKAGAQGKPGIKGKQGVVGPSGPAGPQGPPGPAGEDGEPGPDGEDGPQGVQGPPGERGPQGPEGDAGATGP---DGAQGATGPMGPTGPVGERGEPGEDGPDGIPGRPGEQ---GPRGYPGRAGTNGLPGRAGKQGPIGHKG 1008          

HSP 3 Score: 66.2402 bits (160), Expect = 6.612e-7
Identity = 86/231 (37.23%), Postives = 100/231 (43.29%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKG---DRGIQGK---KGGEGV------------------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            MG  G++GA GP G  G PG+ G+ G  G  GP GP G                      +G  GP G PG  G  G  G IG  GP+G  G  G  G  G  G  GV G PG  GP G +G     G QGK   KG +GV                  DG PG DG+DG  G  G PGE G  G  G  G+ G  G QG  G  G TG       +G +G  G+ GP G+
Sbjct:  770 MGPRGQDGAMGPSGERGPPGVDGTPGEDGAKGPTGPVGP---------------------IGFRGPAGKPGKDGTKGPTGDIGPDGPKGPTGPSGPAGNDGPPGAQGVQGQPGRAGPQGRQGPAGKAGAQGKPGIKGKQGVVGPSGPAGPQGPPGPAGEDGEPGPDGEDGPQGVQGPPGERGPQGPEGDAGATGPDGAQGATGPMGPTG------PVGERGEPGEDGPDGI 973          

HSP 4 Score: 63.1586 bits (152), Expect = 5.468e-6
Identity = 116/273 (42.49%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQG---------------PQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
             +GPA   G     GP G  GPDGP+G  GP GP G              GP G  G QG  GR G  GR G  G  G  GKPG+ G QG               P G +G  GP+GE GP+G  GPPG +GP+GP G+ GA GP G  G  G +G  GP+G  G  GE G  G  G PG  G  G  G  G  G  G  G +G  G KG  G  G PG  G+ GS G PG  G  G  G+PG +G QG  GP G +G  G  G  GL G  G
Sbjct:  811 FRGPAGKPGKDGTKGPTGDIGPDGPKGPTGPSGPAG------------NDGPPGAQGVQGQPGRAGPQGRQGPAGKAGAQGKPGIKGKQGVVGPSGPAGPQGPPGPAGEDGEPGPDGEDGPQGVQGPPGERGPQGPEGDAGATGPDGAQGATGPMGPTGPVGERGEPGEDGPDGIPGRPGEQGPRGYPGRAGTNGLPGRAGKQGPIGHKGWMGPPGDPGPKGQRGSKGPPGPRGHQGPTGLPGEQGPQGLEGPMGEMGYQGEQGPTGLPGPAG 1071          
BLAST of Fibrillar collagen vs. TrEMBL
Match: W6UR32 (Collagen alpha-2(I) chain OS=Echinococcus granulosus OX=6210 GN=EGR_01301 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.879e-49
Identity = 87/226 (38.50%), Postives = 128/226 (56.64%), Query Frame = 2
Query: 3503 IIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDIS-EFRLKLSKVCFS 4177
            I YD     ++DD   A  +G+D+I  P G++ LPAR+C HL   + HL DG Y+IDPN G + DA EV+C +  GETC++PK   F   SYS+  I +   + EL G + F+Y +   QL FLKM+ST+ANQ + + C   +  E     A + +DN+    +D     Y V++DECQ M      TV+ V    +RLP+RD++       S E  ++LS VC++
Sbjct: 1096 ITYDM---AFNDDTAQAQYIGTDSIDKPDGSRKLPARTCKHLALVNPHLPDGFYWIDPNAGSIKDAIEVYCHIRMGETCVAPKADDFEVRSYSDINIGEEHWFHELQGSKLFEYNVPEDQLAFLKMLSTKANQNVTVVCRQSSQEE-----ARLMSDNDHYFLRDGELFRYNVLRDECQYMKDSYGYTVMEVVSRPQRLPVRDISFRDVGGYSKEVGVRLSPVCYA 1313          
BLAST of Fibrillar collagen vs. TrEMBL
Match: A0A0R3TPT3 (Fibrillar collagen NC1 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9498 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.327e-48
Identity = 110/285 (38.60%), Postives = 160/285 (56.14%), Query Frame = 2
Query: 3371 GPNGEMGLMGPMGVTG------------RDGPSGPHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCFS 4177
            GP G  G MG MG  G            RDGP GP G +GN GPPGPPGPPA    + YD     ++DDA  A  +G+D+I  P G++ LPAR+C HL   + HL DG Y+IDPN G + DA EV+C ++TGETC+ PK   F   SY +    +   + +L G + FDY +   QL FLK++S++A Q + + C   +  E     A + +DN++  +++     Y V++DECQ++      TVL V    +RLP+RD++     D+     E  ++LS VC++
Sbjct: 1081 GPQGLEGPMGEMGYQGEQGPSGLPGPPGRDGPQGPSGPIGNQGPPGPPGPPA----VTYDM---AFNDDAAQAQFIGTDSIDKPDGSRKLPARTCKHLAHVNPHLPDGYYWIDPNAGSIKDAIEVYCHIQTGETCVKPKTDDFETKSYQDVSAGEEHWFHDLQGSKLFDYNVPGDQLSFLKLLSSKAKQNVTVVCRQSSQDE-----ARLMSDNDQYFSRNGELFRYNVLRDECQHLKDSYGNTVLEVVSRPQRLPVRDISF---RDVGGATKEVGVRLSPVCYA 1350          

HSP 2 Score: 67.3958 bits (163), Expect = 3.445e-7
Identity = 92/220 (41.82%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFP------------------GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGK---DGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            G  G +G  GP GP G  G  G  G  G +G KGP G+ GP G  G  G  GP G  G  GA G  G PG  G  G QGP G  G +G+PG+ G+ G                    G  G+TG  G  GV GP G +G +G +G  G  G DGA G  G     G VGD G PGE G +G PG  G Q   GP+G  G AG  G PG  G  G  G KG
Sbjct:  829 GAPGEDGPKGPTGPAGPIGFRGPAGSSGKDGAKGPTGDVGPDGPKGSSGPSGPVGNDGPPGAQGVQGQPGRTGPQGRQGPAGKAGAQGKPGIKGKQGNEGPQGPSGPQGPPGPAGEVGEPGLTGEVGPQGVQGPPGERGPQGPEGDAGETGPDGAQGATGPMGPTGPVGDRGEPGEDGPDGKPGKPGEQ---GPRGYPGRAGMNGLPGRAGKPGPIGHKG 1045          
BLAST of Fibrillar collagen vs. Ensembl Cavefish
Match: col1a1a (collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-9102])

HSP 1 Score: 135.191 bits (339), Expect = 2.618e-31
Identity = 83/254 (32.68%), Postives = 127/254 (50.00%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA--------NILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSF-SKISYSENPI--NKYISYGE--LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKTE---YPAIIFTDNNR-ELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            DP R   +DDAN            L S     ++I  P GTK  PAR+C  LK      K G Y+IDP+ G   DA +V+C METGETC+ P QS    K  Y+   I   K++ +GE    G Q F+Y  +       N QL FL+++ST A+Q I   C N++A +++       A++   +N  E+  + +   +Y V +D C + +    +TV+   +  + RLPI D+  +   +   EF +++  VCF
Sbjct: 1182 DPFRHFRADDANVMRDRDLEVDTTLKSLSQQIESIRSPDGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCNQDAIKVYCNMETGETCVYPSQSDIPQKNWYTSKNIKEKKHVWFGEAMTDGFQ-FEYGGEESKPEDVNIQLTFLRLMSTEASQNITYHCKNSIAYMDQASGNLKKALLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1434          

HSP 2 Score: 62.7734 bits (151), Expect = 3.364e-9
Identity = 82/214 (38.32%), Postives = 91/214 (42.52%), Query Frame = 2
Query:  602 NGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV------------------GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
            +G  G QGP G PG  G  GPQG  G  G  GEQG  G               E GA GP G  G RG  G +G  G  GP G  G  G  G  GA G +G SG PG  GP G      +QG  G  G  G PG+ G  G                    GD G PG  G  G  G++G  G  G  G  G AG  G PG DG  G +G  GD+
Sbjct:  612 SGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPG---------------EAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPG------LQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDT 804          

HSP 3 Score: 59.3066 bits (142), Expect = 3.517e-8
Identity = 52/129 (40.31%), Postives = 64/129 (49.61%), Query Frame = 2
Query: 2609 NPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP---------------------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
             PG+ GFPG +G  G +G+ GERG  G +GV G P                     GE G  G PG  G PG  G  G+ G+PG +G  G  G+TG  G  GD G PG++G PG  GP G  G+ G  G
Sbjct:  560 QPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAG 688          

HSP 4 Score: 58.5362 bits (140), Expect = 5.596e-8
Identity = 89/231 (38.53%), Postives = 103/231 (44.59%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGL---------------PGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADG------------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +GA GP+G  G+ G  G+ GP+G  G  G NGE G  G  G  G  G  GP G+ GA GP G                PG+ G  G +G  G  G  GE GV G IG  GA G              G SG  G  GP G  G +G+ G +G  G  G PG  G  G  G  G  G  G  G PG +G+ G  GP G  G+ GA G  G  G  G  G  G  GP GL 
Sbjct:  481 GADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQ 711          

HSP 5 Score: 58.151 bits (139), Expect = 8.903e-8
Identity = 57/142 (40.14%), Postives = 67/142 (47.18%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPE------GSTGAPGLMGDIGK------------------PGQKGKPGNTGPKGLTGNQG 2923
            GL G  G  G+PG PG  G PG  G  G SG  G+RG  G+ G PG  G  G  G+PG  G  G  G  G +G PG +GP G +      G+ G PGL GD G                    G KG+PG  GP G TG +G
Sbjct:  628 GLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARG 769          

HSP 6 Score: 57.7658 bits (138), Expect = 1.099e-7
Identity = 140/397 (35.26%), Postives = 167/397 (42.07%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXX---ELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRG---------------------IQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGS---------NGIPGSKGSQGGTGP---QGIIGNAGATG---RPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGL------AGLPGKDGVVG------------------PFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
              G  G  G  G +G +G PG+ G  GP G  G +G  GE G  G  GPPG +G  G  G     GA+GP G PG RG  G+ GP G+ G   EPG  G  G PG+ G+TG  G PG  G TG  G  G                       G KG  G  G PG  G  G++G  GAPG+ G           G  G +G QG  GP   QG+ G  GATG   +PG  G+ G  G  G SG +G  G  G  G+ GP G +G  G+PG                                    A G DG  G  GA+G PG++GP G QG+      AGLPG  G  G                    G  G+PGA  P GP G  GP G  G+
Sbjct:  419 EAGAPGAKGEAGVKGESGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATG---EPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPG------------------------------------AAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGE 776          

HSP 7 Score: 56.9954 bits (136), Expect = 1.871e-7
Identity = 46/101 (45.54%), Postives = 55/101 (54.46%), Query Frame = 2
Query: 2585 VGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPG 2887
            +GP G  G PG +G  G  G PG   R GERG  G  G  G PG  G+ G  G  G  G+ G +GDTG  GP+G  G  G  G PG MG  G PG++G+ G
Sbjct:  201 MGPRGAAGPPGKNGEDGESGKPG---RPGERGPSGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEPGAPGENGTPGAMGPRGLPGERGRAG 298          

HSP 8 Score: 55.4546 bits (132), Expect = 5.703e-7
Identity = 60/151 (39.74%), Postives = 70/151 (46.36%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---------------ERGDQGKLGVPGI------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRG---PAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G  G+ G PG  G  G  GV G  G+DG               ERG+QG  G PG             PG+ G  G PG  G  G +G RGD G PG RG   PAGP GS G+PG  G+ G  G+ G  G  G +G  G QG+ G
Sbjct:  565 GFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPG 715          

HSP 9 Score: 54.6842 bits (130), Expect = 8.697e-7
Identity = 55/156 (35.26%), Postives = 67/156 (42.95%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGM------------------------------------RGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            + GL G  G  G  G+ G  GFPG +G PG +G  G RG  G  G  G  GE+G +G PG  G PG+ GM                                    +GD G+PG  GP GP G+ G PG  G+ G PG  G  G  G  G  G +G
Sbjct:  644 EQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKG 799          

HSP 10 Score: 53.5286 bits (127), Expect = 2.164e-6
Identity = 98/248 (39.52%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXX---XXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV------------------------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGI---------------IGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G SG +GA G QGP G  G+ G +G  G+ G KG  G+QG KG  G  G  GP   +G  GE GAAGP+G  G RG      P G  G  G PG  G  G PGADG  G  G PG                         +G TG KG RG  G  G  G  GA G  G  G  G+ G PG  G +G  G KG++G TGP G                 G  GA G PG  G+ G QG+ G  G  GL
Sbjct:  694 GESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARG------PPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGL 935          

HSP 11 Score: 53.1434 bits (126), Expect = 2.584e-6
Identity = 56/128 (43.75%), Postives = 68/128 (53.12%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPR---GPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            + G  G  G +G+ G  G  G PG QG PG +G +G+RG +G+ G  G  G  G  G PG  G PG  G  G  G PG R   G  GP+G+TG PG  G+ G PG KG  G+ G  G  G  G TGP 
Sbjct:  416 NTGEAGAPGAKGEAGVKGESGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPA 543          

HSP 12 Score: 52.7582 bits (125), Expect = 3.471e-6
Identity = 51/112 (45.54%), Postives = 59/112 (52.68%), Query Frame = 2
Query: 2597 GKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G  G PG QG+PG  G  GE G  G+ G+PG  G TG +G+ G  G P      G+ G PGP GP G  GS GA G  G  G+ G  G PG  GP GL G  G  G
Sbjct:  613 GERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFP------GERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERG 718          

HSP 13 Score: 52.7582 bits (125), Expect = 3.591e-6
Identity = 55/119 (46.22%), Postives = 63/119 (52.94%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            GN G  G PG  G  G  G  G PGV G  G  G++GK G  G PG  G  G PG  G PG  G  G  G  GP+G  G  G  GA G  G  G+PG+ G+PG  G KG+TG+ G  GP
Sbjct:  415 GNTGEAGAPGAKGEAGVKGESGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGP 533          

HSP 14 Score: 51.9878 bits (123), Expect = 6.008e-6
Identity = 46/119 (38.66%), Postives = 58/119 (48.74%), Query Frame = 2
Query: 2630 PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTG------------------APGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            PG +G PG  G  G +G  G+ G PG  G  G  G PGR+G PG+ G +G TG PG  GP G  G+TG                   PG+MG  G  G  G+ G  G +G+ G  G+ G
Sbjct:  474 PGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAG 592          
BLAST of Fibrillar collagen vs. Ensembl Cavefish
Match: col1a1b (collagen, type I, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4400])

HSP 1 Score: 118.627 bits (296), Expect = 2.390e-26
Identity = 76/253 (30.04%), Postives = 124/253 (49.01%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAAN-------ILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSS--FSKISYSEN-PINKYISYGEL--SGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            DP R   +DDA+  +        L S     + I  P GT+  PAR C  L+      K  +YF+DPN G   DA +VFC METGETC+ P + S        S+N    K+I +GE    G Q F Y  +       N Q+ F++++S +A+Q I   C N++A +++     +   ++   N+ E+  + +   +Y V +D C + +    +TV+   +  + RLPI D+  +   +   EF +++  VCF
Sbjct: 1072 DPLRSYRADDASVRDRDSEVDTTLKSLSQKIENIRSPEGTQKNPARMCRDLRMCHPEWKS-SYFVDPNQGSPLDAIKVFCNMETGETCVQPTRGSVPLKNWYLSKNFREKKHIWFGESMPEGFQ-FQYGSEGSDPEDVNIQMTFMRLMSNKASQNITYHCKNSIAYMDQASGNLKKALLLQGSNDVEIRAEGNSRSTYTVSEDGCTSHTGTWGKTVIEYQTAKTTRLPIIDIAPMDIGAPDQEFGVEVGAVCF 1322          

HSP 2 Score: 64.3142 bits (155), Expect = 1.110e-9
Identity = 60/136 (44.12%), Postives = 72/136 (52.94%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQG---KLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI------------GKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  G  G+PG PGL G  G  G PG  G DG+ G  G   + G  G PG  G  GTPG  G PG  G  G++G+PG RG  GP GS GAPG  GD+            G+ G++G  G +G +GL G QG TG
Sbjct:  431 GSQGATGEPGRPGEPGLPGSKGMTGAPGSPGPDGKTGPTGAPGQDGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGVTGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATG 566          

HSP 3 Score: 63.929 bits (154), Expect = 1.505e-9
Identity = 104/280 (37.14%), Postives = 127/280 (45.36%), Query Frame = 2
Query:  389 SVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXR--MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPG---VIGPTGTKGDRGI------------------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGM 1159
            + +G A   G +   GP G  GP GP+G  GP G  G  G +G+PG  G  GP G      P  R   G +G  GA G  G  G+PGL GS+G  G  G  GP+G+                         GP G PG  G  G  GP GS G    PGV   +GFPG  G  G SG PG   V GPTG+ G  G                   +G++GG G  G  G+ G  G+ G+ G PGE G  G+PG +G+    GP G IG  G+TG  G DG 
Sbjct:  360 NTQGDAGAQGAKGEPGPKGESGPAGPQGLSGPSGEEGKRGARGEPGGAGPLGPPGARTSGAPGERGPNGPAGSQGATGEPGRPGEPGLPGSKGMTGAPGSPGPDGK------------------------TGPTGAPGQDGASGPPGPAGSRG---TPGV---MGFPGPKGADGESGKPGERGVTGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATGEAGKPGEQGDRGLPGERGA---PGPAGPIGARGSTGPAGNDGA 606          

HSP 4 Score: 62.7734 bits (151), Expect = 3.061e-9
Identity = 58/134 (43.28%), Postives = 64/134 (47.76%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  G  GKPG  G  G PG +G PG +G  G RG  G  G  G              G  GM G PG  G  G+ G RGD G  GP+GP G  G  GA G  G IG PG  G PG+ G  G  G  G+TGP
Sbjct:  560 GTQGATGEAGKPGEQGDRGLPGERGAPGPAGPIGARGSTGPAGNDGARGEPGAAGAPGGVGPAGMQGMPGERGAGGMPGARGDRGDAGPKGPDGAVGKDGARGPAGAIGAPGPSGAPGDKGEPGPVGTAGVTGP 693          

HSP 5 Score: 62.3882 bits (150), Expect = 4.514e-9
Identity = 46/100 (46.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G +GR GERG  G  G  G PG  G+ G  G  G PG+ G +GD G  GP+G AG  G  G  G MG  G PG++G+PG  GP  L G +G  G
Sbjct:  155 GDDGEAGKAGRPGERGAAGPQGARGFPGTPGLPGIKGHRGFPGLDGAKGDAGIAGPKGEAGSPGENGVAGAMGPRGLPGERGRPGPPGPSLLQGARGNDG 254          

HSP 6 Score: 58.151 bits (139), Expect = 8.757e-8
Identity = 47/103 (45.63%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 2624 GFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G PG +G  G +G  G  G+ G+ G PG+PG  GM G PG  G  G  G  G  GQ G  GP GP GS G PG+MG  G  G  G+ G  G +G+TG  G  G
Sbjct:  419 GAPGERGPNGPAGSQGATGEPGRPGEPGLPGSKGMTGAPGSPGPDGKTGPTGAPGQDGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGVTGPTGSVG 521          

HSP 7 Score: 55.4546 bits (132), Expect = 5.663e-7
Identity = 84/241 (34.85%), Postives = 107/241 (44.40%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGK---PGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGA---------------------PGEHGSNGIPGSKGSQGGTGPQG---------IIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
             G  G++GA GP GP G    PG+MG  GP+G +G  G  GE+G                    G  G +G PG  GD+G+ G  G  GP GE G  G  G  G  G+ G  G  G  G  G +GDRG+ G++G  G  G  G  G  G  G+ GA                     PGE G+ G+PG++G +G  GP+G           G AGA G PG  G  G +G  G  G  G+ 
Sbjct:  469 TGAPGQDGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGV------------------TGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATGEAGKPGEQGDRGLPGERGAPGPAGPIGARGSTGPAGNDGARGEPGAAGAPGGVGPAGMQGMPGERGAGGMPGARGDRGDAGPKGPDGAVGKDGARGPAGAIGAPGPSGAPGDKGEPGPVGTAGVT 691          

HSP 8 Score: 54.299 bits (129), Expect = 1.076e-6
Identity = 59/128 (46.09%), Postives = 69/128 (53.91%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA------PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG  G  GP G  G PG+ GFPG +G  G SG+ GERG  G  G  G PG+ G  G PG  G  G AG +G+ G  GP G  G  G+ GA      PG  GD G PG++G PG  GP G  G+ G  G
Sbjct:  475 DGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGVTGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATGEAGKPGEQGDRGLPGERGAPGPAGPIGARGSTGPAG 602          

HSP 9 Score: 53.1434 bits (126), Expect = 2.380e-6
Identity = 94/229 (41.05%), Postives = 111/229 (48.47%), Query Frame = 2
Query:  602 NGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXX-----------------------XXXXXXXXELGAAGPIGLPGIRGDLG---SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGAT---GRPGLDGMIGIQGVKGDSGPQG 1201
             G  G QG  G+PG  G  GP G  G  GP+GE+G +G  G PGG                        G +G  GE G  G  GLPG +G  G   S GP G  GP G PG  G  G PG  G  G  G+ G  GP G  G+ G  G++G  G  G+ G  GKDG VG PGAPG  G  G  G +G  G +G QG+ G  GAT   G+PG  G  G+ G +G  GP G
Sbjct:  362 QGDAGAQGAKGEPGPKGESGPAGPQGLSGPSGEEGKRGARGEPGGAGPLGPPGARTSGAPGERGPNGPAGSQGATGEPGRPGEPGLPGSKGMTGAPGSPGPDGKTGPTGAPGQDGASGPPGPAGSRGTPGVMGFPGPKGADGESGKPGERGVTGPTGSVGAPGKDGDVGAPGAPGPAGPAGEKGEQGGAGPSGFQGLPGTQGATGEAGKPGEQGDRGLPGERGAPGPAG 590          

HSP 10 Score: 53.1434 bits (126), Expect = 2.483e-6
Identity = 45/105 (42.86%), Postives = 57/105 (54.29%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G PG +G  G+ G  G+RGD G  G  G  G+ G  G  G  G PG +G  GD G+PGP G AG  G  G+ G  G++G PG  G  G  G  G  G++G TG
Sbjct:  624 MQGMPGERGAGGMPGARGDRGDAGPKGPDGAVGKDGARGPAGAIGAPGPSGAPGDKGEPGPVGTAGVTGPRGSAGERGEVGPPGPAGFAGPPGAAGQPGSKGETG 728          
BLAST of Fibrillar collagen vs. Ensembl Cavefish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 114.39 bits (285), Expect = 6.083e-25
Identity = 66/235 (28.09%), Postives = 107/235 (45.53%), Query Frame = 2
Query: 3530 YSDDANAANI-LGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSF-SKISYSENPINKYISYGE-LSGIQRFDYVIDN-------TQLMFLKMVSTRANQEIKIACNNMAVVEKTE-----YPAIIFTDNNRELTKD-DHHLSYKVIKDEC--QNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            Y  DA   ++    D +  P G+K  PAR+C  ++ +        Y+IDPN G   DA + FC   TG+TCI     S   K  Y  +   K+I +GE ++G   F Y  +        TQL F+++++ +A Q +   C N       E        ++   N+ EL  + +   ++ V++D C  Q  + + ++TV+   +    RLPI D+  L       EF L +  VCF
Sbjct: 1121 YEVDATIKSLNTQIDNLLSPEGSKKNPARTCRDIRLSHPDWTS-FYWIDPNQGCTMDAIKAFCDFSTGQTCIHAHPESIPRKNWYRSSQEKKHIWFGETINGGTEFGYNDETLSPQSMATQLAFMRLLANQAVQNVTYHCKNSIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSVLEDGCTLQRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCF 1354          

HSP 2 Score: 75.0998 bits (183), Expect = 5.750e-13
Identity = 97/208 (46.63%), Postives = 111/208 (53.37%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQG---PQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G +GR G  GP G  G PG  G+QG   P+G+ G  GP G QG  G  GPPG  G KG  GE G  GP G+ G +G LGSQG  G  G  GE G+ G  G  G  G  G SG PG  GP+G  G  G+ G +G  G +G+P   G DG  G PGA G  G  G PGS G  G  G  G +G +GA GRPG  G  G  G  G  GP G
Sbjct:  779 GAAGRVGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSP---GNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAG 983          

HSP 3 Score: 70.4774 bits (171), Expect = 1.247e-11
Identity = 81/203 (39.90%), Postives = 100/203 (49.26%), Query Frame = 2
Query:  614 GPQGPTGKPGL---MGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSN---GIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GP G TG PG    +G  GP G+ GP GP G Q                     G  GP GL   RGD+G  GP G +G  G PG+ G  G PG  G  G  G+ G  G  G++G  G+ G +G  G+ GA G  G+ G VG  G+PG  G +   G+PG  G QG  G +G  GN G  GRPG  G+ G +G  G  GP G+
Sbjct:  770 GPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQ---------------------GKDGPRGL---RGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGI 948          

HSP 4 Score: 67.3958 bits (163), Expect = 1.066e-10
Identity = 57/139 (41.01%), Postives = 78/139 (56.12%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG---VPGVSGRDGE------------RGDQGKLGVPGIPG---ETGMNGTPGRDG---RPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  GP+G+ G+ G +G PG++G   +PG +G  GE            RG  G +G+PG+ G   E G  G+PG DG   RPG AG++GD G+PG  GP G  G+ G  G  G +G+PG +G+ G+ GP G  G  G  G
Sbjct:  848 GIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARG 986          

HSP 5 Score: 65.0846 bits (157), Expect = 5.447e-10
Identity = 61/145 (42.07%), Postives = 74/145 (51.03%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGI---------QGKKGGEGVDGAPGIDGKDGSV------------GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATG 1138
            G AGP+GL G  G+ G QGP G+ G +G PG  G +G  G  G  G+ G  GV GP+G KG+RG          QG  G  G  G PG DG  G              G  G PGE G+ G PG+KG +G  G +G+ GNAG  G
Sbjct:  518 GPAGPVGLGGAPGEKGEQGPSGAPGFQGLPGPAGPVGETGKPGDRGIPGDQGVAGPSGVKGERGTPGPAGASGAQGPIGARGPAGTPGPDGSKGEPGAVGAAGAPGHQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDG 662          

HSP 6 Score: 62.3882 bits (150), Expect = 3.675e-9
Identity = 59/133 (44.36%), Postives = 72/133 (54.14%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGV------------PGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G+VGP G  G  GL G PG  G             PG++G  G+ G QG  G+PG  GE G+   PG  G  G AG  G +G PGPRGP+G   + G PG+ G  G+ G++G PGN GP G  G  GI G
Sbjct:  809 GLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGL---PGAAGSVGEAGRVGPSGSPGPRGPSG---NIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKG 935          

HSP 7 Score: 60.077 bits (144), Expect = 1.957e-8
Identity = 52/121 (42.98%), Postives = 65/121 (53.72%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G+ G  G  G+ G+PG DG PG  G  G+ G  GE G  G LG+ G PG  G +G  GR G       RG+ G  GP G  GP G+ GAP L G  G  G+KG  G+ G +G+ G +G  G
Sbjct:  905 GMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGN------RGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPG 1019          

HSP 8 Score: 59.3066 bits (142), Expect = 3.418e-8
Identity = 111/272 (40.81%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  431 AGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQG---PQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGP---IGLPGI---RGDLGSQGPIGSHGPEGEPGVGG------RIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            AGPAG+ GP GP G  G  GP GL G  G  G  G+ G IGP          G SG  G+ G  GP G PG+ G QG    QG NG  G  GE+G  G AG  G  G  GP G  G  GP   IGLPG+   +G+ G +G  G+ GP G PG  G        G PG  GI G    PG +GP+G  G                PG  G+ GS G  GA G  G+ G P  +G  G  G +G+ G+ G  G  GL G  G+QG+ G +GP G
Sbjct:  787 AGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPP---------GLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGA---PGPLGPSGAVGR---------------PGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPGLQGMPGPNGPSG 1031          

HSP 9 Score: 56.6102 bits (135), Expect = 2.305e-7
Identity = 85/209 (40.67%), Postives = 106/209 (50.72%), Query Frame = 2
Query:  629 TGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG------------------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             G  G  GS GP G  G +GP+GE+G  G AGPPG  GP G  G+ GA G  G  G++GD+G+ GP G                  + G  G PG+    GFPGA G  G +G  G++GP G  G +G  G +G  G  G  G  G++G +G PG  GE GS G  G  G  G  GPQG +G+ G  G PG  G  G+ G  G  G  G
Sbjct:  679 NGDKGETGSFGPSGPAGARGPSGERGESGPAGPPGFAGPPGADGQAGARGEKGPGGVKGDVGAPGPAGPAGNTGPLGPSGPVGPPGARGDSGPPGL---TGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAG 884          

HSP 10 Score: 55.4546 bits (132), Expect = 5.229e-7
Identity = 55/122 (45.08%), Postives = 63/122 (51.64%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
             GL G  GP G+ G PG  G PG+QGV G SG  GERG  G  G  G  G  G  G     G PG  G +G+ G  G  G  G +G+ G PG  G  G PG KG+ G  G +GL GN G  G
Sbjct:  544 QGLPGPAGPVGETGKPGDRGIPGDQGVAGPSGVKGERGTPGPAGASGAQGPIGARGP---AGTPGPDGSKGEPGAVGAAGAPGHQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDG 662          

HSP 11 Score: 54.299 bits (129), Expect = 1.036e-6
Identity = 62/151 (41.06%), Postives = 70/151 (46.36%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGN-QGVPGVSGRDGE------RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAG---MRGDTGQPGPRGPAGP---------------EGSTGAPGLMGDIGKPGQKGKP---GNTGPKGLTGNQGITG 2932
            D G  G  G  G PG PGL G  G+ QG  G+ GR GE      +G+ G  G  G PG+ G  G PG  GR G AG    RG  G  GP GPAGP               +G  GA G  G  G  GQ+G+P   G  GP G  GN G  G
Sbjct:  143 DRGPAGAQGARGFPGTPGLPGMKGHRQGYNGLDGRKGEPGAAGSKGENGAHGANGTPGQRGGRGLPGERGRAGPAGPAGARGADGNTGPAGPAGPLGAAGPPGFPGAPGPKGEIGAAGATGPSGPQGQRGEPGPNGAVGPVGPAGNPGANG 293          

HSP 12 Score: 53.9138 bits (128), Expect = 1.554e-6
Identity = 74/185 (40.00%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGR 1141
            G  G  G  GP G TGKPG  G  G QG+ GP G  GE+                     G  GP G  G +G +G++GP G+ GP+G  G  G +G  GA G  G +GMPG  G  GT G +G +G+ G  G++G  G DG  G+ G  G PG  G+NG  G  GS G +GP G  G +G  G 
Sbjct:  542 GFQGLPGPAGPVGETGKPGDRGIPGDQGVAGPSGVKGER---------------------GTPGPAGASGAQGPIGARGPAGTPGPDGSKGEPGAVGAAGAPGHQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGRDGARGAPGPSGPPGPAGANGDKGETGSFGPSGPAGARGPSGERGE 705          
BLAST of Fibrillar collagen vs. Ensembl Cavefish
Match: ENSAMXT00000043273.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:4246717:4253158:1 gene:ENSAMXG00000033238.1 transcript:ENSAMXT00000043273.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 3.966e-21
Identity = 75/229 (32.75%), Postives = 110/229 (48.03%), Query Frame = 2
Query: 3560 LGS--DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDY-------VIDNTQLMFLKMVSTRANQEIKIACNNMAVVE-----KTEYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTL----GSDSDISEFRLKLSKVCFS 4177
            LGS  D++  P G++  PAR+C  LK      K G Y++DPN G   DA +V+C METGETCIS   SS  +  +  S +   K + YG  ++   +F Y        I   Q+ FL++ S  A Q +   C N    +       +  A++ + +  E+    ++ L Y V +D C   SSE  +TV    S    RLPI D+      G+D    EF + +  VCFS
Sbjct:  108 LGSELDSMRSPDGSRQHPARTCQDLKQCYPLKKSGNYWVDPNEGSSKDAIQVYCNMETGETCISANPSSVPRKHWWSSRSSTPKPVWYGATMNRGAKFTYGNQEDSLSIVTIQMRFLRLHSKEAAQTLTYHCKNSIAYKDGKNSNYKKAALLKSADGLEIKAHGNNRLKYTVTEDSCMKSSSEWGKTVFEYRSQKPSRLPIVDMAPVDVGGAD---QEFGIDIGPVCFS 333          
BLAST of Fibrillar collagen vs. Ensembl Cavefish
Match: col27a1b (collagen, type XXVII, alpha 1b [Source:NCBI gene;Acc:560145])

HSP 1 Score: 100.523 bits (249), Expect = 7.191e-21
Identity = 62/233 (26.61%), Postives = 98/233 (42.06%), Query Frame = 2
Query: 3506 IYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKME-TGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEK------TEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRD-LTLGSDSDISEFRLKLSKVCFS 4177
            + D    ++      +N++ S  I  PLGT++ PAR C  L      + DGTY+IDPN G  +D  EV C     G+TC+ P   S                        + +  +   Q+ F+ ++S+ A Q I I C N+ V         +   ++ F   N ++ +    +   ++KDEC        +T    V+ D   LPI D L L      S + L++  VCFS
Sbjct:  618 MLDQGTEIFKTLHYLSNLIYS--IKNPLGTQENPARMCRDLLDCEQRMNDGTYWIDPNLGCSSDTIEVTCNFTGGGQTCLRPLTVS------------------------KLEMGVGLIQMNFIHLLSSEAVQLITIHCLNVPVWATAASRPPSASNSVRFKTWNGQMIQAGGLIQPDLVKDECWMTDGRWHQTQFQFVTQDPNLLPIVDVLNLPITKPGSNYHLEVGPVCFS 824          

HSP 2 Score: 74.3294 bits (181), Expect = 6.793e-13
Identity = 96/251 (38.25%), Postives = 122/251 (48.61%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGG-------------------RIGFPGADG-ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTG---------------------PQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
              G  G  G  G +GP G PGL+G +GP+G     G  GE+G  G+ G  G +G  G  GE+G  GP+G PG +G+ G+ G   P G  G +G+PG+ G                   + G  G DG I G +G PG IGP G +GDRG  G  G  G  G  G  GK G+ G PG PG  G+ G  GSKG QG  G                     P+G++G  G  G PG+DG+ G  G KG +G QG
Sbjct:  195 EHGEKGEIGLKGKEGPPGDPGLVGVRGPEGK---PGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQG 442          

HSP 3 Score: 67.3958 bits (163), Expect = 9.759e-11
Identity = 87/228 (38.16%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLM---GSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGE---PGVGGRIGFPGADGI------------TGVSGMPGVIGPTGTKGDRG-----IQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G  G  G  G  G+PG     G  GP G NGP+GP GE                      G  G +G+ G RG +G  GP+G  G  GE   PG  G  G PG  GI             G  G PG+ GP+G  G +G     IQG+ G +G  G  G DG  G  GD GA GEHG  G  G KG +G  G  G++G  G  G+PG  G  G  G KG  G QG
Sbjct:   39 GDKGIQGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEP---------------------GIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQG 245          

HSP 4 Score: 65.0846 bits (157), Expect = 4.824e-10
Identity = 52/123 (42.28%), Postives = 71/123 (57.72%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G+ G  G  G  G PG  GFPG+ G PG +G +G +G+ G +G  G+ GE G+ G  G  G  G+ G +G  G PG RG  GP+G   +  ++G+ G+PG +G PG  GP G  G +GI G
Sbjct:   40 DKGIQGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPG 162          

HSP 5 Score: 65.0846 bits (157), Expect = 5.034e-10
Identity = 79/205 (38.54%), Postives = 98/205 (47.80%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G+ G  G +G  G PGL G+ GP+G  GPKG  G+Q                     G  G  G+PG  G  GS G +G  GP+G  G  G  G PG DG++G  G  G+ G  G  G+ G+ G  G  G  G PG+ G  GS G  G  G  G  G  G +G  GG G QG  G+ G  G+PG  G  G  G+ G  GP+G
Sbjct:  346 GYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQ---------------------GPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKG 529          

HSP 6 Score: 63.5438 bits (153), Expect = 1.711e-9
Identity = 69/181 (38.12%), Postives = 86/181 (47.51%), Query Frame = 2
Query:  803 GDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPG------VIGPTGTKGDRGIQGKKG------------------------GEGVDGAPGIDG---------------KDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGAT---GRPGLDGMIGIQGVKGDSGPQG 1201
            GD+G  G  G  G  G+PG  G+IG  G  G  G  G+PG        GP G+KGD+G +GKKG                         EG +G PG+DG                DG VG PG  G HG  G PG +GSQG  GP+G  G AG T   G+ G+ G +G QG +GD+G +G
Sbjct:  328 GDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKG 508          

HSP 7 Score: 62.7734 bits (151), Expect = 2.530e-9
Identity = 74/196 (37.76%), Postives = 92/196 (46.94%), Query Frame = 2
Query:  602 NGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDS 1189
             G  G +GP G PG+    G  G +GPKG  GEQ                     G  G +GLPG  G  G  GP G  G +G  G  G  G  G  G  G  G+PG +G  G +GD G++G+ G  G  G PGI    G  G  G PG+ G +GI G KG QG  G +G IG  G  G  G  G  G +G +G++
Sbjct:  411 KGVVGREGPEGLPGM---DGLSGKDGPKGIAGEQ---------------------GNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGI---LGIFGPKGPPGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGDKGNRGET 579          

HSP 8 Score: 60.8474 bits (146), Expect = 9.685e-9
Identity = 96/258 (37.21%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP--EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGV 1177
            + G R   GP G  G  GP G+ GP+GP G                       G  G +G  G  G  G  GP G+ GL+G +G  G  G +G  G Q         G       IGE G  G  G PGI+G  G  G  G  G   +GEPG  G  G  G DG  G  G  G  G  G KG+ G++GK   EG  G PG+ G  G  G PG  GE G  G  GSKG QG  G  G +G+ G  G PG  G  G  G 
Sbjct:   49 MPGIRGRPGPQGFPGDIGPPGQNGPEGPKG---------------------EPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQ---------GIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGK---EGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGF 273          

HSP 9 Score: 58.5362 bits (140), Expect = 4.905e-8
Identity = 52/125 (41.60%), Postives = 65/125 (52.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPG--VSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  G PG  G  G PG +G+PG  + G  G  G+ G+ G  G  GE G  G  G  G  G  G++G  G PG  G  G  G  G PG +G+ GKPG+KG  G+ G  G+TG  G  GP+
Sbjct:  135 GETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPV 259          

HSP 10 Score: 58.5362 bits (140), Expect = 5.524e-8
Identity = 51/119 (42.86%), Postives = 64/119 (53.78%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G VG EG  G PG+DG  G  G  G++G   E+G+ G++G+PG  G  G  G PG  G  G  G +G+ G  G  GP G  G  G  G  G  G  G KG+PG+ G +G  G  GI GP
Sbjct:  412 GVVGREGPEGLPGMDGLSGKDGPKGIAG---EQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGP 527          

HSP 11 Score: 58.5362 bits (140), Expect = 5.813e-8
Identity = 55/122 (45.08%), Postives = 62/122 (50.82%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            GL GN GP G+ G PGL G  G+ G  G  G  GE G  GK GVPG  G  G  G  G  G+PG  G +G  G  G  GP GP G  G  G+ G  G  G  G+ G  GP G+ G  G  GP
Sbjct:  448 GLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGP 569          

HSP 12 Score: 58.151 bits (139), Expect = 6.889e-8
Identity = 65/151 (43.05%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGI-IGNA--GATGRPGLDGMIGIQGVKGDSGPQGL 1204
            ++   G +GLPG  G+ G QG  G  G  G PG+ GR   PG  G  G  G PG  GP G KG+ GI G  G   + G  G+ G  G VG+ G  GE G  G PG +G     GPQGI + +A  G TG PG  G  GIQG  G  G +G+
Sbjct:   19 QVQFEGEVGLPGEPGEPGFQGDKGIQGLPGMPGIRGR---PGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVG---MLGERGLVGFIGPVGETGLLGEKGHPGTPGERGE---PGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGI 160          

HSP 13 Score: 57.7658 bits (138), Expect = 7.959e-8
Identity = 56/136 (41.18%), Postives = 72/136 (52.94%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM------------NGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            D G  G +G +G+ G  G  G PGN G  G  G  G +GDQG  G  G+PGE+G              G  GR+G  G+ GM G +G+ GP+G AG +G+ G      ++G PG  G  G TGP GL G+QG  GP
Sbjct:  344 DPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDG------EVGLPGNSGPHGQTGPPGLRGSQGSFGP 473          

HSP 14 Score: 57.3806 bits (137), Expect = 1.176e-7
Identity = 101/284 (35.56%), Postives = 124/284 (43.66%), Query Frame = 2
Query:  785 GLPGIRG---------DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGA---PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANK-------PPGPQGKMGPRGLTG 1579
            G+PGIRG         D+G  G  G  GP+GEPG+ G +G  G  G+ G  G  G  G  G KG  G  G++G  G  G P      G  G+PGA   PG  G +G PG+KG  G    QG  G+ G  GR G DG       KG+ G  G  G  G  G +G  G  GP G+PG                                   G  G +G PG  G  GKPG +G +G QG  G+ G+ G +GP G  G P  N+       PPG  G  G  GL+G
Sbjct:   48 GMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPG-EPIQGEPGHDGEAGRSGPDG------AKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPG---------------------------------LVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPG-PKGNRGTIGFVVPPGKMGMQGDPGLSG 290          

HSP 15 Score: 55.0694 bits (131), Expect = 6.761e-7
Identity = 53/128 (41.41%), Postives = 66/128 (51.56%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMG-----DIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GPEG  G PG+ G  G  G  G+ G  G  G+ G LG  G PG  G  G PG  G P  + + G+TG+PG RG  G +G +G PG  G       G+PG  G+ G +GP G  G +G  G
Sbjct:   64 DIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLG 191          

HSP 16 Score: 54.6842 bits (130), Expect = 6.877e-7
Identity = 45/102 (44.12%), Postives = 56/102 (54.90%), Query Frame = 2
Query: 2627 FPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            F G  G+PG  G  G +GD+G  G+PG+         PG  GRPG  G  GD G PG  GP GP+G    PG+MG++G  G++G  G  GP G TG  G  G
Sbjct:   22 FEGEVGLPGEPGEPGFQGDKGIQGLPGM---------PGIRGRPGPQGFPGDIGPPGQNGPEGPKGE---PGIMGNVGMLGERGLVGFIGPVGETGLLGEKG 111          

HSP 17 Score: 54.299 bits (129), Expect = 1.088e-6
Identity = 54/127 (42.52%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 2567 DGLDGNVGPEG---KPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            DGL G  GP+G   + GN G  G PGN G  G +G  G RG QG  G  G  G  G  G  G+ G PG  G +G  G  G +G  G  G  G PG++G  G    KG PG+ GP G+ G +G  G M
Sbjct:  426 DGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGP---KGPPGDFGPSGIQGPKGPQGLM 549          

HSP 18 Score: 53.1434 bits (126), Expect = 2.238e-6
Identity = 53/123 (43.09%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLM---GDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G  G+ GP+G+ G  G  G  G +GVPG  G  G++GD G  G PG PGE G          PG+ G+ G  G PG  GP+G +G  G  GLM   G IG  G  G  G  GP+G  GN+G T
Sbjct:  466 GSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGF---------PGILGIFGPKGPPGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGDKGNRGET 579          

HSP 19 Score: 53.1434 bits (126), Expect = 2.478e-6
Identity = 49/120 (40.83%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 2573 LDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG---PKGLTGNQG 2923
            + G  G +G+ G  G DG  G +G  G  G  GE+G+ G  G  G PG+ G+ G  G +G+PG  G RG  G+ G +G  G  G TG  G +G +G PG KG  G  G   P G  G QG
Sbjct:  165 IQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQG 284          
BLAST of Fibrillar collagen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003197.1 (pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 gene:ENSPMAG00000002618.1 transcript:ENSPMAT00000003197.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 4.211e-30
Identity = 65/220 (29.55%), Postives = 113/220 (51.36%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENP--INKYISYG-ELSGIQRFDYVIDN----TQLMFLKMVSTRANQEIKIACNNMAVVE-----KTEYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            + +  P G++  PAR+C +LK     L  G Y+IDPN G  +DA +V+C METGE+C++    S ++ ++   P    K++ +G  +S   +F Y  D+     QL FL++ ST A+Q+I   C N    +       +   ++   N  E+  + +  L+Y V++D C   + +  +TV+   +  + RLPI D+   +  D+     EF + +  VCF
Sbjct:  970 ENMVSPDGSQKNPARTCRNLKLCYPDLPSGLYWIDPNEGSKSDAIQVWCNMETGESCMNADNPSIARKNWWLKPSGSKKHVWFGVTMSPDAQFTYGEDSHSTEIQLTFLRLFSTEASQKITYHCKNSVAYQDGAVGNLQQALLLQGSNEMEIRAEGNSKLAYSVLEDGCTMHTGQWGKTVIEYRTPKTSRLPIVDI---APKDVGGPDQEFGVDVGPVCF 1186          

HSP 2 Score: 61.6178 bits (148), Expect = 1.467e-9
Identity = 56/129 (43.41%), Postives = 67/129 (51.94%), Query Frame = 2
Query: 2576 DGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGV---------AGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            +G  GP G+ G PG  G PG  GV G SG  G  GD G +G  G PG +G+ G+ G  G PG          AG+ G+ G+ GP GP+G  GS G  G MG  G PG  G+ G  G  GL G  G  GP
Sbjct:  655 EGTKGPRGETGPPGSTGAPG-AGVTGPSGEKGAPGDDGPVGAEGSPGPSGLAGSRGVVGLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGP 782          

HSP 3 Score: 56.9954 bits (136), Expect = 3.586e-8
Identity = 52/123 (42.28%), Postives = 64/123 (52.03%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G+ GP G  G+PG  G  G++GV G+ G+ GERG  G  G+ G  G+ G  G  G  G  G AG  G  G PG  G  G  G+ G PG  G  G  G +G PGN GP G  G  G +G
Sbjct:  683 EKGAPGDDGPVGAEGSPGPSGLAGSRGVVGLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRGPPGNAGPAGAPGASGPSG 805          

HSP 4 Score: 53.9138 bits (128), Expect = 2.681e-7
Identity = 74/171 (43.27%), Postives = 85/171 (49.71%), Query Frame = 2
Query:  599 RNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGD------------LGSQGPIG------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHG 1057
            + G  GP+G TG PG  G+ G     G  GP+GE+G  GD GP G +G  GP G  G+ G +GLPG RG+             G QGP+G      S GP G  G  G  G  G DG  G  G+PG  GP G KGDRG  G  G     GAPG  G  G  G PG  GE G
Sbjct:  654 KEGTKGPRGETGPPGSTGAPG----AGVTGPSGEKGAPGDDGPVGAEGSPGPSGLAGSRGVVGLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRGPPGNAG---PAGAPGASGPSGQAGSPGRTGERG 817          

HSP 5 Score: 52.7582 bits (125), Expect = 7.583e-7
Identity = 48/108 (44.44%), Postives = 57/108 (52.78%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNT 2893
            GL G  G  G  G  GL G  G QG  G SG  G  G  G +G  G PG++G +G  G DG PG  G +G  G  GP G AGP G+ GA G  G  G PG+ G+ G+ 
Sbjct:  712 GLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRGPPGNAGPAGAPGASGPSGQAGSPGRTGERGDV 819          

HSP 6 Score: 50.0618 bits (118), Expect = 4.786e-6
Identity = 38/80 (47.50%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 2684 QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            QG  G PG PG  G+ G+ G +G  G    +GDTG  G RG AG  GS+G  G+ G  G PG++G+PG +GP G  GN G
Sbjct:    1 QGPRGFPGTPGLPGIKGSRGFNGNDGA---KGDTGPAGARGEAGTPGSSGVVGISGGRGAPGERGRPGPSGPAGGRGNDG 77          
BLAST of Fibrillar collagen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005318.1 (pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 gene:ENSPMAG00000004829.1 transcript:ENSPMAT00000005318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 4.428e-30
Identity = 78/245 (31.84%), Postives = 110/245 (44.90%), Query Frame = 2
Query: 3509 YDPNRPMYSDDANAANILGSDT-----ISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENP---INKYISYGE-LSGIQRFDY-------VIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVLLVSGDS-KRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            Y  +  +   DA     L S T     I  P GTK  PARSC  L    S  K G Y+IDPN G + DA +V+C METGETC+ PK  +    ++  N     +K++ +GE + G   F Y        I   QL FL++V+  A+Q I   C N                +      EL  D  +  +Y +++D C   + E  +TVL    +   RLPI D+  L       EF +++  VCF
Sbjct:  366 YRADEALKEHDAEVDVTLKSLTNQLENIMSPEGTKTDPARSCRDLMLCHSDWKSGEYWIDPNEGSVLDAMKVWCNMETGETCVYPKPKNVPSKNWWSNKGSREHKHVWFGEAMPGGFHFSYGDDTMSANIAEVQLNFLRLVAAEASQNITYLCRNSVAYADAAGSLRKAVRLMGSGELELRADGKNRFTYSMLEDGCAKHTGEWGKTVLQYKTNKPSRLPIVDIAPLDIGGPEQEFGVEIGPVCF 610          

HSP 2 Score: 77.0258 bits (188), Expect = 1.504e-14
Identity = 102/256 (39.84%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP+G  GP G  G  G  G  G  G  G+ G  G PG IGP G        G  G++G+ GP+G TG PG  G  GP G+ G +G  GE+                        GP G  G  G  GS G +GSHG +G  G  G  G PG +G TG  G     GPTG +G+RG  G  G  G++GAPG  G++GS G  GA G    +G+ G +G +G  G  G  GN G  G PGL G  G  G +G++GPQG
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGAS------GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGER------------------------GPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKS---GPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGR---DGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQG 221          

HSP 3 Score: 75.485 bits (184), Expect = 5.701e-14
Identity = 85/212 (40.09%), Postives = 110/212 (51.89%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGP------QGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G  G++G+ GP+G TG PG  G  GP      QG  G +GP+G +G  G  G  G  G  G  G  G  G  G+PG+ G  GS G  G  G +GE G  G +G PG +G  G SG  G  G  G  G  G+ G +G  G  G PG  G  G++G+PG  G +G +G  G  G QG +   GI+G  G+ G  G  G  G  G +GDSG +G+
Sbjct:   47 GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDS---GIVGRPGSAGPLGPQGPNGAHGERGDSGERGI 255          

HSP 4 Score: 72.7886 bits (177), Expect = 3.260e-13
Identity = 91/268 (33.96%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  812 GSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTK------------GDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G+QG  GS GP G+ G  G  G PG  G+ G  G  G  GP+GT+            G  GIQG  G  G  G PG++G  GS+G  G  GE G  G PG+ GS G  G  G  G  G++G  G  G  G+ GV+GD G  G                 G  GNPGN                                     G  GL G +G +G  G  GP+G  G+ G PG  G +GP G +G  G     G +G  G RG +G
Sbjct:   47 GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGT---------------PGRPGNPGNM------------------------------------GNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSG 263          

HSP 5 Score: 71.2478 bits (173), Expect = 1.103e-12
Identity = 58/129 (44.96%), Postives = 75/129 (58.14%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI---PGETGMNGTPGRD---GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G+ G  G  G+ G PGL+G  G+ G  G +G  GERG  G +G PG+   PGE+G  G+ G D   GR G+AG+RGD G+PG  G  G  G+ G PGL G  GK G +G+ G  G  G+ G  G  GP+
Sbjct:  107 GIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPL 235          

HSP 6 Score: 66.2402 bits (160), Expect = 3.552e-11
Identity = 54/127 (42.52%), Postives = 68/127 (53.54%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG------MNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G DG++GP G  G PG  G PG  G+ G  G  GERG  G  G  G PG +G      + G  G+ G  GV G+ G TG  G  GP G +G  GAPG   ++G PG  G PG +G +G +G  G +G
Sbjct:   50 GKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPG---NVGSPGLNGAPGESGREGSSGTDGASG 173          

HSP 7 Score: 65.4698 bits (158), Expect = 6.198e-11
Identity = 59/129 (45.74%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---ERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTG---------QPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            + G  GNVG  G  G PG  G  G+ G  G SGRDG    RGD+G+ G PG PG  G  G PG  G  G  G RG+TG         +PG  GP GP+G  GA G  GD G+ G KG  G +G +GL G
Sbjct:  141 ERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPG 269          

HSP 8 Score: 59.6918 bits (143), Expect = 4.176e-9
Identity = 105/297 (35.35%), Postives = 123/297 (41.41%), Query Frame = 2
Query:  818 QGPIGSHGPE---GEPGVGGRIGFPGAD------------------------------GITGVSGMPGVIGPT---GTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIP------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            +GP G  GP+   GE G  G  GFPGA                               G TG  G PG  GPT   G +G+RG +G  G  G  GAPG  G  GS G  G  G+ G  G+P      GS G  G TG QG  G  G  G PGL+G  G  G +G SG  G +GR G+ G  G  G  G  G PGN                                     G  G PG+ GANGK G RG  G QG +G+ G+ G  GP G  G  GA+   G +G  G RG+ G 
Sbjct:    1 KGPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNP------------------------------------GNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAH---GERGDSGERGIKGH 258          

HSP 9 Score: 55.0694 bits (131), Expect = 9.210e-8
Identity = 46/96 (47.92%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSG---RDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL 2845
            DGL G  G  G+PG PG  G PGN G PG+SG   +DG RG+ G  G  GI G  G  G  G  G  G  G RGD+G+ G +G  G  G  G PGL
Sbjct:  175 DGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGL 270          

HSP 10 Score: 48.9062 bits (115), Expect = 8.204e-6
Identity = 43/97 (44.33%), Postives = 48/97 (49.48%), Query Frame = 2
Query: 2651 GVSGRDGE---RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G+DG    RGD G  G PG PG TG+ G  G  G  G +G RG  G PG  G  G  G  G  G  G+ G PG  G  G+ G  G TG QG  G
Sbjct:   47 GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERG 143          

HSP 11 Score: 48.521 bits (114), Expect = 9.730e-6
Identity = 39/87 (44.83%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 2678 GDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G QGK G  G  G+TG   TPG  G PG  G+ G+ G+ G RGP+G  G+ GAPG  G +G  G +G  G  G +G+ G  G TG +
Sbjct:   47 GAQGKDGSMGPRGDTG---TPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSL 130          
BLAST of Fibrillar collagen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001576.1 (pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1 gene:ENSPMAG00000001417.1 transcript:ENSPMAT00000001576.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 3.534e-28
Identity = 68/219 (31.05%), Postives = 112/219 (51.14%), Query Frame = 2
Query: 3527 MYSDDANAANILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPI--NKYISYGE-LSGIQRFDYVIDN-------TQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT 4117
            +   DA     L S     D+I  P G++  PAR+C  LK      K G YFIDPN G   DA +VFC ME+GETC+     +  + S+  N     K+I +GE ++   +F+Y  D+        Q+ FL+++ST A+Q I   C N++A +++     +   ++   N+ E+  + +   +Y V++D C   + +  +TVL   +  + RLPI D+ 
Sbjct:  505 LRQHDAEVDATLKSLTNQIDSIRSPEGSRKNPARTCRDLKLCHPEWKSGDYFIDPNQGCTLDAIKVFCNMESGETCVYASPQNVPRKSWWTNKSKDRKHIWFGETMNSGSQFNYGDDSLPPNTAAIQMTFLRLLSTEASQNITYHCKNSIAYMDEQAGNLKKALLLQGSNDIEIRAEGNSRFTYNVLEDGCTKHTGDWGQTVLEYRTQKTSRLPIVDIA 723          

HSP 2 Score: 55.4546 bits (132), Expect = 9.687e-8
Identity = 55/134 (41.04%), Postives = 64/134 (47.76%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGT------------PGRDGRP------------GVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G PGL G PG +G  G  G  G+RGD G+ G  G PG+ G  G              G  G              G  G RG+TG PGP G AGP GS G PG  G+ G+ GQKG  G  GP+G  G+ G  GP
Sbjct:    1 GPPGLQGMPGERGTAGAPGPKGDRGDGGEKGPEGAPGKDGSRGLTGPIGPPGPSGSAGDKGEAGPPGPTGPAGTRGSPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQGPAGSPGPQGP 134          

HSP 3 Score: 53.9138 bits (128), Expect = 2.877e-7
Identity = 41/86 (47.67%), Postives = 48/86 (55.81%), Query Frame = 2
Query: 2675 RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            RG  G+ G  G PG  G  G PG DG+PG  G +G++GQ G  G  GP+G  G+PG  G  G PG KG  G  GP G TG  G  G
Sbjct:   75 RGSPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQGPAGSPGPQGPNGVPGPKGARGAQGPSGATGFPGAAG 160          

HSP 4 Score: 48.9062 bits (115), Expect = 8.548e-6
Identity = 60/163 (36.81%), Postives = 67/163 (41.10%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPG------IPGETGMNGTPGRDGRPGVAGMRGDTGQPGP------------------------------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGN---------TGPKGLTGNQGITG 2932
            G  G  G PG  G  G PG+ G PG  G  GE G +G  G PG       PG  G NG PG  G  G  G  G TG PG                               RG +GP G +G PGL G  G PG+KG+PG           GP GL G +GI G
Sbjct:   79 GERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQGPAGSPGPQGPNGVPGPKGARGAQGPSGATGFPGAAGRVGPPGPNGNPGPPGPPGPGGKDGPKGIRGDSGPAGRSGEPGLQGAAGPPGEKGEPGEDGPSGPEGPPGPMGLAGQRGIVG 241          
BLAST of Fibrillar collagen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001071.1 (pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gene:ENSPMAG00000000855.1 transcript:ENSPMAT00000001071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 1.651e-27
Identity = 66/222 (29.73%), Postives = 111/222 (50.00%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKD--GTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVIDN----TQLMFLKMVSTRANQEIKIACNNMAVVEKT-----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTL----GSDSDISEFRLKLSKVCF 4174
            ++I+ P G++  PARSC  L       K   G Y+IDPN G   DA +V+C METGE+C++P   S  + ++  S+    K++  GE +S   +F Y   +     QL FL+++ST A+Q+I   C N      +     +   ++   ++ E+  + +   +Y V++D C   +    +TV+   +  + RLP  D+      GSD    EF + +  VCF
Sbjct: 1056 ESITSPDGSRKHPARSCRDLMLCHPEYKSDTGEYWIDPNEGCRADAIKVWCNMETGESCVNPGMPSLPRKNWWRSQAADKKHVWLGETMSPGSQFTYGDGSPNMEVQLTFLRLLSTDASQKITYHCKNSVAYLDSRAGNLKKALMLQGSSDVEIRAEGNSRFTYSVLEDGCTTHTGVWGKTVIEYRTQKTSRLPFMDIAPMDVGGSD---QEFGVDVGPVCF 1274          

HSP 2 Score: 60.077 bits (144), Expect = 3.818e-9
Identity = 94/213 (44.13%), Postives = 110/213 (51.64%), Query Frame = 2
Query:  605 GAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD------------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            GA GP G +GKPG  GS GP G      P G  G  GDAGP G  GP GP GE G AGP+G PG +G  G+ G  G  G  GEPG+ G  G PG  G  G  G P      G +G+ G  G  G  G +GAPG DG              G+ G  G PGE G++G+PG+KG +G  GP GI G       PG DG  G+ G  G +GP G N
Sbjct:  404 GAKGPSGESGKPGEKGSVGPVG------PIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAP------GERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGG------PGKDGPRGLSGPVGPAGPTGSN 598          

HSP 3 Score: 54.6842 bits (130), Expect = 1.754e-7
Identity = 54/119 (45.38%), Postives = 59/119 (49.58%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGS---------------TGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            G PG DG PG +G PG  G  G  G +G  G PG PGE G+ G  G  G PG AG  G TG PGP G  G  GS                GA G  G+ GKPG+KG  G  GP GL G 
Sbjct:  314 GAPGGDGSPGAKGPPGERGATGPAGAKGNSGDPGRPGEAGLPGPRGSTGSPGHAGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPIGLPGK 432          
BLAST of Fibrillar collagen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009617.1 (pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1 gene:ENSPMAG00000008685.1 transcript:ENSPMAT00000009617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 7.828e-27
Identity = 65/216 (30.09%), Postives = 105/216 (48.61%), Query Frame = 2
Query: 3539 DANAANILGS-DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVIDN-------TQLMFLKMVSTRANQ-----EIKIACNNMAVVEKTEY----PAIIFT-DNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT 4117
            DA+  ++ G  + +  P GT+  PAR+C  LK      + G Y+IDPN G   DA +VFC METGETC+     + S+ ++  S++   K++ +GE +SG   F+Y  DN        Q+ FL+++S  A        I   C N       E      A++    N+ E+  + +   +Y V++D C   + E   TV+   +  + RLP  D+ 
Sbjct:  656 DASIKSLSGQIEGLRSPEGTRKNPARTCRDLKLCHPEWESGNYWIDPNQGCTLDALKVFCNMETGETCVYANPQTISRKNWWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAIQMTFLRLLSMEAYDLPAAANITYHCKNSIAYMDEETGNLKKALLLQGSNDMEIRAEGNSRFTYNVLEDSCTKHTGEWGRTVVEYRTQKTSRLPFVDVA 871          

HSP 2 Score: 60.077 bits (144), Expect = 4.060e-9
Identity = 53/108 (49.07%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2618 LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKP---GQKGKPGNTGPKGLTGNQGITG 2932
            L G PG +G  G+SG  G+RGD G+ G  G PG+ G  G  G  G PG AG  GD G  GP GP GP G+ GAPG  G+ G P   G  G PG+ G  G  G QG TG
Sbjct:  147 LQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETG 254          

HSP 3 Score: 57.7658 bits (138), Expect = 2.018e-8
Identity = 118/270 (43.70%), Postives = 135/270 (50.00%), Query Frame = 2
Query:  401 PAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ---GKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            P P  GN    GPAG  G DGP+G  G  GP G  G  G  G  G PG  G  G  GP G  G  G  G  G +G  G PG  G +G  G+ GP G  G+QG  G +G  G  GP GP G  G  G  G  G  G  G+ G  G+ G +GE G  G  G PGA    G  G PG +GPTG  G RG Q   G  G  G  GA G+ G  G  GD G  GE G  GI   KG +G TG QG+ G  G++G  GL G +G  G +G SGP G
Sbjct:  307 PVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGA---PGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGI---KGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTG 570          

HSP 4 Score: 57.3806 bits (137), Expect = 2.234e-8
Identity = 98/295 (33.22%), Postives = 116/295 (39.32%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDG---------------APGIDGKDGSVGDPGAPGEHGSNGIP---GSKGSQGGTGP---------------------QGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GPAG  GP G +G+PG KG  G T                           G+ G  GA GPQGP+G PG    QGP G++GPKG  G QGP                       P G   + G      P+   G  G PG  G  G  G  GI G SG      P G  G+ G+QG  G  G  G               A G+ G+ G VG PG  GE G  G+P   G  G QG TG                      QG  GNAG+ G PG DG  G +G +G++G  G
Sbjct:  230 GPAGFAGPPGSDGQPGAKGEQGET---------------------------GQKGDAGAPGPQGPSGAPG---PQGPNGVSGPKGARGAQGP-----------------------PPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSG------PVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAG 465          

HSP 5 Score: 56.9954 bits (136), Expect = 3.031e-8
Identity = 108/316 (34.18%), Postives = 127/316 (40.19%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGP-------------------TGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGI------------------------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAG---------------ATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G AG  GP GP G PGP+GPNG+                              SG  GA G QGP                    G PG  G  GP G +GPKG  G+ GP G AG            E G  GPIG PG +GD G  GP G  GP G  G+ G+ G  G  G  G  G PG+ GP G  G +G                         QG++G  G DGAPG DG  G+ G+ G  G  G  G PGS G+ G  GP G  G  G               A G PG  G  G +G  G++G +G+ 
Sbjct:  257 GDAGAPGPQGPSGAPGPQGPNGV------------------------------SGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAG------------EPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIK 530          

HSP 6 Score: 55.8398 bits (133), Expect = 7.576e-8
Identity = 91/214 (42.52%), Postives = 104/214 (48.60%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXX---------ELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G +G+ G  G +G  G PG  G+ GPQG+ G +G  G  G  G  G  G  GP G  G         E GA G  G  G RGD G +GP G+ G +G  GV G IG PG  G  G  G  G  GPTG  G RG  G++G  G  G  G  G  GS G PGA GE G     G KG  G  GPQ      G +G PG  G  G+ G KG  G QG
Sbjct:   86 GEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGET---GQKGDAGAPGPQ------GPSGAPGPQGPNGVSGPKGARGAQG 290          

HSP 7 Score: 54.299 bits (129), Expect = 1.958e-7
Identity = 133/354 (37.57%), Postives = 157/354 (44.35%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADG----ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKP------------------PGPQGKMGPRGLTGK 1582
            G  G  GP GPTG  G  G+ G +G  GP GP G              GP G  G+ GA G  G  G +GD G+   QGP G+ GP+G  GV G  G  GA G       + G    + P   +G+ G  G  G  G DG  GI G  G VG  G PG  G  G PG KG  G  GP G  G  GA G  G  G++G+ G +G+ G  GL                GP G PG +G  G  G  G  G  G  G  GP G  G  G+ G+DG    PG DGA G  G RG  G+ G  G PG  G  GP G +G+ GA                     PGPQG  G +G TG+
Sbjct:  200 GDKGDAGPAGPTGPSGARGAPGERGETGPPGPAG------------FAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGL---------------PGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDG---APGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGE 523          

HSP 8 Score: 53.9138 bits (128), Expect = 2.992e-7
Identity = 53/127 (41.73%), Postives = 61/127 (48.03%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPG---------------LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGP 2899
            D G  G  GPEG PG  G                 G  G+ G  G +G  G RG  G+ G  G PG  G  G PG DG+PG  G +G+TGQ G  G  GP+G +GAPG  G  G  G KG  G  GP
Sbjct:  165 DRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGP 291          

HSP 9 Score: 50.0618 bits (118), Expect = 4.745e-6
Identity = 50/128 (39.06%), Postives = 60/128 (46.88%), Query Frame = 2
Query: 2594 EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDT---------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +G+ GN G DG PG  G  G  G  GE G  G+ G PG PG  G  G  G++      G RGD                G PGP+GP G +G TG  G  G  G  G  G  G  GP G +G+QG+ G
Sbjct:  434 QGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKN------GARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAG 555          

HSP 10 Score: 49.2914 bits (116), Expect = 6.948e-6
Identity = 52/129 (40.31%), Postives = 63/129 (48.84%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLG---------VPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G  G  G  G  G PG  G PG  G  G +G++G RGDQG  G           G+PG  G  G  G  G  G  G++G  G  G +G  GP GS+G  GL G +G  G +G  G TGP G  GN G +
Sbjct:  453 GAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNGQS 581          
BLAST of Fibrillar collagen vs. Ensembl Nematostella
Match: EDO44729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV66])

HSP 1 Score: 133.65 bits (335), Expect = 1.868e-31
Identity = 65/233 (27.90%), Postives = 112/233 (48.07%), Query Frame = 2
Query: 3503 IIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMET-GETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVV-----EKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKR-LPIRDLTLGSDSDIS--EFRLKLSKVCF 4174
            +I +  + +Y  + +       D    PLG++  PA +C+ LK  +  +KDG Y+IDPN G  +DA +V+CK +T GE+C+ P      K +++      +  + +L    +  Y+ +  QL FL++++T+  Q+I + C ++ V      +  +Y       N  + T +    S  V++D C+        T LL      R LPI D T    S  +  EF +K+  VCF
Sbjct:  887 LIVNDKKSLYLSEMD-------DKSKTPLGSRANPALTCHELKHVNG-IKDGEYWIDPNQGCSSDAIKVYCKFKTGGESCVRPALKMIPKETWNNATTAGWYQFSKLERGYKITYLTNKVQLNFLRLLTTKVTQKIIVKCKSVVVWFHRHSKSYDYSWKFHGFNGHQFTYNSSRSSLNVLRDACKYDDGRWRRTELLFETTKLRTLPIVDFTYYHRSLTTPEEFGVKIEPVCF 1111          

HSP 2 Score: 79.337 bits (194), Expect = 8.251e-15
Identity = 107/263 (40.68%), Postives = 127/263 (48.29%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGP---QGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTK----GDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP GL+G  GP G+PG  G  G                       G  GR+G  G  G  GP GP G  G MGS+GP    G  G +GPNGE G +G  G  G  GP G  G  G  GP GLPG+ G  G +G  GS G  G  G+ G IG P   G  G  G PG IGP G++    G  G++G  G +G DG  G  GK G  G  G  G+ GS G  G  G +   G +G+ G  G  G  GL+G  G+QG  G  GPQG
Sbjct:  422 GPQGLEGDRGPIGKPGVSGTKG---------------------NIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVP---GFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQG 660          

HSP 3 Score: 73.559 bits (179), Expect = 6.100e-13
Identity = 84/229 (36.68%), Postives = 111/229 (48.47%), Query Frame = 2
Query:  602 NGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPG---------ADGITGVSGMPGV------IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPG------------APGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
             GA G  G +G PG  GS+GP G +GP G  G +G KG                +G+ GP GL G +G +G +G  G  G +G  G  G  G PG         A GI G  G PG+      IGP+G +G +G  G KG  G DG  G  G  G+ G PG              G+ G+ G+PGS+G  G  GP+G +G++G  G PG  G  G  G++G  G QG++
Sbjct:   94 KGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGG---------------VGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVS 307          

HSP 4 Score: 73.1738 bits (178), Expect = 6.640e-13
Identity = 110/292 (37.67%), Postives = 143/292 (48.97%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKP------------------GLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFP---------GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            L G+R   G  G +GP G +G  G +GP G  G QG  G  G  G  G +G +G  G+ GR G  G  G +G +G P                  G++G  G  G +G +GP GE GP G  G  G KG       +G+ GP GL G +G +G +G  G  G +G  G  G  G P         GA GI G  G PG+ G  G+ G  G+QG +G  G+ G  G DG D      G  G  G+ GIPG +G+ G  G +GI+G+ GA G PG  G+ G +G +GD G  GL
Sbjct:    3 LMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGG------VGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVD------GFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGL 282          

HSP 5 Score: 71.2478 bits (173), Expect = 2.618e-12
Identity = 88/221 (39.82%), Postives = 110/221 (49.77%), Query Frame = 2
Query:  596 GRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGP---------------IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDR---GIQGKKGGEGVDGAPGIDGKDGSVGDPGAPG-EHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G  GP+G  G P      GPQG+ G +GP G+ G  G  G  G KG  G  G+ G  GP G  G  G++GS+GP               +GS G  GE G  G IG+ G +G  G +G+PG+ G  G +G     G+ G KG +G  G PG  G+ G+ GD G PG E G  G  G +G  G  GP G  G  G  G  G  G+ G QG +GD GP G
Sbjct:  407 GAAGPSGPRGALGHP------GPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIG 621          

HSP 6 Score: 69.707 bits (169), Expect = 7.608e-12
Identity = 89/212 (41.98%), Postives = 105/212 (49.53%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGP---IGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV---DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G SG  GA G +G  G  G +G  G QG  G  G  G+ G  G  G  G  G  G  G  G  GPIG  GI GD+G+ G    +GS GP G  G  GR+G  G  G  GV G  G  G TG  G +G  G  G +G+    GAPG+ G  G  G  G  G+ G +G+PG  G QG  G  GI G+ G  G  G  G IG  G  GD G +GL
Sbjct:  116 GESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGL 327          

HSP 7 Score: 68.5514 bits (166), Expect = 1.744e-11
Identity = 89/226 (39.38%), Postives = 111/226 (49.12%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGP------QGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPG------------IRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            MG  G  G  G +GP G  GL+G +GP      QG +G KG  G  G  G  G  G +G  G  GE G+ G  GLPG             +G +G  G  GS G +G  G  G  G  GA G  G  G  G IGP+G +G +G  G KG  G DG   +DG  G  G+ G PG  G+ G  G+KG  G  G  G+ G  G+ G  GL G  G  G+KGD+G  G++
Sbjct:    4 MGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDG---VDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVD 226          

HSP 8 Score: 68.1662 bits (165), Expect = 2.101e-11
Identity = 78/212 (36.79%), Postives = 99/212 (46.70%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTK---GDRGIQGKKGGEGVDGAPGIDGK---DGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQ 1198
            RMG  G  G  G  G  G  G  G  GPQG  GP G  G                          G +G PG+ G +GS GP G  G +G  G+ G  G+ G DG  G +G  G+ GP GT    G +GI G  G  G+ G+ G++G    +G +G  G PG  G  G PG  G +G  G QG+ G AG+ G PG  G  G +G+ GD  P+
Sbjct:  147 RMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKG------------------------ILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPGDIVPR 334          

HSP 9 Score: 67.0106 bits (162), Expect = 5.952e-11
Identity = 65/146 (44.52%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GAAGP G  G  G  G QG  G  GP G+PGV G  G  GA G  G+ G  G  GP G KG  G  G KG  G  G  G+ G +G +G  G PGE G  G  G +G +G  GP G+ G  G  G  G +G  G+ G+KG  GP G+
Sbjct:  407 GAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGV 552          

HSP 10 Score: 65.0846 bits (157), Expect = 1.930e-10
Identity = 87/216 (40.28%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNG------PKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSH---------GPEGEPGVGGRIGFPGADGI---TGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G  G PG  G +GPQG+ G      P+GP GEQG  G  G  G  G  G  GE G  G  G+ G RG  G  G  G           G +G  G+ G+ G PG DG    TG SG  G +G  G KG  G  G  G +G  G  G+ G  G  G  G  G  G+ GIPG +G+ G  G +GI+G+ GA G PG  G IG  G++G  G  GL 
Sbjct:    2 GLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLK 217          

HSP 11 Score: 62.7734 bits (151), Expect = 9.317e-10
Identity = 53/124 (42.74%), Postives = 67/124 (54.03%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLG------VPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +G  GK G+PG DG  G  G  G +G  G +G +G +G      + G  G  G+ G  G DG  G  G  G+TG PGP+G  GP    GA G++GD+G PG  G  G+ GP GL G QG  G
Sbjct:   95 GAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGP---IGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMG 215          

HSP 12 Score: 60.8474 bits (146), Expect = 4.346e-9
Identity = 60/133 (45.11%), Postives = 70/133 (52.63%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA---PGLMGDIGKP---GQKGKPGNTGP----KGLTGNQGITGPM 2938
            GL G+ G +G  G  G  G  G++G PG  G  G RG  G+LG  G+PGE G  G  G  GR G  G  G  G PG RG  G EGSTG     G+ G IG P   GQ G PG+ GP     G+ G  G+ GPM
Sbjct:  452 GLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPM 584          

HSP 13 Score: 59.6918 bits (143), Expect = 8.698e-9
Identity = 55/144 (38.19%), Postives = 71/144 (49.31%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGF---PGNQGVPG---VSGRDGERGDQGKLGVPGIPG---------------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
             G  G +G +G  G  G+DGF    GN G+PG     G  G +G  G +G PG+PG                 G+ G  G DG  G  G  G+TG PGP+G  GP G+ G  G +G  G PG +G  G  GP+G  G+ G+ GP
Sbjct:  142 QGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGP 285          

HSP 14 Score: 58.5362 bits (140), Expect = 1.910e-8
Identity = 50/119 (42.02%), Postives = 64/119 (53.78%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGF---PGNQGVPG---VSGRDGERGDQGKLGVPGIPGETGMNGTP------GRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPG 2887
             G  G +G +G  G  G+DGF    GN G+PG     G  G +G  G +G PG+PG  G+NGT       G  G PG  G +GD G+PG RG  G +G +G  G +GD G PG +G  G
Sbjct:  208 QGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEG 326          

HSP 15 Score: 57.3806 bits (137), Expect = 5.272e-8
Identity = 55/143 (38.46%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP---------GIPGETGMNGTPG-------RDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            +G+ G VG  G  G  G +GF G  G+PG+ G+ G RG +G  GV          G+PG  G +GTPG         G PG  G+RG  G  GP   +G  G  G  G  GL GD G  G +G  G     G  G +G TGP+
Sbjct:  496 EGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPI 638          

HSP 16 Score: 56.6102 bits (135), Expect = 7.089e-8
Identity = 55/128 (42.97%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGV---------AGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
             GL+G+ GP GKPG   + G  GN G  G  G  G+RG+QG  G  G  GE G  G PG  G  GV          G+ G+ G+PGP G  G EG  G  GL G  GK G +G  G+TG  G+ G +G
Sbjct:  424 QGLEGDRGPIGKPG---VSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKG 548          

HSP 17 Score: 54.6842 bits (130), Expect = 2.767e-7
Identity = 50/112 (44.64%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQG---VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTG 2914
            GP G  G+PG  G  G++G    PGVSG  G  G +G++G+ G  GE G  G  G  G  G  G  GD G+ G RGP G  GS G PG +G  G  G +G+ G  GP GL G
Sbjct:  413 GPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPG 524          

HSP 18 Score: 54.6842 bits (130), Expect = 3.195e-7
Identity = 54/136 (39.71%), Postives = 66/136 (48.53%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL-------------MGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GP G+ G+   +G PG  G PG  G  G  G +G  G+PG+PG+ G+ G+ G  G  G+ GM+G  G PG RG  G  G  G PG              MG  G  G+KG  G  G KG  G QG  G
Sbjct:  480 DFGEVGVRGPNGELGS---EGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQG 612          

HSP 19 Score: 54.299 bits (129), Expect = 4.596e-7
Identity = 113/319 (35.42%), Postives = 136/319 (42.63%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPG----LMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGR---IGFPGADGITGVSGMPGVIGPTGTK------------------GDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGT------------------------GPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            V+GP    G+  V G  G  GP G +GR G KGPNGL G  GK G  G  G  G  G +G  G +G  G  G  G  G  G PG    + G  G +G  G KGP+GE+G  G               + G  G +GL G +G  G +GPIG    +GE G+ G    IG  G +G TGV G  G+ GP G +                  GD G +GK G  G  G PG  G  G +G  G  G  G  G  G KG QG                          GPQG +G  G  G  G  G  GI+G  G  GP+G
Sbjct:  486 VRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVG---------------KRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRG 789          

HSP 20 Score: 53.9138 bits (128), Expect = 5.131e-7
Identity = 55/149 (36.91%), Postives = 68/149 (45.64%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPG---------IPGE------------------TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
             GL G+ GP G PG  G  G  G  G  G+ GR GE+G +G+ GV G         +PG+                   G +G+PG+DG  G  G  G TG  G +G  G  GS G  GL G  G+ G KG  G  G  G  G+ G TG
Sbjct:   22 QGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTG 170          

HSP 21 Score: 53.1434 bits (126), Expect = 9.923e-7
Identity = 54/130 (41.54%), Postives = 62/130 (47.69%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGE------TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            G+ G+VG  G PG        GL GF G  G+ G +G DG  G +G  G  GIPG        G  G  G  G PG+ G RG  G  GP G  G  G  G PG  GD GKPG +G  G  G  G  G+ G
Sbjct:  185 GILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIG 314          

HSP 22 Score: 51.9878 bits (123), Expect = 1.809e-6
Identity = 78/228 (34.21%), Postives = 97/228 (42.54%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPG 1075
            +KG A   G     G AG  G  GP+G  GP G  G+                           +G  G  G  G  G  G  GL G QG  G+ G  G +G  G K                  G AG  G+PG +G +G  G  G  G  G PG+ G  G  G  G  G  G  G+ GP G +GD G  G +G EG+    G+ GK GS+GDPG PG+ G+ G+PG
Sbjct:  150 LKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGI---------------------------LGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFK------------------GHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQ---GVSGKAGSIGDPGDPGDEGNEGLPG 329          

HSP 23 Score: 51.9878 bits (123), Expect = 2.331e-6
Identity = 50/116 (43.10%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVP-GIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G EG  G  G+ G  G  GVPG  G+ G  GD G  G   G+PG+TG+ G  G  G  G  G  G  G+ G  G  G +GS G  G +G+  K G+KG  G TGP G  G +G TG
Sbjct:  533 GSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTG 648          

HSP 24 Score: 50.447 bits (119), Expect = 6.766e-6
Identity = 51/123 (41.46%), Postives = 59/123 (47.97%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  G  G  GL GF G  G+ G +G DG  G +G  G  GIPG  G  G  G  G  G  G  G  G  G  GP+G +G  G  GL GD G  G  G  G+ G  G+ G QG  GP+
Sbjct:  125 GAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPI 247          

HSP 25 Score: 49.6766 bits (117), Expect = 9.488e-6
Identity = 85/253 (33.60%), Postives = 99/253 (39.13%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGE------------------------PGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP---------------------GIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            MG  G +G  G  G  G+ G MG QG QG  G +GP GE+   G+ G              G  GPIG  G+ G  G QG  G  GP+G+                         G  G+IG  G  G  G  G  G +GP G  GD G  G+KGG+G  G                       G  G  G  G  GA G  G +GI G  G  G  GP G  G  G  GR G  G  G  G +G  GP G N
Sbjct:  584 MGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLK------------GETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGEN 824          
BLAST of Fibrillar collagen vs. Ensembl Nematostella
Match: EDO49368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG67])

HSP 1 Score: 125.946 bits (315), Expect = 1.430e-29
Identity = 67/203 (33.00%), Postives = 100/203 (49.26%), Query Frame = 2
Query: 3572 TISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSK-RLPIRDLTLGSDSDISEFRLKLSKVCFS 4177
            T     GTK  PARSC +LK  +   K G Y+IDPN G  +DA EV+C   T  TC+ PK +     S   N   +     E   + + DY +D  Q+ FL+++   A Q +   C N    E +     +  DN  E+T        K+  +ECQN  ++  +TVL +S   K +LPI D+      D ++F+++L  VCF+
Sbjct:  438 TYKEQEGTKGKPARSCRNLKIDNPDKKSGYYYIDPNEGSPSDAEEVWCDFTTNATCVFPKNTEIITRSLVVNSNGEDTWITENDDV-KIDYKLDVVQMKFLRLMHKTAKQNMTYHCYNSRAWEDSRT-IKLLGDNEEEITA-------KLRLNECQNKDNQWHKTVLDISTKQKDKLPIIDVAPYDLQDGAQFKIELGPVCFA 631          

HSP 2 Score: 78.5666 bits (192), Expect = 1.109e-14
Identity = 109/275 (39.64%), Postives = 139/275 (50.55%), Query Frame = 2
Query:  416 GNRYVAGPAG--LQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGG-EGVDGAPGIDG---------KDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GN+   GPAG  + G DG +G PGP+G  G+TGP G  G  G  G              GR+G  GA GPQG  G  G  G++G  G+ G  GP GE+G  G  G  G +G  G +G  G+ GP G PG+ G+ G+ G  G  G +G  G  G  G PG+ G  G  G+ G  G  G KGDRG +G KGG  G  G PG+ G         +DG +G  G  G  G +G+PG +G  G  G +G  G  G+ G PG  G +G  G  G  G  G+
Sbjct:   82 GNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAP------------GRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGI 344          

HSP 3 Score: 76.6406 bits (187), Expect = 4.735e-14
Identity = 85/216 (39.35%), Postives = 107/216 (49.54%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIG-----------SHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G  G  G +G  G+PG +G +G QG  GP GP G +G  G  G  G  G  G  GE GA G  G  G+ G+ G+QG  G             GP G  G  G  G PG +G  G +G PG  G  G +G +G +G KGG G  G PG+       G PG  GE G++G PG +G +G  G  G  G+ G  G+PG+ G  G  G  G+ G QG
Sbjct:    7 GPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGV------AGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQG 216          

HSP 4 Score: 74.7146 bits (182), Expect = 1.588e-13
Identity = 133/343 (38.78%), Postives = 167/343 (48.69%), Query Frame = 2
Query:  632 GKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG--------GEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQG----LAGLPGK---------------DGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            GK G  G QG QG+ G KG  GE                      GA GP      RG  G +GP G  GP+G+ G  G+ G PG DG  G  G PG  G  G  G++G QGK+G         +G  G PG  G  G  G PG  G+ G+NG PG  G +G  GPQG  G+ G  G  GL    G+ G  G  G +G +G+ G  G  G  G +GP G+PG  G PG  G  G  G PG +G QG +G  G+ G PG+ G  G PG+ G  G+ G++G RGS+G     +G PGK               DG +GP G  G+PG +  PG +G+ GP G  G
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEP---------------------GAVGP------RGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLP---GVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKG 313          

HSP 5 Score: 73.1738 bits (178), Expect = 4.369e-13
Identity = 99/261 (37.93%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGA---TGRPGLDGMIGIQGVKGDSGPQG 1201
              GP G QG +GP G  GPKG  G  G                        + GR G +GA G +G  GK G  G  G +G  G +GP G       AG PG  G +GP G  G+ G  G PG  GD G+ G  G  G  G  G  G+ G  G  G  G+ G+ G  GP G +G+ G  G++G  G  G  G  G  G  G PG  GE G++G PG +G QG +G  G+ G  G+    G PGL G  G +G KGD G +G
Sbjct:   26 AVGPRGQQGEEGPTGPAGPKGDAGKNG------------------------QDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAG-------AGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKG 255          

HSP 6 Score: 61.6178 bits (148), Expect = 1.620e-9
Identity = 57/136 (41.91%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQP------------GPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DDG  G  GP+G  G  G  GF G++G  G  GR G+RG QG  G  G  G  G  G PG  G PG  G RG+ G+P            GP G  GP G  G  G  G  G PG++G+ G++G  GL G  G  GP
Sbjct:   97 DDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGP 232          

HSP 7 Score: 61.6178 bits (148), Expect = 2.093e-9
Identity = 53/112 (47.32%), Postives = 63/112 (56.25%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            G+ G  GP+G+ GN   DG PG QG  G  G  G  G  G  G PG+ GE G +GTPG  G+ G +G  G  G+PG  GPAG      APGL G  G+ G KG  G+ GPKG
Sbjct:  156 GVAGTPGPQGERGN---DGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAG------APGLKGPRGEKGAKGDRGSKGPKG 258          

HSP 8 Score: 60.8474 bits (146), Expect = 3.128e-9
Identity = 55/123 (44.72%), Postives = 64/123 (52.03%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  G +G  G  G  G PG  G PG  G  G  G  G+ G  G  GE G  G+PG  G+PGV+G  G  G PG R   G +GS+GA GL G  G PG  G PG  GP+G  G +G  G
Sbjct:  133 DRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGER---GQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRG 252          

HSP 9 Score: 58.9214 bits (141), Expect = 1.431e-8
Identity = 54/123 (43.90%), Postives = 63/123 (51.22%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG---ERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G+ G  G+ G PG DG  G +G PG  G+ G   E+G+QGK G    P   G+ G  GR G PG  G RG TG PG  G  G  G+ G  G  G  G  GQKG  G  G +GL G  G  GP 
Sbjct:   46 GDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRG----PAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQ 164          

HSP 10 Score: 56.225 bits (134), Expect = 8.819e-8
Identity = 58/136 (42.65%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQG--------VPGVSGRDGERGDQGKLGV---PGIPGETGMNGTPGRDGRPGV---AGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DG  G  G  GK G  G+ G  GNQG        +PG  GR G  G QG  GV   PG  G+ G NG PGR G  G     G +GD G  G RG  G  G+ G  G  G+ GKPG++G+ G  G  G TG+ G  G
Sbjct:   60 DGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAG 195          

HSP 11 Score: 55.8398 bits (133), Expect = 1.169e-7
Identity = 54/128 (42.19%), Postives = 70/128 (54.69%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE---RGDQGKLGVPGIPGETGMNGTPGRDGR--PGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI---GKPGQKGKPGNTGPKGLTGNQG 2923
            D G  G VGP G+ G  G  G  G +G  G +G+DG     G +G+ G PG  G+ G++G  G  G+  P  AG+ GD G+ GP GP G  G TG PG  GD    G PG+ G  G  GP+G  G++G
Sbjct:   20 DRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKG 147          

HSP 12 Score: 54.299 bits (129), Expect = 2.913e-7
Identity = 38/78 (48.72%), Postives = 46/78 (58.97%), Query Frame = 2
Query: 2576 DGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP 2809
            DG++GP G+ G PGL G PG +G  G +G  G  G+ G  G PG PG     G PG  G  G AG+ G+ G PGPRGP
Sbjct:  282 DGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAM---GPPGDSGSKGAAGIIGEPGSPGPRGP 356          

HSP 13 Score: 53.9138 bits (128), Expect = 4.986e-7
Identity = 59/145 (40.69%), Postives = 69/145 (47.59%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRD------GERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGST----GAPGLM------------GDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +DG  G  G  G  G  G  G PG  G PGVSG        GERG QG  G  G+PG     G+PG  G PG+ G RG+ G  G RG  GP+G      G PGL             GD+G  G+ G+PG +G  GL G  G  G
Sbjct:  169 NDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRP---GSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAG 310          

HSP 14 Score: 51.9878 bits (123), Expect = 1.577e-6
Identity = 50/116 (43.10%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G PG  G  G PG +G  G  G  G RG QG+ G  G  G  G  G  G+DGRPG  G +G+ G PG +G  G  G  G  G  G  G  G  G  G  GP G  G++G+TGP
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGA-GIPGDDGRQGPPGPQGSRGVTGP 115          

HSP 15 Score: 50.8322 bits (120), Expect = 3.894e-6
Identity = 56/142 (39.44%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQG-KLGVPGIPGETGMN---------------GTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  G+PG+PG  G PG +G  G  G  G+RG +G K G  G PG+ G+                G  G DGRPG++G+ G  GQ GP   +G  G  GS G+PG  G +G PG  G  G  G  G  G+ G  GP+
Sbjct:  216 GSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRGPI 357          
BLAST of Fibrillar collagen vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 124.02 bits (310), Expect = 1.993e-28
Identity = 57/208 (27.40%), Postives = 95/208 (45.67%), Query Frame = 2
Query: 3569 DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSF--SKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNREL-TKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSK-RLPIRDLTLGSDSD-ISEFRLKLSKVCFS 4177
            +TI  P G K+ PA++C  L+        G Y+IDPN G   DA  V+C      +CISP ++     ++  + N  +K++S        + DY  + +Q+ FL++ S RA Q +   C N       ++   +  DN+     K        VI +EC     +  +T+L +    K RLPI D+ L        +  +++  VCF+
Sbjct: 1194 NTIRKPTGMKNNPAKTCKDLRMDHPDYVSGYYWIDPNEGSKKDAIRVYCDFSNDFSCISPTKAKLLNLRVQANVNKKDKWLSE-AFEEESQIDYSAEQSQIAFLRVFSKRAYQNVTYNCQNYKAWTNRKHSIKLRGDNDLIFHAKSPKKFQPTVILNECTTKDDQWHKTILAIDTKQKHRLPIVDMALFDFGKPHQKVTVEVGSVCFA 1400          

HSP 2 Score: 72.7886 bits (177), Expect = 1.101e-12
Identity = 85/228 (37.28%), Postives = 100/228 (43.86%), Query Frame = 2
Query:  590 RSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS------------------HGPEGEPGVGGRIGFPGADG------ITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            + G+ G  GP GP G PG  G+ GP+G  G  GPNG +G                  E G+ G  G PG +GD GS G  G                    G  G PG  G+ G PGA G      + G++GMPG  G  G KG  G  GK G  G  G  G  G+ G  G  G PG  G NG  G  G +G  GPQG  G  G  G PGL G  G  G +G+ G  G
Sbjct:  424 KRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKG------------------EQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDG 633          

HSP 3 Score: 70.8626 bits (172), Expect = 4.046e-12
Identity = 60/128 (46.88%), Postives = 68/128 (53.12%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGN---PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            DDG DG  G  GKP      G+ G PG  GV G  G +GE G  G  G  G  G  G +G  G  G PGVAG  G+ G+PG RGP GP+G  GAPG     G PG  GK G +GP+G  G  G  G M
Sbjct:  514 DDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQ---GPPGLPGKTGESGPRGERGTDGKPGAM 638          

HSP 4 Score: 65.0846 bits (157), Expect = 2.091e-10
Identity = 112/276 (40.58%), Postives = 130/276 (47.10%), Query Frame = 2
Query:  389 SVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG-PIGSH---------------GPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGI 1168
            S++G   + G   VAG  G  G  G +G  GP+GP G        G+ G  G  G  G  G NG  G  G  G  GPQGP G PG  G  G  G  G  GP GE+G  G  G  G +GP+G  G  G  GP G PG RG  G+ G P+  H               GP G PG  GR G PGA      SG  G  G  G++G+RG  G  G +G DGAPG DG +G  G  G  GE G  G PG+ G  G  G QG  G  G  G PG +G  G 
Sbjct:  531 SLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAK------GESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGA------SGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGA 794          

HSP 5 Score: 65.0846 bits (157), Expect = 2.414e-10
Identity = 63/149 (42.28%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  782 IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQ---------GGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            IG  G +G  G  G  G+ GP G PG+ G  G+PG DG  G  G  G+ GPTG  G+ G+ G+       G PGI+G +G  G PG  GE GS G PG  G Q         G  G  G+ G  GA G  G DG  G  G +G +GPQG
Sbjct:  927 IGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEP------GKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQG 1069          

HSP 6 Score: 64.3142 bits (155), Expect = 4.179e-10
Identity = 89/210 (42.38%), Postives = 104/210 (49.52%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
             G  G  G  G +G  G+PG +GS+G +G  GP       G  G  G PG  G +G IG +G  GPIG PG RG  G +G  G+ GP   +GE G  G  GFPG+ G  G SG  G  G  G +G  G  G  G EG  G PG DG+DG  G PG P      G+ G        GP G+ G  GA G PG DG  G QG  G  G  GL
Sbjct:  377 TGNPGATGINGDRGAPGRPGKIGSKGEKGSEGP------NGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGM------PGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGL 574          

HSP 7 Score: 63.5438 bits (153), Expect = 5.810e-10
Identity = 52/115 (45.22%), Postives = 64/115 (55.65%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDG------ERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTG 2896
            G DG+ GP+G  G  G  G  G++G+PGV+G++G      ERG  G  G  G PG  G  G PG+ G  G  G RG  G+PG  G  GP+G TG  GL G  GKPG +G  G  G
Sbjct:  555 GKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADG 669          

HSP 8 Score: 62.003 bits (149), Expect = 1.742e-9
Identity = 59/137 (43.07%), Postives = 71/137 (51.82%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQ---GVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPA------------GPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G+ GN GP G PG  G  G+PG     G PG  G  G  G  G+ G+PG PG+ G+NGT GR G PG+ G RG  G+PG  G              G  G  GA G  GD GK G++G  G  GP G  G++G  GP
Sbjct:  940 GITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGP 1076          

HSP 9 Score: 60.4622 bits (145), Expect = 5.446e-9
Identity = 91/209 (43.54%), Postives = 106/209 (50.72%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIG------------LPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEH---GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIG 1165
             G  G NGA GP+G  G PG  GS GP+G  G  G  GE G  G  G  G  G  G  G  GA G  G             PG++G  G +G +G  G  G P   GR GF GA G  G  G  G +G TG  G RG  G  G +GV GAPG +G  G  G+PG  G+    GS G PG++G QG +GPQG  G AG  GRPG  G+ G
Sbjct:  146 AGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRP---GRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPG 351          

HSP 10 Score: 60.077 bits (144), Expect = 7.897e-9
Identity = 113/283 (39.93%), Postives = 139/283 (49.12%), Query Frame = 2
Query:  785 GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPG---VIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG------------TGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGP---RGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            GL G RG  GS+G  G+ GP+G  G  G  G  G DG  G  G+PG    +G  G  G  GI+G  G  G+ G PG  G +G  G PG PG+ GS G  GS+G  G              G  G +G  G  G PG  G  G +G  G +GP G  G  G               +PG  G PG  G  G+ G  G  G  G  GPPG  GSPG +G+ GLPG DG +GKPG+ G       QG+ G+PG  GV G  G +G+PG +   GPQG  G +G +G
Sbjct:  306 GLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQG---------------SPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESG 573          

HSP 11 Score: 59.6918 bits (143), Expect = 9.671e-9
Identity = 59/151 (39.07%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 2570 GLDGNVGPEG---KPGNPGLDGFPGNQGVPGVSGRDGERGD------------QGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKP---------------GNTGPKGLTGNQGITG 2932
            G +GN+G  G   +PG PG DG PG  G PG  G+ G  G             QG  G PG  G  G+ G PG  G+ G  G RG  G  GP+GP+GP+GS G  G+ G  G+PG  G                 G +G  G+TGN G TG
Sbjct:  234 GEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATG 384          

HSP 12 Score: 59.3066 bits (142), Expect = 1.205e-8
Identity = 171/437 (39.13%), Postives = 199/437 (45.54%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG-PIGSH---------------GPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKG---SQGGTGPQGIIGNAGATGRPGLDG---------------MIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAG------------LPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            L G   + GP+G+ G  G  G PG  G  G  GP G  G+ G  G  G  G  G NG  G  G  G  GPQGP G PG  G  G  G  G  GP GE+G  G  G  G +GP+G  G  G  GP G PG RG  G+ G P+  H               GP G PG  GR G PGA G  G  G        G++G+RG  G  G +G DGAPG DG +G  G  G  GE G  G PG+ G     G  GP+G+ G  GA GR G  G               + G +GV G SG  G+ G  G  G +G  G  G  G+ G  G  G  G PG  G PG  G  GP+G  G NG  G+ G  G PG DG  G+PG+ G  G  G+ G              G+ G  GP G  G  G   PPG  G  G RG  GK
Sbjct:  532 LQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGA------KGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGK 962          

HSP 13 Score: 59.3066 bits (142), Expect = 1.311e-8
Identity = 97/274 (35.40%), Postives = 112/274 (40.88%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIG---------------FPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGID------------------------------------------GKDGSVGDPGAPGEHGSNGIP---------------GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            G  GR G  G  G  G PG  GS+G +G  GP G +G+ G  G  G  G  GP+GP GE G AG  G  G  G  G QGP G  G  G PG  G  G                 GA G+ G SG PG+   TGT G RG  G KGGEG  G+ G+                                           G+DG  G+PG PG  G  GIP               G KG +G +GP GI GN G  G PG+ G  G  G  G +G
Sbjct:  697 GTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGI---TGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAG 967          

HSP 14 Score: 58.9214 bits (141), Expect = 1.463e-8
Identity = 102/291 (35.05%), Postives = 123/291 (42.27%), Query Frame = 2
Query:  443 GLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNG--EQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGF------PGADGITGVSGMPGVIGPTGT------------KGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS---------------KGSQGGTGPQGIIGNAGATGRPGLDGMIGI---QGVKGDSGPQG 1201
            G +GPDGP G  G +GP+                              G +G+ G  G  G  G  G+ G  GPQG  GP+GP G   Q   G  GP       G  G  GA GP G PG+ G  GS GP G  G  G PG  G  G       PG+ GI G SG PG  G  G             KG +G +G  G  G+ G PG  G DG+ G PG+PG  G  G+ G                +G+ G  G +G+ GN G  G+ G  G  G    QG +G SGPQG
Sbjct:   73 GQRGPDGPPGDIGDQGPS------------------------------GEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQG 333          

HSP 15 Score: 58.151 bits (139), Expect = 3.049e-8
Identity = 54/118 (45.76%), Postives = 67/118 (56.78%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G VGP G  G+PG  G  G +G PG +G +G +G+QG  G  G PG  G  G+ G++G PG  G+RG  GQ    G  G EG TG PG  G  GKPG  GKP     +G+TG  G +G
Sbjct:  429 GRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQ---PGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSG 543          

HSP 16 Score: 57.7658 bits (138), Expect = 3.403e-8
Identity = 65/173 (37.57%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  764 LGAAGPIGLPGIRGD---------LGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVS---GMPGVIGPTGTKGDRGIQGKK---------------GGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             G  GP G PGI+G+          G  G +G  GP G+PG  G  G PG  GI G +   G+PG+ G  G+ G+ G  GK+               G +G  GA G DGKDG  G  G  G +G  G  G++G +G  G +G  G+ G+ G PG  G  G  GV G  GP G
Sbjct:  942 TGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPG 1114          

HSP 17 Score: 57.3806 bits (137), Expect = 4.311e-8
Identity = 71/206 (34.47%), Postives = 90/206 (43.69%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG---------VDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G +GP+G PG+ G++GP G  G KG  G                               PG  G  G  G +G  GP G+PG  G  G PG  GI G +G  G+ G  G +G  G  GK G +G          +G PG+ G  G+ GD G  G+ G  G  G  G QG  G +G  G  G  G  G DG  G  G +G+ GP G+
Sbjct:  931 GEKGPSGPPGITGNRGPPGSPGIKGERG------------------------------YPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGV 1106          

HSP 18 Score: 56.225 bits (134), Expect = 1.228e-7
Identity = 113/333 (33.93%), Postives = 133/333 (39.94%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEG-----------------EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNG------------IPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPG 1525
            G +GP G PG +G QGP G  G  GP                        LG  G  G  G+RGD G QG  G  GP G                   G+ G  G PG  G  G+ G  G  GP G +G+ G+ G+ G  G  GA G  G  G  G  GAPGE G  G            + G KG +G  G +G++G  G   RPG DG  G  G  G  G  GL G++G  G  GPPG  G  G PGN                                  GA G  G PG+ G  G  GSRG  G+QG  G  G  G  G  G+ G+PG
Sbjct:   73 GQRGPDGPPGDIGDQGPSGEAGKPGP------------------------LGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPG---RPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGN---------------------------------EGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPG 345          

HSP 19 Score: 56.225 bits (134), Expect = 1.260e-7
Identity = 56/147 (38.10%), Postives = 69/147 (46.94%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMN------------------GTPGRDGRPGVAG------MRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GP G PG  G +G  G QG PG +G  G +GD+G  G  G PG  G+                   G  G+DG+PG  G      ++G TG PGP G AG +G+ G PG  GD G  G  G  G +G  G  G  G+ G
Sbjct:  439 DPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAG 585          

HSP 20 Score: 55.4546 bits (132), Expect = 1.954e-7
Identity = 61/153 (39.87%), Postives = 73/153 (47.71%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGF---PGNQGVPG------------VSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPR---------------GPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G  G  G PG+PG+DGF   PG QG  G            + G+ GE G+ G+ G+ G PG  G +G PG  G PG  G  G TGQ GPR               G  G  G  G PGL G  G  G +G PGN GP+G +G QG  G
Sbjct:  184 ESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKG 336          

HSP 21 Score: 54.299 bits (129), Expect = 4.862e-7
Identity = 56/131 (42.75%), Postives = 67/131 (51.15%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETG------------MNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPK---GLTGNQGITGP 2935
            GP G+PG  GL G PG  G+ G +GR G  G +G+ G PG PG+ G             NG PG  G     G RGD G+ G +GPAGP+G  G  G  G+ G  G+KG  G TG     G  G QG  GP
Sbjct:  976 GPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQG---AKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGP 1103          

HSP 22 Score: 52.373 bits (124), Expect = 1.784e-6
Identity = 140/383 (36.55%), Postives = 159/383 (41.51%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGG---------------------------------------------RIGFPGADGITGVSGMPGVIGPTGTKGDRGIQ---GKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGAN---GKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQ------PGANKPPGPQGKMGP 1564
            G +G NG  G QGP G PG  G+          G NGEQG  G  GP G +GP G  G  G  G  G PGI G LG +G +GS G EG PG  G                                             R G PG  G  G  G PG+ GP G  G+RG     G+KG +G  G PGI G  G  G PG  GE G  G  G  G  G  G +G  G  G  G PG  G  GI G  G  G  GL                G  G+PG  G  G+ G PG  G  G  G  G  G  G  G  G DG+ G  G  G N   G  G+RGPRG +G  G  G DG  G  G  G+       G + PPGP+G +GP
Sbjct:  763 GTNGFNGKNGDQGPRGLPGTPGA---------PGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLK---------------GERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPGPRGNVGP 1121          

HSP 23 Score: 51.9878 bits (123), Expect = 1.893e-6
Identity = 52/119 (43.70%), Postives = 58/119 (48.74%), Query Frame = 2
Query: 2594 EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
             G PGN G  G PGN G+ G  G  G RG  G  G  G  G  G  G  G DGRPG  G+ GD G  G          RGP+G  G TG PG  G  G  G  G+PG  G KG  G++G
Sbjct:  290 RGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEG 408          

HSP 24 Score: 51.6026 bits (122), Expect = 3.088e-6
Identity = 56/135 (41.48%), Postives = 63/135 (46.67%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPG------------------NQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQ 2920
            G  G  G  G+PG PG DG PG                   +G  G SG  G  G++G  G PGI GE G  G  GR G PG  G+RG TGQPG  G  G  G  G  G  G  G PG KG+ G+ G  G  G Q
Sbjct:  889 GRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQ 1023          

HSP 25 Score: 50.0618 bits (118), Expect = 9.174e-6
Identity = 52/134 (38.81%), Postives = 66/134 (49.25%), Query Frame = 2
Query: 2573 LDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPG-----------VAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  GP+G PG+ G  G  G  G PG  G +G+ G+QG  G PG  G+ G  G PG   +              AG++G  G PGPRG     GP GS G  G  G++G PG+ G  G  G  G  G+ GI G
Sbjct:   71 VKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDG 204          
BLAST of Fibrillar collagen vs. Ensembl Nematostella
Match: EDO49401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGC7])

HSP 1 Score: 101.293 bits (251), Expect = 6.037e-24
Identity = 74/207 (35.75%), Postives = 106/207 (51.21%), Query Frame = 2
Query: 3584 PLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAI-----IFTDNNRELTKDDHHLSYK--VIKDECQNMSSEEAETVLLVSGDS-KRLPIRDLTLGSDSDI-SEFRLKLSKVCFS 4177
            PLGT   PAR+C  LK      + G Y+IDPNGG   D+  V+C      +CI+P Q  F K  YS     K+ +  +L G Q+F Y  D +QL+FL+++S RA+Q+I   C N      +          + + N  EL     +  YK  +IKD+C     +  +TVL V+ +S  RLPI D+ +    D   EF L++  VCFS
Sbjct:   25 PLGTHRHPARTCRDLKLCRPEAESGQYWIDPNGGITEDSILVYCDFALNASCITPNQ--FMKW-YSGRDGYKWFA-QDLHGSQQFHYTSDPSQLLFLRLLSDRASQKITYHCRNSVAWYDSRSRDFDKSIKLKSGNGIELYAASSN-KYKPTIIKDDCGVKDGKWRKTVLEVNTESTHRLPIVDIAVFDIGDRDEEFGLQIGSVCFS 226          
BLAST of Fibrillar collagen vs. Ensembl Nematostella
Match: EDO44697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV65])

HSP 1 Score: 106.686 bits (265), Expect = 4.519e-23
Identity = 63/219 (28.77%), Postives = 99/219 (45.21%), Query Frame = 2
Query: 3527 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMET-GETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQ--NMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDISEFRLKLSKVCF 4174
             + +    A++L  D I +P G KD PAR+C  L +   HL DG Y++DPN G + DAF  FC     G+TCI P + S     +++    K +     +G + F Y  +  QL FL+++S  A+Q     C       +T+    +F  N +E   D           ECQ    ++  A+ + L       LPI+D ++       E +  +  VCF
Sbjct: 1323 QHKEAIIEASVL-FDKIVLPEGKKDSPARTCRELMTLRKHLPDGKYWLDPNQGVIEDAFPAFCNFTAGGQTCIFPVKKSG---KWAKTSSGKELFSAIETGFKVFVYEANPVQLKFLRILSRSASQIFTHDC------PQTKPSLHLFGTNYKEFPSDHK---------ECQVGYRNTHTADKLEL-------LPIKDFSMSKTH--KELQFDVGPVCF 1513          

HSP 2 Score: 73.1738 bits (178), Expect = 8.088e-13
Identity = 81/196 (41.33%), Postives = 91/196 (46.43%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP GPTG  G  G  GPQG  G  G  G                    GE G  GPIGL G RG           GP+G  G+ G  G  G  G  G +G  G  GP G KG  G+ GK G  G DGAPG    DG+ G+PG  G  G+ GIPG +G  G  GP G  G +G  G PG  G  G  G  G SGP+G
Sbjct:  462 GPIGPTGLQGARGITGPQGETGSDGAQG------------------APGEGGLQGPIGLQGQRG---------PPGPKGSRGIAGEAGPDGPAGAQGKAGAKGTTGPNGEKGPAGLDGKNGINGEDGAPGS---DGAQGNPGPQGPTGTRGIPGPQGKNGKMGPTGPRGPSGKNGEPGPQGPEGEAGANGVSGPKG 627          

HSP 3 Score: 66.6254 bits (161), Expect = 6.808e-11
Identity = 59/140 (42.14%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  806 DLGSQGPIGSHG------PEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            D GS+GP+   G       +G  G  G +G PGA G +GV G  G+ GP G+ GD G +G+ G  G  G  G  G  G+ GD G PG  G+ G  G KG+QG  GP G +G  G TG  G +G+ G  G KG+  P G N
Sbjct:  232 DSGSEGPVRQLGKPGMDRAKGATGNTGLMGAPGAKGSSGVPGAQGMPGPRGSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGAN 371          

HSP 4 Score: 62.7734 bits (151), Expect = 1.151e-9
Identity = 133/339 (39.23%), Postives = 159/339 (46.90%), Query Frame = 2
Query:  593 SGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIG---LPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSG------------MPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGP 1564
            +GR G  G  GP G+ G+ G  G +G   P G NG++G  G +G PG  G +G  G  G AGP G    PG+ G  G++G  G  G  G+ G  G  G  G  GI G SG              G IGPTG +G RGI G +G  G DGA G  G+ G  G  G  G+ G    PG KGS+G  G  G  G AGA G+ G  G  G  G KG   P GL+G++GI G  G PGS G  GNPG                                   G  G  G+PG  G NGK G  GPRG        GK+G  GP G  G+ GAN   GP+G+MGP
Sbjct:  338 TGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGP---PGPKGSRGIAGEAGPDGPAGAQGKAGAKGTTGPNGEKG---PAGLDGKNGINGEDGAPGSDGAQGNPG---------------------------------PQGPTGTRGIPGPQGKNGKMGPTGPRGPS------GKNGEPGPQGPEGEAGANGVSGPKGEMGP 631          

HSP 5 Score: 60.4622 bits (145), Expect = 5.216e-9
Identity = 52/123 (42.28%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            D   G+ GP  + G PG+D   G  G  G+ G  G +G  G  G  G+PG  G  G  G +G+PG AG RG+ G+ GP G  G  G  GAPG  G +G   +KG  G+ GP G  G  G TGP
Sbjct:  230 DSDSGSEGPVRQLGKPGMDRAKGATGNTGLMGAPGAKGSSGVPGAQGMPGPRGSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAEGAMG---EKGNQGSRGPTGRVGPDGKTGP 349          

HSP 6 Score: 60.4622 bits (145), Expect = 5.627e-9
Identity = 52/126 (41.27%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDG------RPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGIT 2929
            G  GN G  G PG  G  G PG QG+PG  G  G+ G +G+ G  G  GE G  G PG +G       PG  G  G+ G  G RGP G  G  G  G  G  G PG+ G+ G   P G  G +G+T
Sbjct:  252 GATGNTGLMGAPGAKGSSGVPGAQGMPGPRGSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVT 377          

HSP 7 Score: 59.3066 bits (142), Expect = 1.320e-8
Identity = 54/124 (43.55%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
             G  G  GP+G+ G+ G  G PG  G+ G  G  G+RG  G  G  GI GE G +G  G  G+   AG +G TG  G +GPAG +G  G   + G+ G PG  G  GN GP+G TG +GI GP 
Sbjct:  470 QGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGPPGPKGSRGIAGEAGPDGPAGAQGK---AGAKGTTGPNGEKGPAGLDGKNG---INGEDGAPGSDGAQGNPGPQGPTGTRGIPGPQ 587          

HSP 8 Score: 59.3066 bits (142), Expect = 1.388e-8
Identity = 91/250 (36.40%), Postives = 110/250 (44.00%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFP------GADGITGVS------------GMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS------------------------KGSQGGTGPQGIIGNAGATGRP---GLDGMIGIQGVKGDSGPQG 1201
            G +G  GA G  GP G+ G  G QGP G NG +G  G  G +                  GA G  G  G RG  G  GP G  GP+G+ G+ GR G        GA+G  GV+            G  G+ GP G KGDRG  G  G  G  GA G +G  G  G  G  GE G  GI G+                        +G++G TGPQG  G+ GA G P   GL G IG+QG +G  GP+G
Sbjct:  282 GSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAE------------------GAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGPPGPKG 513          

HSP 9 Score: 56.6102 bits (135), Expect = 8.887e-8
Identity = 82/229 (35.81%), Postives = 99/229 (43.23%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQG---MNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSH---------GPEGEPGVGGRIGFPGADGITGVS---------------GMPGVIGPTGTKGDRGIQGKKGGEGV------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GP GP G  G  G QGPQG   M G                 G +G  G  G  G  G  GLPG RG  G++G  G           GP G+ G  G+ G PG DG+ G +               G PG +G  G +GDRG  G+ G  G        G  G  G+ G  GD G  G  G  G PG KG +G +G +G  GN GATG  G  G  G  G+ G+ G +G
Sbjct:  760 GPDGPAGLAGSQGEQGPQGPVGMKG---------------DNGPQGGAGAPGPSGGRGANGLPGPRGSRGTKGEAGPPGPNGPKGNVGPAGQVGNNGQDGTPGKDGVPGTNGGKGQPGPQGLPGPRGHPGGVGKVGLRGDRGKDGRDGEPGALGPRGPTGNKGELGRAGRTGDQGVAGRRGVTGQPGLKGEKGESGNRGAPGNVGATGAMGETGDQGATGITGEVGKEG 973          

HSP 10 Score: 56.6102 bits (135), Expect = 9.270e-8
Identity = 61/143 (42.66%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2585 VGPEGKPGNPGLDGFPGNQGV---------------PGVS------GRDGERGDQGKLGVPGIPGE------TGMNGTPGRDGRP---GVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            VGP G+ GN G DG PG  GV               PG        G+ G RGD+GK G  G PG       TG  G  GR GR    GVAG RG TGQPG +G  G  G+ GAPG +G  G  G+ G  G TG  G  G +G
Sbjct:  831 VGPAGQVGNNGQDGTPGKDGVPGTNGGKGQPGPQGLPGPRGHPGGVGKVGLRGDRGKDGRDGEPGALGPRGPTGNKGELGRAGRTGDQGVAGRRGVTGQPGLKGEKGESGNRGAPGNVGATGAMGETGDQGATGITGEVGKEG 973          

HSP 11 Score: 53.5286 bits (127), Expect = 7.905e-7
Identity = 52/125 (41.60%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP---RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            GL G  GP G  G+ G+ G  G  G  G  G+ G +G  G  G  G  G  G NG  G DG PG  G +G+ G  GP   RG  GP+G  G  G  G  G  G+ G+PG  GP+G  G  G++GP
Sbjct:  501 GLQGQRGPPGPKGSRGIAGEAGPDGPAGAQGKAGAKGTTGPNGEKGPAGLDGKNGINGEDGAPGSDGAQGNPGPQGPTGTRGIPGPQGKNGKMGPTGPRGPSGKNGEPGPQGPEGEAGANGVSGP 625          

HSP 12 Score: 50.8322 bits (120), Expect = 5.016e-6
Identity = 83/239 (34.73%), Postives = 102/239 (42.68%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGV------------DGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQ------------GGTGPQGIIGNAGATGR---------PGLDGMIGIQGVKGDSGPQG 1201
            MG  G  G+ G  G  G PG  GS G  G  G  GP G++G                  E G  GP G  G RG  G+ G  G+ G +G  G  G  G  G DG TG  G  G+ G  G KG+R   G  G  GV             GA G+ G  G  GD G+PG  G++G  G+KG +            G  GP+GI G +G  G           G  G  G+QG +G +GPQG
Sbjct:  260 MGAPGAKGSSGVPGAQGMPGPRGSTGDAGAEGQPGPAGQRG------------------EAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQG 480          

HSP 13 Score: 50.8322 bits (120), Expect = 5.321e-6
Identity = 65/166 (39.16%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  767 GAAGPI---GLPGI---RGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQG---KKGGEGVDGAPGIDGK------------DGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G+ GP+   G PG+   +G  G+ G +G+ G +G  GV G  G PG  G TG +G  G  GP G +G+ G QG     G  G  GAPG +G              G VG  G  G  G NGIPG  G +G   P G  G  G TG  G  G  G+QG  G  GP G
Sbjct:  234 GSEGPVRQLGKPGMDRAKGATGNTGLMGAPGAKGSSGVPGAQGMPGPRGSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAG 399          

HSP 14 Score: 50.0618 bits (118), Expect = 8.534e-6
Identity = 55/145 (37.93%), Postives = 65/145 (44.83%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRP------GVAGMRGDT------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKG------------KPGNTGPKGLTG 2914
            G  G  GP G  G+ G  G PG +G  G  G  G RG  G++G  G  G  G NG PGRDGR       G  G RG T            G  G  GPAGP+G  G+PG+ G  G  G KG            + G  GP+G+ G
Sbjct:  300 GEAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKG 444          
BLAST of Fibrillar collagen vs. Ensembl Medaka
Match: col2a1a (collagen type II A [Source:NCBI gene;Acc:100682394])

HSP 1 Score: 144.05 bits (362), Expect = 4.215e-34
Identity = 82/256 (32.03%), Postives = 128/256 (50.00%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAANILGSDT---------------ISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSF-SKISYSENPINKYISYGE-LSGIQRFDYVIDN-------TQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D A A N+   D                I  P G+K  PAR+C  LK      K G Y+IDPN G   DA +VFC METGE+C+ P  SS   K  +S    NK++ +GE ++G   F+Y  D+        Q+ FL+++ST A+Q +   C N++A ++ +    +   ++   N+ E+  + +   +Y V++D C   + +  +TV+   S  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1168 DPLRYMRADQAAAGNLRQHDAEVDATIKSLNNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFGETMNGGFHFNYGDDSLAPNTAAIQMNFLRLLSTEASQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVMEYRSQKTSRLPIVDI---APMDIGGADQEFGVDVGPVCF 1420          

HSP 2 Score: 67.781 bits (164), Expect = 9.530e-11
Identity = 84/205 (40.98%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  632 GKPGLMGSQGPQGMNGP---KGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIR------------GDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G PG  G  GP G  GP   +GP GE G  G  GP G  G  G  G  GA G  G PGI             G  G+ GP+G  G  G+PG+ G  G  G  G  G  G+ G  GP G +G RG +G+ G  G  G PG  G  G+ G PG  G  G  G PG +G  G +G +G  G+ G  G  GL G  G+ G  GD+GPQG
Sbjct:  303 GSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQG 507          

HSP 3 Score: 67.0106 bits (162), Expect = 1.479e-10
Identity = 138/334 (41.32%), Postives = 161/334 (48.20%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDG---MIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G +G  G  GP+G  G PGL G+ GPQG  G +GP GE                      GAAGP+G PG RG  G++G  G  G  G+ G  G  G PGA G  G +G PG  G +G  G RG+ G+         PG  G  G VG  GAPGE G  G PG +G++G  G  G  G  GATG PG  G   ++G  G++G  G  G  G +G  G  GP G  G  G PG  G  G  G PG  G  G  G QG  G  G  G+ G  G  G PG  G  G  G +GPRG   L G PG DG  G  G +G  GA  P G QG  G RG  G
Sbjct:  393 GIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEP---------------------GAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGR---------PGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRG---LPGTPGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAG 693          

HSP 4 Score: 67.0106 bits (162), Expect = 1.678e-10
Identity = 120/310 (38.71%), Postives = 135/310 (43.55%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGV------SGMPGVIGPTGT---KGDRGIQGKKGGEGVDGAPG---------------------IDGKDGSVGDPGAPGEHGSNGI------PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R  AGP GLQGP G  G PG  GP G  GP G  G  G  G              G  G  GA G  GP G  G +G +GP+G     G +G +G  G  GPPG  GP G  GE G AGP G PG RG  G +G  G  GP         +G+PG  G  G PG  G  G       SG PG  GPTG    KG RG QG  G  G  GA G                      DG  G  GDPG  G  G  G+      PG KG  G  GP G  G +G  G  G  G++G+ G +G+ G  GL
Sbjct:  637 FPGERGPAGPQGLQGPRGLPGTPGTDGPKGAIGPAGSRGAQGPQGL------------QGMPGERGAAGIPGPKGDRGDLGEKGPEGA---AGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGL 931          

HSP 5 Score: 65.855 bits (159), Expect = 3.559e-10
Identity = 60/145 (41.38%), Postives = 73/145 (50.34%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA------------------PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +G  GP G+PG       PG  G PGN+G PG  G  G++G  G+ G PG  G  G  G PGR G  G+ G RG TG+PG  GP G  G +GA                  PG+MG  G  G  G+PG +G KGL G  G+ G
Sbjct:  420 GEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRG 564          

HSP 6 Score: 64.6994 bits (156), Expect = 7.234e-10
Identity = 56/122 (45.90%), Postives = 70/122 (57.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQK---GKPGNTGPKGLTGNQGI 2926
            G  G  GP+G+ G PGL G PG QG  G  G  GE G  G LG PG  G  G  G PG+D   G+AG +G  G+ GP G +G +G+TG PG  G+ G PG +   G+PG+ GP+G  G  G 
Sbjct:  396 GFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQD---GLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGA 514          

HSP 7 Score: 62.003 bits (149), Expect = 5.219e-9
Identity = 43/89 (48.31%), Postives = 54/89 (60.67%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            G  G+ GERG  G  G  G PG  G+ G  G  G PG+ G +G+TG  G +G AG  G +GAPG MG  G PG++G+PG+TG  G  GN
Sbjct:  192 GKPGKSGERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGN 280          

HSP 8 Score: 60.077 bits (144), Expect = 2.193e-8
Identity = 53/123 (43.09%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 2606 GNPGLDGF------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G+PG+ GF            PG QG PG  G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP    G++GA G  GD G+PG+ G PG    +GLTG  G  GP 
Sbjct:  390 GDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPP---GASGAKGATGDPGRPGESGLPGA---RGLTGRPGDAGPQ 506          

HSP 9 Score: 57.3806 bits (137), Expect = 1.441e-7
Identity = 134/355 (37.75%), Postives = 159/355 (44.79%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK---------------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGK---PGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRG 1570
            G+SG  G  GPQG  G PG  G  G +G  G  G +G +G  G  G  G  G  G  G  G  GP GLPG RG  GS G  G+ G +G PG  G  G  G  G  G  G PG     GPTG +G  G QG +G  G  G+PG  G  G+ G  G PG  GS G PG                       G +G +G  GI G  G  G  G  G  G+QG  G  G +G  G  G  G+ GP G  G  G PGNRG P                                 G+DGL G  GA G+   PG+ G +G+ G  G PG+ G+ G  GL+G+PG     GPQGK+GP G
Sbjct:  195 GKSGERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFP---------------------------------GQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDA---GPQGKVGPSG 513          

HSP 10 Score: 55.4546 bits (132), Expect = 4.620e-7
Identity = 129/361 (35.73%), Postives = 148/361 (41.00%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIG---------PTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGL------------------PGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
              G  G +GA GP GP G PG  G  G  G  G +G +G  GP G  GP G  G  G  G  G+ G  G  G RG  G+QGP G  G  G PG  G  G PG DGI G  G  G  G         P G  G +G  G  G +G  G PGI G  G  G  G  G  G  G PG +G +G  GP+G  G AG  G PG  G  G +G  G  G  G  G  G  G  G  G+ G  G+PG                                      G  GLPG  G  G+PG  GP+G  G +G                   PG  G  GP G +G+PG +   G  G  G RGL GK
Sbjct:  244 EAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRP------------------------------------GESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGK 568          

HSP 11 Score: 55.0694 bits (131), Expect = 6.104e-7
Identity = 61/153 (39.87%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQ---GVPGVS---------------------GRDGERGDQGKLGVPGIPGETGMNGTPGRDGRP---GVAGMRGDTGQPGPRGPAGPEGSTGAP---GLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G+ GP G  GNPG DG PG +   G PG++                     G  G  GD G  G  G  G  G  G PG  G P   G  G RG  G+PG  GP GP G  GAP   G  G  G  GQKG PG  GP G +G +G TG
Sbjct:  328 ESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATG 480          

HSP 12 Score: 54.6842 bits (130), Expect = 8.341e-7
Identity = 60/161 (37.27%), Postives = 74/161 (45.96%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPG---LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG------------------------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGK------------PGNTGPKGLTGNQGITG 2932
            DG  G +GP G  G  G   L G PG +G  G+ G  G+RGD G+ G  G  G                        E+G  G  G  G  G  G RG+TG PGP G AGP G+ G PG  G+ G+PGQKG+            PG  GP G++G +G  G
Sbjct:  662 DGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLGEKGPEGAAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARG 822          

HSP 13 Score: 53.5286 bits (127), Expect = 1.908e-6
Identity = 60/153 (39.22%), Postives = 70/153 (45.75%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM------NGTPGRDGRP---GVAGMRGDT---------------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G  G  G PG PGL G  G++G PG+ G  GE G  G  G  G PGE+G        G PG  GRP   G AG RG+                      G PG +G AGP   TGA G  G  G  G+ G PG+ GP G +GN G  G
Sbjct:  199 ERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGP---TGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDG 348          

HSP 14 Score: 53.5286 bits (127), Expect = 2.239e-6
Identity = 45/94 (47.87%), Postives = 50/94 (53.19%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G SG  G RG  G  G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  744 GPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAG 837          

HSP 15 Score: 53.1434 bits (126), Expect = 2.909e-6
Identity = 86/199 (43.22%), Postives = 97/199 (48.74%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGM---PGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP GP+G PG  G+ G +G  GP GP G     G  G  G  G KG  GE G  G  G PG +G  G+ GP G  G  G  G  G  G PGA G  G +G    PG  G  G  G  G  GK G +GV G PG  G+ G     G  GAPGE G  G  G  G  G +GPQG+ G  G  G PG  G  G  G+ G SG
Sbjct:  741 GPAGPSGAPGTRGAPGDRGETGPPGPAG---FAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSG 936          

HSP 16 Score: 52.373 bits (124), Expect = 4.147e-6
Identity = 63/162 (38.89%), Postives = 71/162 (43.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFP---GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMN---------GTPGRDGRPGVA---------------------------GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GP G  G PG DG P   G QG PG  G  G  G QG  G PG  G TG++         G PG  G PG A                           G+RGD G  G +G AG  G  GAPG  GD G+ G  G  G +GP+GL G +GI G
Sbjct:  757 DRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVG 918          

HSP 17 Score: 51.9878 bits (123), Expect = 5.911e-6
Identity = 102/283 (36.04%), Postives = 118/283 (41.70%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP GP G++                           G  G  GA GP G TG PG  G                       GP+G+ G  GP G QG                  + G  GP G PG +GD G  GP G  GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G  G  G  G  G  G  G  G+PG  G  GS+G PG       KG +G TGP G  G  GA G PG  G  G QG +G+ GPQG
Sbjct:  792 GEAGAPGPQGPSGAPGPAGPTGVS---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQG------------------DAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGPGDRGPPGPVGPPGLTGPAGEPGREGNPGSDGPPGRDGSAGIKGDRGNTGPVGASGAPGAPGAPGPVGPTGKQGDRGEPGPQG 1029          
BLAST of Fibrillar collagen vs. Ensembl Medaka
Match: col2a1a (collagen type II A [Source:NCBI gene;Acc:100682394])

HSP 1 Score: 141.354 bits (355), Expect = 3.136e-33
Identity = 82/256 (32.03%), Postives = 128/256 (50.00%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAANILGSDT---------------ISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSF-SKISYSENPINKYISYGE-LSGIQRFDYVIDN-------TQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D A A N+   D                I  P G+K  PAR+C  LK      K G Y+IDPN G   DA +VFC METGE+C+ P  SS   K  +S    NK++ +GE ++G   F+Y  D+        Q+ FL+++ST A+Q +   C N++A ++ +    +   ++   N+ E+  + +   +Y V++D C   + +  +TV+   S  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1238 DPLRYMRADQAAAGNLRQHDAEVDATIKSLNNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFGETMNGGFHFNYGDDSLAPNTAAIQMNFLRLLSTEASQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVMEYRSQKTSRLPIVDI---APMDIGGADQEFGVDVGPVCF 1490          

HSP 2 Score: 69.3218 bits (168), Expect = 3.162e-11
Identity = 138/334 (41.32%), Postives = 161/334 (48.20%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDG---MIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G +G  G  GP+G  G PGL G+ GPQG  G +GP GE                      GAAGP+G PG RG  G++G  G  G  G+ G  G  G PGA G  G +G PG  G +G  G RG+ G+         PG  G  G VG  GAPGE G  G PG +G++G  G  G  G  GATG PG  G   ++G  G++G  G  G  G +G  G  GP G  G  G PG  G  G  G PG  G  G  G QG  G  G  G+ G  G  G PG  G  G  G +GPRG   L G PG DG  G  G +G  GA  P G QG  G RG  G
Sbjct:  463 GIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEP---------------------GAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGR---------PGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAAGATGPRGERGFPGERGPAGPQGLQGPRG---LPGTPGTDGPKGAIGPAGSRGAQGPQGLQGMPGERGAAG 763          

HSP 3 Score: 68.5514 bits (166), Expect = 5.031e-11
Identity = 84/205 (40.98%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  632 GKPGLMGSQGPQGMNGP---KGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIR------------GDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G PG  G  GP G  GP   +GP GE G  G  GP G  G  G  G  GA G  G PGI             G  G+ GP+G  G  G+PG+ G  G  G  G  G  G+ G  GP G +G RG +G+ G  G  G PG  G  G+ G PG  G  G  G PG +G  G +G +G  G+ G  G  GL G  G+ G  GD+GPQG
Sbjct:  373 GSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQG 577          

HSP 4 Score: 68.5514 bits (166), Expect = 5.663e-11
Identity = 120/310 (38.71%), Postives = 135/310 (43.55%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGV------SGMPGVIGPTGT---KGDRGIQGKKGGEGVDGAPG---------------------IDGKDGSVGDPGAPGEHGSNGI------PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
              G R  AGP GLQGP G  G PG  GP G  GP G  G  G  G              G  G  GA G  GP G  G +G +GP+G     G +G +G  G  GPPG  GP G  GE G AGP G PG RG  G +G  G  GP         +G+PG  G  G PG  G  G       SG PG  GPTG    KG RG QG  G  G  GA G                      DG  G  GDPG  G  G  G+      PG KG  G  GP G  G +G  G  G  G++G+ G +G+ G  GL
Sbjct:  707 FPGERGPAGPQGLQGPRGLPGTPGTDGPKGAIGPAGSRGAQGPQGL------------QGMPGERGAAGIPGPKGDRGDLGEKGPEGA---AGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGL 1001          

HSP 5 Score: 66.6254 bits (161), Expect = 2.320e-10
Identity = 60/145 (41.38%), Postives = 73/145 (50.34%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA------------------PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G +G  GP G+PG       PG  G PGN+G PG  G  G++G  G+ G PG  G  G  G PGR G  G+ G RG TG+PG  GP G  G +GA                  PG+MG  G  G  G+PG +G KGL G  G+ G
Sbjct:  490 GEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRG 634          

HSP 6 Score: 65.4698 bits (158), Expect = 4.794e-10
Identity = 56/122 (45.90%), Postives = 70/122 (57.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQK---GKPGNTGPKGLTGNQGI 2926
            G  G  GP+G+ G PGL G PG QG  G  G  GE G  G LG PG  G  G  G PG+D   G+AG +G  G+ GP G +G +G+TG PG  G+ G PG +   G+PG+ GP+G  G  G 
Sbjct:  466 GFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQD---GLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDAGPQGKVGPSGA 584          

HSP 7 Score: 62.7734 bits (151), Expect = 3.399e-9
Identity = 43/89 (48.31%), Postives = 54/89 (60.67%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            G  G+ GERG  G  G  G PG  G+ G  G  G PG+ G +G+TG  G +G AG  G +GAPG MG  G PG++G+PG+TG  G  GN
Sbjct:  262 GKPGKSGERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGN 350          

HSP 8 Score: 60.4622 bits (145), Expect = 1.502e-8
Identity = 53/123 (43.09%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 2606 GNPGLDGF------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G+PG+ GF            PG QG PG  G +G+RG +G+ G  G  G  G  G PG  G PG  G+ G  G PG RGP    G++GA G  GD G+PG+ G PG    +GLTG  G  GP 
Sbjct:  460 GDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPP---GASGAKGATGDPGRPGESGLPGA---RGLTGRPGDAGPQ 576          

HSP 9 Score: 58.9214 bits (141), Expect = 4.205e-8
Identity = 134/355 (37.75%), Postives = 159/355 (44.79%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGV---IGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSK---------------------GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGK---PGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRG 1570
            G+SG  G  GPQG  G PG  G  G +G  G  G +G +G  G  G  G  G  G  G  G  GP GLPG RG  GS G  G+ G +G PG  G  G  G  G  G  G PG     GPTG +G  G QG +G  G  G+PG  G  G+ G  G PG  GS G PG                       G +G +G  GI G  G  G  G  G  G+QG  G  G +G  G  G  G+ GP G  G  G PGNRG P                                 G+DGL G  GA G+   PG+ G +G+ G  G PG+ G+ G  GL+G+PG     GPQGK+GP G
Sbjct:  265 GKSGERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFP---------------------------------GQDGLAGQKGAPGERGPPGASGAKGATGDPGRPGESGLPGARGLTGRPGDA---GPQGKVGPSG 583          

HSP 10 Score: 57.7658 bits (138), Expect = 1.177e-7
Identity = 129/361 (35.73%), Postives = 148/361 (41.00%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIG---------PTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGL------------------PGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
              G  G +GA GP GP G PG  G  G  G  G +G +G  GP G  GP G  G  G  G  G+ G  G  G RG  G+QGP G  G  G PG  G  G PG DGI G  G  G  G         P G  G +G  G  G +G  G PGI G  G  G  G  G  G  G PG +G +G  GP+G  G AG  G PG  G  G +G  G  G  G  G  G  G  G  G+ G  G+PG                                      G  GLPG  G  G+PG  GP+G  G +G                   PG  G  GP G +G+PG +   G  G  G RGL GK
Sbjct:  314 EAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATGDPGRP------------------------------------GESGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGATGEPGKSGEKGLLGAPGLRGLPGK 638          

HSP 11 Score: 55.8398 bits (133), Expect = 4.140e-7
Identity = 61/153 (39.87%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQ---GVPGVS---------------------GRDGERGDQGKLGVPGIPGETGMNGTPGRDGRP---GVAGMRGDTGQPGPRGPAGPEGSTGAP---GLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G+ GP G  GNPG DG PG +   G PG++                     G  G  GD G  G  G  G  G  G PG  G P   G  G RG  G+PG  GP GP G  GAP   G  G  G  GQKG PG  GP G +G +G TG
Sbjct:  398 ESGTPGSPGPSGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGTSGDPGIAGFKGEAGPKGEIGPPGLQGAPGPQGEEGKRGPRGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGQKGAPGERGPPGASGAKGATG 550          

HSP 12 Score: 55.4546 bits (132), Expect = 5.754e-7
Identity = 60/161 (37.27%), Postives = 74/161 (45.96%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPG---LDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPG------------------------ETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGK------------PGNTGPKGLTGNQGITG 2932
            DG  G +GP G  G  G   L G PG +G  G+ G  G+RGD G+ G  G  G                        E+G  G  G  G  G  G RG+TG PGP G AGP G+ G PG  G+ G+PGQKG+            PG  GP G++G +G  G
Sbjct:  732 DGPKGAIGPAGSRGAQGPQGLQGMPGERGAAGIPGPKGDRGDLGEKGPEGAAGKDGARGLTGPIGPPGPGGPNGEKGESGPAGPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARG 892          

HSP 13 Score: 54.299 bits (129), Expect = 1.327e-6
Identity = 60/153 (39.22%), Postives = 70/153 (45.75%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGM------NGTPGRDGRP---GVAGMRGDT---------------------GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            + G  G  G  G PG PGL G  G++G PG+ G  GE G  G  G  G PGE+G        G PG  GRP   G AG RG+                      G PG +G AGP   TGA G  G  G  G+ G PG+ GP G +GN G  G
Sbjct:  269 ERGPSGPQGARGFPGTPGLPGIKGHRGYPGLDGAKGETGAVGAKGEAGAPGESGAPGPMGPRGLPGERGRPGSTGAAGARGNDGLPGPAGPPGPVGPAGAPGFPGSPGSKGEAGP---TGARGPEGAQGPRGESGTPGSPGPSGASGNPGTDG 418          

HSP 14 Score: 54.299 bits (129), Expect = 1.338e-6
Identity = 86/199 (43.22%), Postives = 97/199 (48.74%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGM---PGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP GP+G PG  G+ G +G  GP GP G     G  G  G  G KG  GE G  G  G PG +G  G+ GP G  G  G  G  G  G PGA G  G +G    PG  G  G  G  G  GK G +GV G PG  G+ G     G  GAPGE G  G  G  G  G +GPQG+ G  G  G PG  G  G  G+ G SG
Sbjct:  811 GPAGPSGAPGTRGAPGDRGETGPPGPAG---FAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSG 1006          

HSP 15 Score: 53.9138 bits (128), Expect = 1.531e-6
Identity = 45/94 (47.87%), Postives = 50/94 (53.19%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G SG  G RG  G  G  G PG  G  G PG DG+PG  G +G+ GQ G  G  GP+G +GAPG  G  G  G KG  G  GP G TG  G  G
Sbjct:  814 GPSGAPGTRGAPGDRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAG 907          

HSP 16 Score: 53.5286 bits (127), Expect = 2.146e-6
Identity = 102/283 (36.04%), Postives = 118/283 (41.70%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMG---------------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G AG  GP GP G PGP GP G++                           G  G  GA GP G TG PG  G                       GP+G+ G  GP G QG                  + G  GP G PG +GD G  GP G  GP G  G+ G+ G  G  G  G  G PG+ GP+G  G +G  G  G  G  G  G  G  G  G+PG  G  GS+G PG       KG +G TGP G  G  GA G PG  G  G QG +G+ GPQG
Sbjct:  862 GEAGAPGPQGPSGAPGPAGPTGVS---------------------------GPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQG------------------DAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGPGDRGPPGPVGPPGLTGPAGEPGREGNPGSDGPPGRDGSAGIKGDRGNTGPVGASGAPGAPGAPGPVGPTGKQGDRGEPGPQG 1099          

HSP 17 Score: 53.1434 bits (126), Expect = 2.741e-6
Identity = 63/162 (38.89%), Postives = 71/162 (43.83%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFP---GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMN---------GTPGRDGRPGVA---------------------------GMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GP G  G PG DG P   G QG PG  G  G  G QG  G PG  G TG++         G PG  G PG A                           G+RGD G  G +G AG  G  GAPG  GD G+ G  G  G +GP+GL G +GI G
Sbjct:  827 DRGETGPPGPAGFAGPPGADGQPGTKGEQGEPGQKGEAGAPGPQGPSGAPGPAGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPAGPAGPPGKDGPKGVRGDPGPAGRQGDAGLRGPAGAPGEKGDAGEDGPNGPSGPSGPQGLAGQRGIVG 988          
BLAST of Fibrillar collagen vs. Ensembl Medaka
Match: col1 (collagen type I alpha 1 [Source:NCBI gene;Acc:100144368])

HSP 1 Score: 137.887 bits (346), Expect = 3.622e-32
Identity = 81/254 (31.89%), Postives = 126/254 (49.61%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAA--------NILGS-----DTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SEN-PINKYISYGEL--SGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIACNN----MAVVEKTEYPAIIFTDNNR-ELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLT-LGSDSDISEFRLKLSKVCF 4174
            DP R   +DDAN          + L S     + I  P GT+  PAR+C  LK      K G Y+IDP+ G   DA +V+C METGETC+SP Q   ++ ++  S+N    K++ +GE    G Q F+Y  +       N QL FL+++ST A+Q +   C N    M         A++   +N  E+  + +   +Y V++D C + +    +TV+   +  + RLPI D+  +   +   EF L++  VCF
Sbjct: 1193 DPFRMFRADDANVLRDRDLEVDSTLKSLSQQIEQIRSPDGTRKNPARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYCNMETGETCVSPTQREVAQKNWYISKNIKEKKHVWFGETMNDGFQ-FEYGSEGSLPEDVNIQLTFLRLMSTEASQNLTYHCKNSVAYMDAAAGNLKKALLLQGSNEIEIRAEGNSRFTYSVLEDGCTSHTGTWGKTVIDYKTSKTSRLPIIDIAPMDIGAPDQEFGLEVGPVCF 1445          

HSP 2 Score: 83.1889 bits (204), Expect = 1.768e-15
Identity = 84/210 (40.00%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGD---PGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
             G+ G  G  GP GP G PG  G  GPQG +GP GP GE+                     G  GP G PG +G  G QG IG  G  GE G+ G  G PG  G  G  G PG         +RG  G  G  G  G+PG  G DG+ GD   PGAPG  G  G+ G  G +G  G  G+ G+ G  G  G DG  G  G +G +GP GL
Sbjct:  575 AGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGER---------------------GEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPG---------ERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGL 754          

HSP 3 Score: 81.2629 bits (199), Expect = 6.390e-15
Identity = 122/321 (38.01%), Postives = 141/321 (43.93%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGM------IGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGAN 1531
            G+ GR G  G  G  G+PG+MG  GP+G  G  G  GE+G                   +G  GP G PG  GD G QGP G  GP GE G  G  G PG  G+ G  G    IG  G  G++G+ G  G  G+ GA G  G  G  G PG  G  G+ G PGS G+ G  G  G  G  GA G PGL GM       G+ G++GD G QG  G  G  G  G  G  GPIG PG                                   GA G  G PG  G  G  G+RG  G +G +G PG  G  GP G  GQPGA 
Sbjct:  543 GQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGV------------------MGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQG---AIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPG---------------------------------PAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAK 809          

HSP 4 Score: 74.3294 bits (181), Expect = 9.832e-13
Identity = 59/126 (46.83%), Postives = 70/126 (55.56%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGN---PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            +DG  G+ G  G PG    PGL G PG +G  G+ G  G+RGDQG  G  G PG+ G  G  G  G PG AG  GD G+PG  GP GP G+ GAPG  G+ G PG  G  G  G  G  G +G +G
Sbjct:  688 NDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESG 813          

HSP 5 Score: 73.559 bits (179), Expect = 1.426e-12
Identity = 149/352 (42.33%), Postives = 169/352 (48.01%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRG---DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGD------PGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGL---PGIDGANGKPGSRGPRGSQGLA---GLPGKD---GVVGPFGL---SGQPGANKPPGPQGKMGPRGLTG 1579
            G+ G  G  G  G  G PG  G+ G +G  G  GP G +G  G+ G PG  GPKG  GE G  G  GLPG +G     GS GP G  GP G PG  GR G PG+ G  G  G+ G  GP G  GD G  G++G  G  G  G  GKDG  G        G  GE G  G  G+ G QG  GPQG IG  G  G  GL G  G  G+ G  G +G                      PG RG PG +G  G RG PG+ G+ G  G  G  G+PGA G  GL   PG  GA G PG RG RG QG     G PGKD   G+ GP GL   +G PG    PG  G +GP G  G
Sbjct:  450 GKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGF---------------------PGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARG 780          

HSP 6 Score: 72.4034 bits (176), Expect = 3.864e-12
Identity = 88/203 (43.35%), Postives = 103/203 (50.74%), Query Frame = 2
Query:  602 NGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGT---GPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            NG  G  G  G+PG  G  G  G  GP G +GE+G +G  G PG  G        GA G  G PG RG  GS GP G+ G  GE G  G +G  G+ G  G +G PG+ G  G  G  G  G  G  G  GAPG DG+ G  G  GA G+ G  G PG KG+ G     G +G++G  G  G PG DG  G QG  G SGP G
Sbjct:  416 NGEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGA------RGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAG 612          

HSP 7 Score: 70.8626 bits (172), Expect = 9.222e-12
Identity = 71/157 (45.22%), Postives = 80/157 (50.96%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDP------GAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            E+GA G  G PG +G+ G+   QGP G+HG EG+ G  G  G PGA G  G  G PG     G  G  G  G KG  G  GAPG+ G  GS G+P      G PG  G  G PGS G  G TGP G  G  G  G PG  G  G  GV G  GP+G 
Sbjct:  418 EVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGG---RGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGA 571          

HSP 8 Score: 68.9366 bits (167), Expect = 3.812e-11
Identity = 62/136 (45.59%), Postives = 71/136 (52.21%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGI------------PGETGMNGTPGRDGRPGVAGMRGDTGQPGPR---GPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G +GP G  G PG DG  G QG  G SG  GERG+QG  G PG             PG+ G  G PG  G PG+ G RGD G PG R   GP GP G+ G+PG  G+ G  G  G PG  G +G  G QG+ G
Sbjct:  579 GERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPG 714          

HSP 9 Score: 68.1662 bits (165), Expect = 7.491e-11
Identity = 59/132 (44.70%), Postives = 70/132 (53.03%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP------AGPEGSTGAPGLMGDIGKPGQK---GKPGNTGPKGLTGNQGITGPM 2938
            GL G  G  G+PG PG  G PG+ G PG++G  G+RG  G+ G PG  G  G  G+PG  G  G  G  G  G PG +GP       G  G+ G PGL GD G  G K   G PG  G +GLTG  G+ GP 
Sbjct:  627 GLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPA 758          

HSP 10 Score: 67.3958 bits (163), Expect = 1.308e-10
Identity = 60/129 (46.51%), Postives = 71/129 (55.04%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGP---AGPEGSTGAPGLMGDIGKPGQK---GKPGNTGPKGLTGNQGITG 2932
            ++G  G  G +G+PG  G  G PG QG PG  G +G+RG +G+ G PG  G  G  G PG  G PG  G  G  G PG RG     GP+GSTG PG  G+ G PG K   G PG+ GP G TG  G  G
Sbjct:  415 NNGEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPG 543          

HSP 11 Score: 65.4698 bits (158), Expect = 4.303e-10
Identity = 121/286 (42.31%), Postives = 141/286 (49.30%), Query Frame = 2
Query:  416 GNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNG------PKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGP------------IGLPGIRGDLGSQGPIGSHGP---EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGI------PGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            G R V GP G  G  G +G  GP+GP+G +GP G+ G+ G  G  G  G  GP G +G  G+ G  G  G  G PGL G++G +G  G      P GP G +G  G AG  G KG  G  G  GA GP             GLPG+RGD G QG  G+ G    +G  G+ G IG PG  G  G  G PG  GP G  G RG  G++G  G  G  G  G  GS G PGA GE G NG       PG  G  G  GPQG +GN GA G  G  G  G  G  G +G
Sbjct:  579 GERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGGAG 864          

HSP 12 Score: 64.3142 bits (155), Expect = 1.185e-9
Identity = 58/141 (41.13%), Postives = 69/141 (48.94%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPG------------VSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIG------KPGQKGKPGNTGPKGLTGNQGITG 2932
            + GL G+ G  G  G  G  GFPG +G PG             +G DG +GD G  G PG  G  G+ G PG  G  G+ G+RGD G  G +G  G  G  GA GL G IG       PG KG+PG  GP G  G +G  G
Sbjct:  643 EQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPG 783          

HSP 13 Score: 63.929 bits (154), Expect = 1.489e-9
Identity = 58/129 (44.96%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGD------IGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  G+PG PG  G  G+ G PG  G+ G  G  G+ G PG PG  G  G PG  G PG  G  GD G+PG RG  GP G  GAPG  GD       G  G  G+ G  GP G  G QG+ GP 
Sbjct:  504 GSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQ 632          

HSP 14 Score: 62.7734 bits (151), Expect = 2.925e-9
Identity = 60/144 (41.67%), Postives = 71/144 (49.31%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGER------------GDQGKLGVPGIPGETGMNGTPGR---DGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL------MGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  G  G+ G PG  GFPG+ G  G  G  GER            G+ G+ G PG+PG  GM G+PG    DG+ G AG  G  G+PGP G  G  G  G  G        GD GKPG++G  G TGP G  G  G +GP 
Sbjct:  459 GAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQ 602          

HSP 15 Score: 61.6178 bits (148), Expect = 6.308e-9
Identity = 53/118 (44.92%), Postives = 60/118 (50.85%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G +G  G PG  G PG QG  G  G+ GE+G  G  G PG+ G  G  G PG  G PG  G  G  G PG  G  G +G  GAPG  G  G PG +G PG  G  GL G +G  G
Sbjct:  612 GERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRG 729          

HSP 16 Score: 61.2326 bits (147), Expect = 9.380e-9
Identity = 89/224 (39.73%), Postives = 112/224 (50.00%), Query Frame = 2
Query:  920 GVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRG---PRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G +G  G KG+ G +G+ G  G  G PG  G++G  G  G PG  G+ G PG +G+ GG G  G  G AGA G P      G +G  G  GP+G  G  G  G  G PG+ G  G+PG+ G  G+ G  G  G                      DGR G PG  GA G+PG  G   P+G+ G AG PG+ GV+GP G +G PG +   GPQG  GP G  G+
Sbjct:  417 GEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAP------GERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQ---------------------DGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGE 613          

HSP 17 Score: 60.8474 bits (146), Expect = 1.239e-8
Identity = 59/133 (44.36%), Postives = 71/133 (53.38%), Query Frame = 2
Query: 2570 GLDGNVGP------EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGL------MGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G DG  GP      +G+PG PG  G  G  GV G  G  G  GD GK G  G+ G TG  G PG+DG  G  G  G +G  G RG  GP G+ G  GL      +G+ GKPG++G PG+ G  GLTG +G  G
Sbjct:  531 GPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRG 663          

HSP 18 Score: 60.077 bits (144), Expect = 2.146e-8
Identity = 57/130 (43.85%), Postives = 71/130 (54.62%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGD---TGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG---LTGNQGITGPM 2938
            DG  G  G  G  G PG+ GFPG +G  G +G+ GERG  G  G  G PG+ G +G  G  G  G AG RG+    G PG +G  GP+G+ G PG  G+ G PG  G PG TG +G     G +G  GP+
Sbjct:  545 DGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPV 674          

HSP 19 Score: 57.7658 bits (138), Expect = 1.085e-7
Identity = 53/124 (42.74%), Postives = 57/124 (45.97%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            + G  G  GP G  G  G  G  G  G PG  G  GERG  G  G PG  G  G  G PG  G PG+ G +G TG+P      G  G  G PG  G  G PG  G  G TGP G  G  G  GP
Sbjct:  433 EAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEP------GRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGP 550          

HSP 20 Score: 53.5286 bits (127), Expect = 2.265e-6
Identity = 40/85 (47.06%), Postives = 47/85 (55.29%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPG 2887
            G  G  G  GR GERG  G  G  G PG  G+ G  G  G  G+ G +GDTG  GP+G AG  G  G PG MG  G PG++G+ G
Sbjct:  213 GEDGESGKPGRAGERGPPGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEAGTPGENGTPGAMGPRGLPGERGRAG 297          

HSP 21 Score: 52.7582 bits (125), Expect = 3.095e-6
Identity = 55/134 (41.04%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  836 HGP------------EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             GP             GE G  G  G PGA G  G  G  G  G  G +G RG +G+ G  G  GAPG  G  G  G PG+ G  G+ G PG +G+ G  GP+G  G  G TG PGL G  G+ G  G  GP G
Sbjct:  401 PGPQGAGGAPGPKGNNGEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDG 534          

HSP 22 Score: 52.7582 bits (125), Expect = 3.790e-6
Identity = 89/239 (37.24%), Postives = 105/239 (43.93%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGI------------------QGKKGGEGVDGAPGIDGKDGSVGDPGAPGE---------------HGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            G +G  GA G QGP G  G+ G +G  G+ G +G  G+QG KG  G PG  G +G  G +G  GP G PG +G+ G+ GP+G  G  G PG  G  G PG  G  G  G  G  G  G  G+ G                   QG  G  G  GA G  G  G+ G PG  G                 G  G  G KG++G TGP G  G  GA G PG  G  G  G  G  G  GL
Sbjct:  693 GDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGGAGRVGPPGPAGNPGPPGPTGQAGKEGPKGNRGETGPAGRPGEVGAAGPPGPSGEKGSPGADGAPGSAGL 931          
BLAST of Fibrillar collagen vs. Ensembl Medaka
Match: col2a1a (collagen alpha-1(II) chain [Source:NCBI gene;Acc:100529192])

HSP 1 Score: 137.117 bits (344), Expect = 6.205e-32
Identity = 83/258 (32.17%), Postives = 129/258 (50.00%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAANILGSDTISV----------------PLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D+A  +N L    + V                P GT+  PAR+C  LK      K G ++IDPN G   DA +VFC METGETC+ P+ S   K ++  S++   K+I +GE +SG   F Y  D       N QL FL+++ST A+Q +   C N++A +++     +   ++   N+ E+  + +   +Y V++D C+  S   + TV    +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1167 DPLRYMRADEA--SNSLRQHDVEVDSTLKSLNSQIENMRSPDGTQKNPARTCRDLKLCHPEWKSGDFWIDPNLGCTADAIKVFCNMETGETCVYPRISKVPKKNWWSSKSKNLKHIWFGETISGGFHFSYGQDGPIPNSANIQLNFLRLLSTEASQNLTYHCKNSIAYMDQATGNLKKALVLQGSNDVEIRAEGNSRFTYSVMEDGCKRHSGRWSNTVFEYKTMKTSRLPIVDI---APMDIGGADQEFGVDIGPVCF 1419          

HSP 2 Score: 62.3882 bits (150), Expect = 4.445e-9
Identity = 113/318 (35.53%), Postives = 136/318 (42.77%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGP---NGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGV------SGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGI------------------------DGKDGSVGDPGAPGEHGSNGIPG---------------SKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
              G R  AGP GLQGP G  G PG  GP G  GP G  G                    G  G  G  G +G  G PG  G +G  G  GP+G    +G +G  G  GPPG  GP G  GE G+ GPIG PG+RG  G +G +G  GP         +G+PG  G +G  G  G +G       SG PG +GPTG  G +G +G +G  G  G PG                         DG  G+ GD G PG  G  G+ G                 G+ G  GPQG+ G+ G  G PG  G  G  G+ G SG
Sbjct:  636 FPGERGGAGPQGLQGPRGLPGTPGSDGPKGAIGPAGAAGP------------------QGPPGLQGMPGERGAGGIPGAKGDRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGPAGPAGAAGKDGPKGTRGDAGPPGRPGDAGLRGPAGPPGEKGEPGEEGKPGTDGPPGPQGLAGSRGIVGLPGQRGERGFPGLPGPSG 935          

HSP 3 Score: 62.3882 bits (150), Expect = 4.445e-9
Identity = 55/135 (40.74%), Postives = 67/135 (49.63%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP------------------------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G PGL G PG +G  G+ G  G+RGD G+ G  G P                        GETG  G  G  G  G  G RG+ G PGP G AGP G+ G PG  G++G+ GQKG+ G  GP+G +G  G  GP 
Sbjct:  677 GPPGLQGMPGERGAGGIPGAKGDRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPT 811          

HSP 4 Score: 59.3066 bits (142), Expect = 3.488e-8
Identity = 72/202 (35.64%), Postives = 88/202 (43.56%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGV---SGMPGV---------------------IGPTGTKGDRGIQGKKGGEGVDG------------APGIDGKDGSVGDPGA------------------PGEHG---SNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GA G  G  G+RG  G QGP G  G  G PG  G  G PG DGI G    +G PG+                     +GP G  GD G+ G KG  G  G              G +GK G+ G+PG                   PG+ G   + G PG +G  G +GP+G  G+ G TG PGL G  G+ G  GD+GPQG
Sbjct:  305 GAKGEAGPTGLRGAEGPQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGLPGFKGEVGPKGELGPVGPQGPPGPAGEEGKRGARGEPGTAGPLGPPGERGPPGNRGFPGQDGLAGAKGAPGDRGVAGASGPKGATGDPGRTGEPGLPGARGLTGRPGDAGPQG 506          

HSP 5 Score: 54.299 bits (129), Expect = 1.111e-6
Identity = 54/117 (46.15%), Postives = 67/117 (57.26%), Query Frame = 2
Query: 2582 NVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            N G  G+ G  G  G PG++GV G SG  G  GD G+ G PG+PG  G+ G PG  G  G  G  G +G+ G  GP GP+G+ G PG+MG  G  G  G+PG  G KGL G  G+ G
Sbjct:  447 NRGFPGQDGLAGAKGAPGDRGVAGASGPKGATGDPGRTGEPGLPGARGLTGRPGDAGPQGKVGPTGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRPGLRG 563          

HSP 6 Score: 54.299 bits (129), Expect = 1.261e-6
Identity = 56/138 (40.58%), Postives = 63/138 (45.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGF---------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G +G  GPEG PG  G  G                 G  G  G  G  G RG  G  G  G PG  G  G PG DG+PG  G  G++GQ G  G  GP+G +GAPG +G  G  G KG  G  G  G TG  G  G
Sbjct:  699 DRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAG 836          

HSP 7 Score: 53.5286 bits (127), Expect = 2.041e-6
Identity = 87/200 (43.50%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGA---------PGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDG 1156
             G SG  GA G  G TG+PGL G++G  G  G  GP G+ GP G +G  G  GP GP G  G  G +G PG +G  G  G  G  G  G PG+    G PG DG TG +G PG  GP G +G++G  G  G +G+ G          PG  G  G  G PGA G+ G  G PG +   GG GPQG+ G  G  G PG DG
Sbjct:  469 AGASGPKGATGDPGRTGEPGLPGARGLTGRPGDAGPQGKVGPTGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRPGL---RGLPGKDGETGSAGPPGPAGPAGERGEQGQPGPSGFQGLPGPAGPPGEAGKPGDQGVSGEAGAPGAVGQRGERGFPGER---GGAGPQGLQGPRGLPGTPGSDG 662          

HSP 8 Score: 51.6026 bits (122), Expect = 8.425e-6
Identity = 96/251 (38.25%), Postives = 112/251 (44.62%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNG------EQXXXXXXXXXXXXXXXXXXXELGAAGPIG---------LPGIRGDLGSQGPI---------------GSHGPEGEPGVGG------------RIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
              G +G  GA GPQGP G+ G  GS GP G +G  G +G        G  G AG PG  GP+GP G  GA GP+G         LPG +G++G +G +               G  G  GEPG  G              GFPG DG+ G  G PG         DRG+ G  G +G  G PG        G+PG PG  G  G PG  G QG  GP G  G  G  G PG  G  G  GV G  GP+G N
Sbjct:  309 EAGPTGLRGAEGPQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGLPGFKGEVGPKGELGPVGPQGPPGPAGEEGKRGARGEPGTAGPLGPPGERGPPGNRGFPGQDGLAGAKGAPG---------DRGVAGASGPKGATGDPG------RTGEPGLPGARGLTGRPGDAGPQGKVGPTGASGEDGRPGPPGPQGARGQPGVMGFPGPKGAN 544          
BLAST of Fibrillar collagen vs. Ensembl Medaka
Match: col2a1a (collagen alpha-1(II) chain [Source:NCBI gene;Acc:100529192])

HSP 1 Score: 135.191 bits (339), Expect = 2.595e-31
Identity = 83/258 (32.17%), Postives = 129/258 (50.00%), Query Frame = 2
Query: 3512 DPNRPMYSDDANAANILGSDTISV----------------PLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISY--SENPINKYISYGE-LSGIQRFDYVID-------NTQLMFLKMVSTRANQEIKIAC-NNMAVVEKT----EYPAIIFTDNNRELTKD-DHHLSYKVIKDECQNMSSEEAETVL-LVSGDSKRLPIRDLTLGSDSDI----SEFRLKLSKVCF 4174
            DP R M +D+A  +N L    + V                P GT+  PAR+C  LK      K G ++IDPN G   DA +VFC METGETC+ P+ S   K ++  S++   K+I +GE +SG   F Y  D       N QL FL+++ST A+Q +   C N++A +++     +   ++   N+ E+  + +   +Y V++D C+  S   + TV    +  + RLPI D+   +  DI     EF + +  VCF
Sbjct: 1114 DPLRYMRADEA--SNSLRQHDVEVDSTLKSLNSQIENMRSPDGTQKNPARTCRDLKLCHPEWKSGDFWIDPNLGCTADAIKVFCNMETGETCVYPRISKVPKKNWWSSKSKNLKHIWFGETISGGFHFSYGQDGPIPNSANIQLNFLRLLSTEASQNLTYHCKNSIAYMDQATGNLKKALVLQGSNDVEIRAEGNSRFTYSVMEDGCKRHSGRWSNTVFEYKTMKTSRLPIVDI---APMDIGGADQEFGVDIGPVCF 1366          

HSP 2 Score: 62.7734 bits (151), Expect = 2.938e-9
Identity = 113/318 (35.53%), Postives = 136/318 (42.77%), Query Frame = 2
Query:  410 LTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGP---NGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP---------EGEPGVGGRIGFPGADGITGV------SGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGI------------------------DGKDGSVGDPGAPGEHGSNGIPG---------------SKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
              G R  AGP GLQGP G  G PG  GP G  GP G  G                    G  G  G  G +G  G PG  G +G  G  GP+G    +G +G  G  GPPG  GP G  GE G+ GPIG PG+RG  G +G +G  GP         +G+PG  G +G  G  G +G       SG PG +GPTG  G +G +G +G  G  G PG                         DG  G+ GD G PG  G  G+ G                 G+ G  GPQG+ G+ G  G PG  G  G  G+ G SG
Sbjct:  583 FPGERGGAGPQGLQGPRGLPGTPGSDGPKGAIGPAGAAGP------------------QGPPGLQGMPGERGAGGIPGAKGDRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGPAGPAGAAGKDGPKGTRGDAGPPGRPGDAGLRGPAGPPGEKGEPGEEGKPGTDGPPGPQGLAGSRGIVGLPGQRGERGFPGLPGPSG 882          

HSP 3 Score: 62.3882 bits (150), Expect = 4.120e-9
Identity = 55/135 (40.74%), Postives = 67/135 (49.63%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP------------------------GETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G PGL G PG +G  G+ G  G+RGD G+ G  G P                        GETG  G  G  G  G  G RG+ G PGP G AGP G+ G PG  G++G+ GQKG+ G  GP+G +G  G  GP 
Sbjct:  624 GPPGLQGMPGERGAGGIPGAKGDRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPT 758          

HSP 4 Score: 59.6918 bits (143), Expect = 2.686e-8
Identity = 72/202 (35.64%), Postives = 88/202 (43.56%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGV---SGMPGV---------------------IGPTGTKGDRGIQGKKGGEGVDG------------APGIDGKDGSVGDPGA------------------PGEHG---SNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            GA G  G  G+RG  G QGP G  G  G PG  G  G PG DGI G    +G PG+                     +GP G  GD G+ G KG  G  G              G +GK G+ G+PG                   PG+ G   + G PG +G  G +GP+G  G+ G TG PGL G  G+ G  GD+GPQG
Sbjct:  267 GAKGEAGPTGLRGAEGPQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGLPGFKGEVGPKGELGPVGPQGPPGPAGEEGKRGARGEPGTAGPLGPPGERGPPGNRGFPGQDGLAGAKGAPGDRGVAGASGPKGATGDPGRTGEPGLPGARGLTGRPGDAGPQG 468          

HSP 5 Score: 55.0694 bits (131), Expect = 7.676e-7
Identity = 54/117 (46.15%), Postives = 67/117 (57.26%), Query Frame = 2
Query: 2582 NVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            N G  G+ G  G  G PG++GV G SG  G  GD G+ G PG+PG  G+ G PG  G  G  G  G +G+ G  GP GP+G+ G PG+MG  G  G  G+PG  G KGL G  G+ G
Sbjct:  409 NRGFPGQDGLAGAKGAPGDRGVAGASGPKGATGDPGRTGEPGLPGARGLTGRPGDAGPQGKVGPTGASGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGKPGEKGLVGRPGLRG 525          

HSP 6 Score: 54.299 bits (129), Expect = 1.014e-6
Identity = 56/138 (40.58%), Postives = 63/138 (45.65%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGF---------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G +G  GPEG PG  G  G                 G  G  G  G  G RG  G  G  G PG  G  G PG DG+PG  G  G++GQ G  G  GP+G +GAPG +G  G  G KG  G  G  G TG  G  G
Sbjct:  646 DRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAG 783          

HSP 7 Score: 52.373 bits (124), Expect = 5.087e-6
Identity = 96/251 (38.25%), Postives = 112/251 (44.62%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNG------EQXXXXXXXXXXXXXXXXXXXELGAAGPIG---------LPGIRGDLGSQGPI---------------GSHGPEGEPGVG------------GRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
              G +G  GA GPQGP G+ G  GS GP G +G  G +G        G  G AG PG  GP+GP G  GA GP+G         LPG +G++G +G +               G  G  GEPG              G  GFPG DG+ G  G P         GDRG+ G  G +G  G P      G  G+PG PG  G  G PG  G QG  GP G  G  G  G PG  G  G  GV G  GP+G N
Sbjct:  271 EAGPTGLRGAEGPQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGLPGFKGEVGPKGELGPVGPQGPPGPAGEEGKRGARGEPGTAGPLGPPGERGPPGNRGFPGQDGLAGAKGAP---------GDRGVAGASGPKGATGDP------GRTGEPGLPGARGLTGRPGDAGPQGKVGPTGASGEDGRPGPPGPQGARGQPGVMGFPGPKGAN 506          
BLAST of Fibrillar collagen vs. Planmine SMEST
Match: SMESG000024244.1 (SMESG000024244.1)

HSP 1 Score: 553.903 bits (1426), Expect = 2.493e-173
Identity = 321/322 (99.69%), Postives = 322/322 (100.00%), Query Frame = 2
Query: 3212 EPGHPGWMXXXXXXXXXXXXXDRGKPGDPGSPGIEXXXXXXXXXXXXXXXXXTGPNGEMGLMGPMGVTGRDGPSGPHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDISEFRLKLSKVCFS 4177
            EPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRDGPSGPHGLMGNAGPPGPPGPPAMMLPIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGK+NDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDISEFRLKLSKVCFS
Sbjct:  996 EPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRDGPSGPHGLMGNAGPPGPPGPPAMMLPIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKVNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDISEFRLKLSKVCFS 1317          

HSP 2 Score: 513.072 bits (1320), Expect = 3.485e-158
Identity = 451/452 (99.78%), Postives = 451/452 (99.78%), Query Frame = 2
Query:  227 MDIKTFLFIFFILSAAQAEPLSRLKRQXXXXXXXXXXXXXXXXXXXXXXXXXXXSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            MDIKTFLFIFFILSAAQAEPLSRLKRQAEGEFTFGGAGEEEPETTEAPMETLPPSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGPVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGP GLSGQPGANKPPGPQGKMGPRGLTGK
Sbjct:    1 MDIKTFLFIFFILSAAQAEPLSRLKRQAEGEFTFGGAGEEEPETTEAPMETLPPSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTGPQGKPGKDGKPGPIGPVGPQGPNGRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQGPKGDAGPPGGKGPKGPIGELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGK 452          

HSP 3 Score: 230.335 bits (586), Expect = 6.221e-61
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM
Sbjct:  780 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 904          

HSP 4 Score: 109.768 bits (273), Expect = 9.367e-24
Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 2
Query: 1952 IGITXXXXXXXXXXXXXXAGLMGLKGDIXXXXXXXXXXXXXISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIA 2233
            IGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIA
Sbjct:  576 IGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIA 669          

HSP 5 Score: 71.2478 bits (173), Expect = 6.367e-12
Identity = 133/357 (37.25%), Postives = 159/357 (44.54%), Query Frame = 2
Query:  614 GPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGS----------HGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGG---------------TGPQ---GIIGNAGATGR---PGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPP---GPQGKMGPRGLTGK 1582
            GP GP G  G+ G  G  GMNGP GP G +G  G +G            + G  G  G PG RG  GS G  G+           G +G+PG  G  G PG+ G  G  G PG IGPTG  G     GK G +G  G PG DG+DG +G  G+ G  GS+G  G +G++G                +GPQ   G+ GN G  G+   PGLDG  G QGV G SG  G  G  G +G  G PG  G  G PG                                     DGR G+ G+ G  G+PG RGP G +G  G PG  G +G  G  G+PG   P    G QG  GP G TGK
Sbjct:  604 GPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSG------------KTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSG---ALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGR------------------------------------DGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGK 909          

HSP 6 Score: 70.4774 bits (171), Expect = 9.081e-12
Identity = 142/342 (41.52%), Postives = 165/342 (48.25%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPG---------LMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
             G+SG  G  GP+GP G PG         L GSQGP G +G  GP G +G  G  GPPGG G        G +GP G  G+ G++G         PEG+PG  G  GFPG  G+ GVSG           G+RG QGK G  G+ G  G++G  G  G PG  G  G  G PG +G  G  G  G  G  G  G+PG  G  G  G KG +G QG+ G  G  G  G  G  G  G PG  G  G +G  G  G+PG  G  G  G  G  G  G  G++GLPG  G  GKPG  G  G       PGKDG  GP G  G PG   P G  G  GP+G  GK
Sbjct:  709 TGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPG------STGMSGPQGDDGLDGNVG---------PEGKPGNPGLDGFPGNQGVPGVSGR---------DGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGK------PGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGK 1020          

HSP 7 Score: 68.5514 bits (166), Expect = 4.374e-11
Identity = 87/233 (37.34%), Postives = 106/233 (45.49%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQG-------PQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKG------------GEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGS------------KGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            G++G+ G+ GP G  GKPG  GS G         G +G KG  GE G                  + G  G  G PG  G  G  GP G  G  G+PG  G +GFPG DG  G  G+ G  GP G+ G  G QG KG              G+ G  G DG DG+VG  G PG  G +G PG+            +G QG  G  GI G  G  G PG DG  G+ G++GD+G
Sbjct:  640 GKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDG------------------DAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQGPAGSSGKVGPQGAKGKVGPQGPPGGPGSTGMSGPQGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTG 854          

HSP 8 Score: 65.0846 bits (157), Expect = 4.073e-10
Identity = 59/127 (46.46%), Postives = 72/127 (56.69%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPG---NPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNT---GPKGLTGNQGITG 2932
            G+ G+VGP G  G   NPG  G PG  G PG  G  G +G QG  G PGI      NG+PG DGR G+ G+ G  G+PG RGP G +G  G PG  G +G  G  G+PG     GP+G  G +G+TG
Sbjct:  331 GIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGI------NGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTG 451          

HSP 9 Score: 64.6994 bits (156), Expect = 5.073e-10
Identity = 56/117 (47.86%), Postives = 63/117 (53.85%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            +GL G VGP GKPG PG +G PG  G  G  G  G  G  G  G+ G PG  G  G PG  G PG+ G  GD G  G  GP GP G  G  GLMG +G  G+ G    +GP GL GN
Sbjct:  964 EGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPMGVTGRDGP---SGPHGLMGN 1077          

HSP 10 Score: 63.1586 bits (152), Expect = 1.484e-9
Identity = 57/133 (42.86%), Postives = 71/133 (53.38%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE------RGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNT---GPKGLTGNQGITGP 2935
            D G+ G  G EG  G PG+DG  G+ G PG  G  G       +G QG  G  GI G  G  G PG DG  G+ G++GD+G  G  G +G  GS G PG +G IG PG +G PG     G +G+ G +G  GP
Sbjct:  242 DRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGP 374          

HSP 11 Score: 61.2326 bits (147), Expect = 5.832e-9
Identity = 66/161 (40.99%), Postives = 79/161 (49.07%), Query Frame = 2
Query:  764 LGAAGPIGLPGIRGDLGSQGPIGSHGPEG------------EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDR------GIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSG 1192
            +G AG  G PG+ G +G QG  G  GP+G             PG  G IG PG  G  G  G PG  G  GTKG +      GI G  G +G DG PGIDG +G    PG+ G  GS G+ G  G  G  GP G+ G  GA   PG  G +G +G+ G  G
Sbjct:  297 IGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGK---PGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPG 454          

HSP 12 Score: 60.077 bits (144), Expect = 1.580e-8
Identity = 62/145 (42.76%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  785 GLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD-GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIG---NAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            GL G++GD+G  GP+G  G  G  G+ G  G PG  G  G  G+ G  G  G+ G  G +GK G  G  G   I G+  G  G  G PGE G  G PGS GS G  GP G IG    +GA G+PG  G +G  G  G  G  GL+
Sbjct:  595 GLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLD 739          

HSP 13 Score: 59.3066 bits (142), Expect = 2.879e-8
Identity = 62/141 (43.97%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGN------PGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGET------GMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGA------PGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G  GP+G  GN      PGLDG  G QGV G SG  G  G  G +G  G PG        G  G PGR G PG  G+ G  G  GP GP G  GS GA      PG+ G  GKPG +G  G+ G  GL G  G+ GP+
Sbjct:  286 GSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPV 426          

HSP 14 Score: 58.5362 bits (140), Expect = 4.319e-8
Identity = 93/231 (40.26%), Postives = 107/231 (46.32%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMG------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXEL---GAAGPIGLPGIRGDLG---------------SQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
             G+ G  G  GP+G TG PGLMG       +G  G  GPKG  G QG  G  G  G  G  G  G     G  GP G  G RG+ G               ++GP+G  G EG PG  G +G PG  G  G  G  G  GP G  G  G  G    +G+ G PG  G  G  GDPG+PG  GS   PG  G QG  GP+   G  G  G  GL G +G+ G  G SGP GL
Sbjct:  853 TGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGP---QGLLGPPGPQGDRGKPGDPGSPGIEGS---PGDVGDQGVPGPK---GPTGPNGEMGLMGPMGVTGRDGPSGPHGL 1074          

HSP 15 Score: 57.7658 bits (138), Expect = 7.415e-8
Identity = 100/250 (40.00%), Postives = 117/250 (46.80%), Query Frame = 2
Query:  587 GRSGRNGAGGPQG------PTGKPGL---MGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRG---DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGK---------KGGEGVDGAPGIDGKDGSVGDPGAPGEH------------------------GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G  G  G  GPQG       TG+PGL   +G QG +G +GP+G NG  G  G  GPPG  GP G  G  G  G IG PG RG     GSQGP G  G  G PG  GR G PG DG    +G PG  GP G++G  G+ GK          G  G +  PG  GK G  G  G PG +                        G NG+ G+ G  G  G  G IG+AGA G PG DG  G  G++G  G +G
Sbjct:  283 GSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDG---ANGKPGSRGPRGSQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKG 529          

HSP 16 Score: 56.225 bits (134), Expect = 2.339e-7
Identity = 43/90 (47.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 2666 DGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            +G  G  GK G+PG  G  G  G PG++G+PG  G  G  G+PG  G  GP+G  G PG  GD GKPG  G PG  G  G  G+QG+ GP
Sbjct:  955 EGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGP 1044          

HSP 17 Score: 55.4546 bits (132), Expect = 3.785e-7
Identity = 153/443 (34.54%), Postives = 180/443 (40.63%), Query Frame = 2
Query:  398 GPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGD---------------RGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPG------------EHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGS---------------------QGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            GP  + G+    G  GL G DG  G+PG +GP G                          G  G  G++G  GP G +G+PG     GPQG  GP+G  G+ G  G  GP G  GP G  G  G+ G IG  G+ G+      IG  G  G PG  G  G PG  G  G  G  G+ GP G KG                RG++GK G  G DG  G  GKDG  GDPG  G            + G  G+ G KG  G TGP G +G  G +G PG++G  G QG KG  G  G  G+ G  G  G  G  G  G+ GN                                S G  G  G PG DG  GKPGS G  G                      +G  G PGKDG  G  GL G  G   P G  GK+GP+G  GK
Sbjct:  376 GPPGINGSPGADGRDGLPGIDGANGKPGSRGPRG------------------------SQGLAGLPGKDGVVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGN------IGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGN--------------------------VQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGALGKPGPKGPVGFPGKDGRDGRLGLDGSQG---PAGSSGKVGPQGAKGK 759          

HSP 18 Score: 54.299 bits (129), Expect = 9.189e-7
Identity = 99/275 (36.00%), Postives = 117/275 (42.55%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGE---PGVGGRIGFPGA---------------DGITGVSG---------------MPGVIGPTGTKGDRGIQG------------------------------------KKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
             G  G +G  GP+G  G PGL G  G QG+ G  G +GE+G +G  G PG  G  G  G  G  G  G+ G+RGD G  GP G  GPEG    PG+ G IG PG                 GITG  G               +PG  GP+G+ G RG  G                                    K G  G +G PG DGK G VG+PG PG  G  G+ G  G QG  G  G  G+ G  G PG  G  G+ G KG +GP G
Sbjct:  778 QGDDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPMGNTGKPGAAGKTGGKGLPGPDGPSGSVGRRGESGVPGKSGGFGSKGKKGAEGPVGPAGKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNG 1052          

HSP 19 Score: 53.9138 bits (128), Expect = 1.097e-6
Identity = 63/158 (39.87%), Postives = 74/158 (46.84%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGF------------PGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQ------PGPRGPAGPEGST----------------GAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            DG++G  G +GKPG+PG+ G             PG  G+ G+ G  G  G  G LGV GI G  GMNG PG  G  G  G+ G TG+      PG RG  G  GST                G PG  GD GKPG  G PG  GP G  G  G +G +
Sbjct:  558 DGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTGQSGAL 715          

HSP 20 Score: 51.9878 bits (123), Expect = 4.458e-6
Identity = 51/121 (42.15%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2624 GFPGNQGVPGVS---------GRDGERGDQGKLGVPGIPGETGMN---------GTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GFPG  G+ GVS         G  G+RG QGK G  G+ G  G++         G PG  G  G+ G +G  G  GP+G  G  G+TG PGL G IG  G K   G++GP+GL G  GI G
Sbjct:  217 GFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVK---GDSGPQGLNGRSGIIG 334          

HSP 21 Score: 51.6026 bits (122), Expect = 5.599e-6
Identity = 60/156 (38.46%), Postives = 73/156 (46.79%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGE------------RGDQGKLGVPGIPGETGMNGTPGRDGRPG---------------------VAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            +G  G +G  G PG PG DG PG  G+ G  G+ G+            +G +G  G PG PG+ G+NG PG+DG+PG                      AG+ G  G  GP GP GP G TG  GL G  G PG +G  G  G  G TG  G  GP
Sbjct:  495 NGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQGARGVRGKPGPPGKDGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGP 650          

HSP 22 Score: 51.2174 bits (121), Expect = 6.742e-6
Identity = 46/102 (45.10%), Postives = 56/102 (54.90%), Query Frame = 2
Query: 2633 GNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G +G+PG  G  G+ G  GK G PG  G+TG  G P   G PG  G +G  G PGP+G  G  G  G+PG+ G  G  G +G PG  GP G  G  G+ GPM
Sbjct:  962 GKEGLPGKVGPLGKPGKPGKEGKPGKDGKTGPVGEP---GHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPTGPNGEMGLMGPM 1060          

HSP 23 Score: 50.8322 bits (120), Expect = 8.909e-6
Identity = 117/304 (38.49%), Postives = 140/304 (46.05%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPE---GRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGIT---------------GVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAP---------GIDGKDGSVGDPGAPGEHGSNGIPGSKG-------SQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            V GP  L+G      P G QG  GP    G+PG  G  G  G  G PG  G  G  G +G  G  G +G+ G NGA G  G  G PG+ G  GP G  G +GP G++G  G+ G PGG+G +G                RG  G  GP G  G  G+PG  G+ G PG  GIT               G+ G+ G IGPTG  G  G+ G  G  G++G P         G+ GK G VG PG PG  G  G  GS G       S GG+G +G  G  G  G+PG  G  G  G  GD GP G
Sbjct:  422 VVGPVGLSGQPGANKPPGPQGKMGPRGLTGKPGSNGVPGPVGQPGPPGSQGSSGSPGLIGENGLLGNIGKPGSNGAPGAIGSAGAPGVPGDDGPPGPAGLRGPIGKKGKVGERGGPGGQGNQG---------------ARGVRGKPGPPGKDGVNGKPGKDGKPGDPGVIGITGKSGPPGPSGKPGPAGLMGLKGDIGPTGPLGPLGVTGISGLPGMNGPPGPQGYKGTMGLSGKTGKVGSPGPPGNRGKPGSSGSTGNVQIAGRSSGGSGTKGKPGEDGDAGKPGSPGSPGEIGPPGDIGPTG 710          
BLAST of Fibrillar collagen vs. Planmine SMEST
Match: SMESG000026651.1 (SMESG000026651.1)

HSP 1 Score: 236.498 bits (602), Expect = 8.622e-63
Identity = 137/323 (42.41%), Postives = 192/323 (59.44%), Query Frame = 2
Query: 3218 GHPGWMXXXXXXXXXXXXXDRGKPGDPGSPGIEXXXXXXXXXXXXXXXXXTGPNGEMGLMGPMGVTGRDGPSGPHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISY-GELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTL--GSDSDISEFRLKLSKVCFS 4177
            GHPGWMG  G  G  G  G RG PGD G  G  G PG+ G QG  GP G  G  GE G  GP+G+ GRDGP+G          P  P  P  +   +    R + +DDA A   LGSD +  PLGTKD+PAR+C  L   + +L+DG Y+IDPNGGK +DAF V C+ +  E+CI PK  S+    +  + + +Y S+ GE++G  +FDY I+ +QLMFLK+ ST A Q I I C+ ++VV  +E+P I+++D++ E+ ++     Y VI+D C+N +     T L +  ++ RLPIRD+ L  GS  +  +F L + +VCFS
Sbjct:  992 GHPGWMGTVGNPGARGKSGVRGDPGDRGPNGNNGPPGEPGVQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAG-LPGPVGNTGPPGPPGPPAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 1313          

HSP 2 Score: 106.686 bits (265), Expect = 8.540e-23
Identity = 225/450 (50.00%), Postives = 267/450 (59.33%), Query Frame = 2
Query:  233 IKTFLFIFFILSAAQAEPLSRLKRQXXXXXXXXXXXXXXXXXXXXXXXXXXXSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            I   L    ++    A+ L+R++RQ++ EFTFGGAGEE  E    P       VKGPAP  G++Y+ GP G  G  GP G PGPKGP G TG  G+ G  G  GP GP GP G NG+ G+ G+NG  GPQGPTG+PG+ G  GP G+ G KGP G +G KG  G  G  G  GP G LG  GP G PG RG +GS GP+G+ G  G  G+ GR G  G  G+ G  G+PG+ GP G KG +G  G KG  G DG PG DGK G+ G+ G PG+ G +G  G KG  G TG  G  G  G  G  G  G+IG  G KGD GP G +G  G+ G+ G  GSLG  G PG RG  G +G+PG RG  G+KGSQG  G  G+ G+PG DG+ G  GI G NG PG  GP G  GL G PGKDG  GP G  G PG N  PGPQG +G RG  GK
Sbjct:    2 INLSLVFVLLIVLISADSLNRIRRQSDDEFTFGGAGEETTEGPTLPP-----GVKGPAPFAGSQYIPGPQGDPGVRGPPGPPGPKGPPGPTGTPGRTGTSGSDGPPGPPGPPGDNGQDGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGK 446          

HSP 3 Score: 77.411 bits (189), Expect = 7.837e-14
Identity = 92/211 (43.60%), Postives = 107/211 (50.71%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITG---VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G+SG  G  GP G +G+ GL GS GP G  G KG  G  G  G AG            + GA+GP G  G  GDLG+   QGP+G  G  G  GV G  G PG DG  G   V G  G IGP G+ G RG QG     G+ G PG  G  G +G  G  G  G  GIPG  G  G  GP+G  G+ G  G PG  G+IG QG++G  G  G
Sbjct:  460 GQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGM---TGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAG 655          

HSP 4 Score: 67.0106 bits (162), Expect = 1.175e-10
Identity = 64/145 (44.14%), Postives = 80/145 (55.17%), Query Frame = 2
Query:  773 AGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
             GPIG  G++G+ G  G  GS GP G      R G PGA G  G+ G+PG  G TG+ G+ G  G+ G  G  G PG DGK G +G  G+ G  G +G+PG +G QG  GP+G IG  G  G PG  GM G  G  G +G  G+ 
Sbjct:  706 TGPIGSIGLKGERGPNGIDGSIGPPG------RNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIR 844          

HSP 5 Score: 65.0846 bits (157), Expect = 3.968e-10
Identity = 87/211 (41.23%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGG---RIGFPGADGITGVSGMPGVIGP---TGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G SG  G  G +GP GKPG+ G  G  G  GP+G NG+ G  G               E G  G +G  GIRG  G+ G  G  G  G+  V G    IG  G+ G  G  GM G+ GP    G KGD G  G  G  GV   PGI GK G VG PG  G  G  G+PG+ G+ G  GPQG+ G  G  G  G     G  G  G SGP+G
Sbjct:  484 GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTG---------------EQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGV---PGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSG--GQSGPRG 674          

HSP 6 Score: 64.6994 bits (156), Expect = 6.054e-10
Identity = 93/222 (41.89%), Postives = 118/222 (53.15%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLM---GSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD------------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G++G  GP G  G PG     G QGP G  GP G +G+ G  G+ GPPG  G +GPIG  G +G  GLPG  G  G++G  GS GP G+PG+ G     GA G  G  G  G +G TG +G  G  G  G  GV+GAPGI GKD            G++G  G+ G  G  G+ G +G  G  G +G IG+ G  GR G+ G+ G  G+ G  GP+G  
Sbjct:  409 GHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDN---GASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFK 627          

HSP 7 Score: 63.929 bits (154), Expect = 1.094e-9
Identity = 121/299 (40.47%), Postives = 140/299 (46.82%), Query Frame = 2
Query:  782 IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIG---FPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---------------------GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGP---------RGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            IG  G +GD+G  GP GS G  G PGV G +G   FPGA G  G+ G PG   P G  G +G QG  G  GV G PG DGK G V                     G PG  G+ G  G PG+ G     GPQG +G  G  G+ G DG+ G  G  G SG QG                  PIG PGN G  G  G+ G  G  G KGS+GP G PGI G  GA G  G  G +G  G  G +GP         RG  G  G+PGKDG  G   + G  G   P G  G+ GP+G+TG
Sbjct:  306 IGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG---PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQG------------------PIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 583          

HSP 8 Score: 63.1586 bits (152), Expect = 1.641e-9
Identity = 56/131 (42.75%), Postives = 69/131 (52.67%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVP---GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI-------------GKPGQKGKPGNTGPKGLT 2911
            DG  GN+GP G  G  G  G  G QG P   G+ G  G  G  G++GVPGIPG+ G+ G PG +G  G  G+ G+ G PG  GP G  G  G  G +G +             GKPG  GKPG +GPKG+ 
Sbjct:  561 DGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVA 691          

HSP 9 Score: 63.1586 bits (152), Expect = 1.831e-9
Identity = 126/321 (39.25%), Postives = 155/321 (48.29%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGD------LGSQGPIGSHGPEG---EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG---------VDGAPGIDGKDGSVGDPGAPGEH---GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGK---------------PGSRGPRGSQGLAGLPGKDGV------------VGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            ++G  GP G PG+RG+      LGSQG  G+ GP+G    PG  GR G  G+ G  G++G+PG  G  G  G  GI GK G  G         + G PG DGK G  G PG PG++   G  G  G +G  G +G  G+ GN G  G+ GL G IG  G  G  G  G NG SG  G+ G  G  G  G  G+ G  G  G  G  G  G  G QGP G  G  G  G +G  G+PG DG NGK                G RGP+G  G+ G PG  G+            +G  G+ G+PG   PPGP+G  G +GL G
Sbjct:  314 DIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPG 634          

HSP 10 Score: 62.3882 bits (150), Expect = 2.679e-9
Identity = 63/123 (51.22%), Postives = 72/123 (58.54%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DDG  G +GP G  G PG  G PG   + G  GRDG RG+ G  G PG+PG+ GM G  G DG+ G  G+RGD G  GP GP GP G+ G  G  G  GK G +G PG  GP G  GNQG TG
Sbjct:  777 DDGKVGPIGPRGSIGLPGPSGVPG---IRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTG 896          

HSP 11 Score: 62.3882 bits (150), Expect = 2.747e-9
Identity = 85/184 (46.20%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATG 1138
            GR+G  GA GPQG  G PG  G+ G  G  GP G  G  G  G  G  G  GP GP G +G  GP G+PGIRG  G  GP G  G  G+PG+ G IG PGA G  G +G PG+ G  GT G  G  G  G  G  G PG  GK G     G PG+ G  G  G++G  GG GP+G  G+ G  G
Sbjct:  731 GRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPR---GPPGKMGPVGPVGNQGPTGGAGPEGSPGHLGVQG 911          

HSP 12 Score: 60.8474 bits (146), Expect = 9.433e-9
Identity = 50/107 (46.73%), Postives = 62/107 (57.94%), Query Frame = 2
Query: 2603 PGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            PG+PG DG PG  G PG  G++ + G QG LG  G PG++G +G PG  G PG +G++G  G PG  G  G  GS G  G  G+ G  G  GKPG  G  G +G QG
Sbjct:  408 PGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQG 514          

HSP 13 Score: 58.9214 bits (141), Expect = 3.001e-8
Identity = 91/223 (40.81%), Postives = 113/223 (50.67%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPG---ADGITGVSGMPGVIGP---TGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPG-------APGEHGSNGIPGSKGSQGGTGPQGII---GNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +G NGA GPQGP G+ G +G+ G QG  G  G  G +G  G  G PG  G  G     GA G IG  G  G  G QG  G  GP G  G+ G IG  G     G+ G+ G PG++GP    G KGD+G+ G  G  GV G  G+ GK G  G  G       + G+ G  G PG  G  G +GP+G+    G  G  G  G  G IG  G+KG+ GP G++
Sbjct:  502 GIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGID 724          

HSP 14 Score: 57.3806 bits (137), Expect = 9.876e-8
Identity = 88/243 (36.21%), Postives = 114/243 (46.91%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMG---------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIG------------------LPGIRGDLGSQGPIGSHGPEG---EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            +G  G  G  GP GP+G PGL G               ++GPQG+ G  GP G  G KG  G  G  G  G  G+ G AG +G                  LPG  G  G  GP G  G  G   +PG  G +G  G  G +G  G+PG +GP G  G +G  G  G  G  G PG +G  G+ G+ G+ G +G  GI G  G+ G  GP+G  G+ G TG  G  G +G  G++G +G  G+
Sbjct:  306 IGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI 548          

HSP 15 Score: 57.3806 bits (137), Expect = 1.030e-7
Identity = 65/189 (34.39%), Postives = 84/189 (44.44%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGL------------DGFPGNQG------VPGVSGRDGERGDQGKLGVPGIPGETGMNGT---------------------------PGRDGRPGVAGMRGDTG---QPGPRGPAG---PEGSTGAPGLMGDIGKPGQ---------------KGKPGNTGPKGLTGNQGITGPM 2938
            G  G++GP G  G+PGL             GFPG +G       PG  GR G +G QG +G+ G+PG  G +G                            PG+DG+PG AG  G  G   QPGP+GP G   P G +G  G+ G++G PGQ               +G PG+ GP G  GN+G  GP 
Sbjct:  310 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY 498          

HSP 16 Score: 56.9954 bits (136), Expect = 1.150e-7
Identity = 54/129 (41.86%), Postives = 67/129 (51.94%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRG------------PAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            +G+DG++GP G+ G PG  G    QG+ G+ G  G  G  G++G PG  G  G +G PG DG+ G  G RG  G PGP G            P G  G  G PGL GDIG PG  G  G  G  G+ G+
Sbjct:  721 NGIDGSIGPPGRNGAPGAVG---PQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGD 846          

HSP 17 Score: 53.9138 bits (128), Expect = 1.051e-6
Identity = 56/138 (40.58%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRD------GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK---------PGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G +G  G PG  G DG PGN G PG SG  G  G  G  G  G+PG  G +GT G        G+PG+AG  G +G  GPRG  G  G+TG  G +G++G          PG  GK G  G   + G +G  GP+
Sbjct:  433 GPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI 570          

HSP 18 Score: 53.9138 bits (128), Expect = 1.087e-6
Identity = 54/135 (40.00%), Postives = 67/135 (49.63%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGV---SGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLM---------GDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GP G+ GN G+ G  G  G+PG    +G+D   G +G +G  G  G  G  G  G  G PG  G++GD G  GP G  G  G  G PG++         GD G PG  G PG  GP+GL G +G  G
Sbjct:  521 DLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAG 655          

HSP 19 Score: 53.5286 bits (127), Expect = 1.332e-6
Identity = 55/147 (37.41%), Postives = 72/147 (48.98%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG---------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG------------------LMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G VG  G PG  G+ G PGNQG         +PG+ G +GE+G QG LG   I G  G +G PG DG+ G  G  GD G+ G  GP+G +G  G  G                  ++G++G  G  G  G +G  GL GN G+ G +
Sbjct:  193 GPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLG---IKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSL 336          

HSP 20 Score: 53.5286 bits (127), Expect = 1.537e-6
Identity = 87/225 (38.67%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQ-GPIGSHGPEGEPGVGGRIGFP------------------GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            +G  G  G+ GP G  G PG+ G  G  G  GP+G  G++G  G+ G PG  GP+G  G+ G AG +G     G  G Q GP G  GP G+PG  G  G                    G+ G+ G  G  G+ G  G  G  G  G  G +G+ G PG  G  GSVG+ G PG+ G NG  G  G  G  GP   IG  G+ G PG  G+ GI+G +G  GP+G
Sbjct:  591 IGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGP---IGPRGSIGLPGPSGVPGIRGQQGRDGPRG 812          

HSP 21 Score: 52.7582 bits (125), Expect = 2.286e-6
Identity = 55/135 (40.74%), Postives = 68/135 (50.37%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGK---------PGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN---QGITG 2932
            DDG+ GNVGP G+         PGN G  G PG+ G  G  G  G +G  GK G+ G  G +G  G  G +G  G  G +G  G+ G  G  G  G+ G PG  G+ GK    G  GN GP G +G    QG+TG
Sbjct:  449 DDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 583          

HSP 22 Score: 52.373 bits (124), Expect = 3.125e-6
Identity = 56/128 (43.75%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGN---QGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK---PGQKGKPGNTGPKGLTGNQGITGP 2935
            G+ G+ G  G+ G  G+ G  GN   QG  G  GR G  G  G +G  G PG  G++G PG  G PG   M+G  G PG RGP G +GS G  G+ G IG+   PG  GK G  G  G  G  GI GP
Sbjct:  151 GVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPG---MQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP 275          

HSP 23 Score: 51.9878 bits (123), Expect = 3.892e-6
Identity = 45/100 (45.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQP------GPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G++G+ G QG  G PGI G TG  G PG  G  GV G +G  G+       GPRG  GP+G TGAPG  G +G PG  G  G+ G +G++G  G  G
Sbjct:  115 GKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQG 214          

HSP 24 Score: 51.9878 bits (123), Expect = 4.200e-6
Identity = 52/121 (42.98%), Postives = 62/121 (51.24%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G DG  GP G PG PG +  PG QG  G  G  G+ GD G  G  G PG++G+ G  G  G  G  G+ G  G  G +G  G +G  G PG+ GD G  G +G  G  G  G TG QG  G
Sbjct:  412 GKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVG 532          

HSP 25 Score: 51.6026 bits (122), Expect = 5.644e-6
Identity = 82/208 (39.42%), Postives = 93/208 (44.71%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRG---------DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD---------------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
            GP G  GL G +GP G++G  GP G  G  G  GP G  G  G  G  G+ G IG PG  G         D G  GPIG  G  G PG  G  G  G  G  G  G  G+ G  G  GD G+ G  G +G  G PGI G                 G  G+PG PG+ G  G PG  G  G  G QG  G AG  G P   G +G+QG
Sbjct:  707 GPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTGGAGPEGSP---GHLGVQG 911          

HSP 26 Score: 50.8322 bits (120), Expect = 9.854e-6
Identity = 58/145 (40.00%), Postives = 73/145 (50.34%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLG------------VPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK---------PGQKGKPGNT---GPKGLTGNQGITG 2932
            G  G+ GP GKPG  G +G  G QG  G +G  G  G+QG +G             PGIPG+ G NG    DG  G  G  G +G+ GP+G  G +G  G+ GL GDIG          PG  GKPG     GP+G  G++G+ G
Sbjct:  490 GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPG 634          
BLAST of Fibrillar collagen vs. Planmine SMEST
Match: SMESG000026651.1 (SMESG000026651.1)

HSP 1 Score: 236.113 bits (601), Expect = 1.022e-62
Identity = 137/323 (42.41%), Postives = 192/323 (59.44%), Query Frame = 2
Query: 3218 GHPGWMXXXXXXXXXXXXXDRGKPGDPGSPGIEXXXXXXXXXXXXXXXXXTGPNGEMGLMGPMGVTGRDGPSGPHXXXXXXXXXXXXXXXXXXXXIIYDPNRPMYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISY-GELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTL--GSDSDISEFRLKLSKVCFS 4177
            GHPGWMG  G  G  G  G RG PGD G  G  G PG+ G QG  GP G  G  GE G  GP+G+ GRDGP+G          P  P  P  +   +    R + +DDA A   LGSD +  PLGTKD+PAR+C  L   + +L+DG Y+IDPNGGK +DAF V C+ +  E+CI PK  S+    +  + + +Y S+ GE++G  +FDY I+ +QLMFLK+ ST A Q I I C+ ++VV  +E+P I+++D++ E+ ++     Y VI+D C+N +     T L +  ++ RLPIRD+ L  GS  +  +F L + +VCFS
Sbjct:  997 GHPGWMGTVGNPGARGKSGVRGDPGDRGPNGNNGPPGEPGVQGSVGPTGTKGFPGENGSPGPVGMPGRDGPAG-LPGPVGNTGPPGPPGPPAVFFPVRTVRRDLLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSEHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 1318          

HSP 2 Score: 107.457 bits (267), Expect = 5.508e-23
Identity = 225/455 (49.45%), Postives = 269/455 (59.12%), Query Frame = 2
Query:  218 LLEMDIKTFLFIFFILSAAQAEPLSRLKRQXXXXXXXXXXXXXXXXXXXXXXXXXXXSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            + +  I   L    ++    A+ L+R++RQ++ EFTFGGAGEE  E    P       VKGPAP  G++Y+ GP G  G  GP G PGPKGP G TG  G+ G  G  GP GP GP G NG+ G+ G+NG  GPQGPTG+PG+ G  GP G+ G KGP G +G KG  G  G  G  GP G LG  GP G PG RG +GS GP+G+ G  G  G+ GR G  G  G+ G  G+PG+ GP G KG +G  G KG  G DG PG DGK G+ G+ G PG+ G +G  G KG  G TG  G  G  G  G  G  G+IG  G KGD GP G +G  G+ G+ G  GSLG  G PG RG  G +G+PG RG  G+KGSQG  G  G+ G+PG DG+ G  GI G NG PG  GP G  GL G PGKDG  GP G  G PG N  PGPQG +G RG  GK
Sbjct:    2 IEKFMINLSLVFVLLIVLISADSLNRIRRQSDDEFTFGGAGEETTEGPTLPP-----GVKGPAPFAGSQYIPGPQGDPGVRGPPGPPGPKGPPGPTGTPGRTGTSGSDGPPGPPGPPGDNGQDGKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGK 451          

HSP 3 Score: 77.411 bits (189), Expect = 7.847e-14
Identity = 92/211 (43.60%), Postives = 107/211 (50.71%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITG---VSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G+SG  G  GP G +G+ GL GS GP G  G KG  G  G  G AG            + GA+GP G  G  GDLG+   QGP+G  G  G  GV G  G PG DG  G   V G  G IGP G+ G RG QG     G+ G PG  G  G +G  G  G  G  GIPG  G  G  GP+G  G+ G  G PG  G+IG QG++G  G  G
Sbjct:  465 GQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAG------------DNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGM---TGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAG 660          

HSP 4 Score: 67.0106 bits (162), Expect = 1.206e-10
Identity = 64/145 (44.14%), Postives = 80/145 (55.17%), Query Frame = 2
Query:  773 AGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
             GPIG  G++G+ G  G  GS GP G      R G PGA G  G+ G+PG  G TG+ G+ G  G+ G  G  G PG DGK G +G  G+ G  G +G+PG +G QG  GP+G IG  G  G PG  GM G  G  G +G  G+ 
Sbjct:  711 TGPIGSIGLKGERGPNGIDGSIGPPG------RNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIR 849          

HSP 5 Score: 65.0846 bits (157), Expect = 4.143e-10
Identity = 87/211 (41.23%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGG---RIGFPGADGITGVSGMPGVIGP---TGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            G SG  G  G +GP GKPG+ G  G  G  GP+G NG+ G  G               E G  G +G  GIRG  G+ G  G  G  G+  V G    IG  G+ G  G  GM G+ GP    G KGD G  G  G  GV   PGI GK G VG PG  G  G  G+PG+ G+ G  GPQG+ G  G  G  G     G  G  G SGP+G
Sbjct:  489 GPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTG---------------EQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGV---PGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSG--GQSGPRG 679          

HSP 6 Score: 64.6994 bits (156), Expect = 6.321e-10
Identity = 93/222 (41.89%), Postives = 118/222 (53.15%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLM---GSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD------------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G++G  GP G  G PG     G QGP G  GP G +G+ G  G+ GPPG  G +GPIG  G +G  GLPG  G  G++G  GS GP G+PG+ G     GA G  G  G  G +G TG +G  G  G  G  GV+GAPGI GKD            G++G  G+ G  G  G+ G +G  G  G +G IG+ G  GR G+ G+ G  G+ G  GP+G  
Sbjct:  414 GHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDN---GASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFK 632          

HSP 7 Score: 63.5438 bits (153), Expect = 1.171e-9
Identity = 121/299 (40.47%), Postives = 140/299 (46.82%), Query Frame = 2
Query:  782 IGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIG---FPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSV---------------------GDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGP---------RGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            IG  G +GD+G  GP GS G  G PGV G +G   FPGA G  G+ G PG   P G  G +G QG  G  GV G PG DGK G V                     G PG  G+ G  G PG+ G     GPQG +G  G  G+ G DG+ G  G  G SG QG                  PIG PGN G  G  G+ G  G  G KGS+GP G PGI G  GA G  G  G +G  G  G +GP         RG  G  G+PGKDG  G   + G  G   P G  G+ GP+G+TG
Sbjct:  311 IGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPG---PRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQG------------------PIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 588          

HSP 8 Score: 63.1586 bits (152), Expect = 1.629e-9
Identity = 56/131 (42.75%), Postives = 69/131 (52.67%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVP---GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDI-------------GKPGQKGKPGNTGPKGLT 2911
            DG  GN+GP G  G  G  G  G QG P   G+ G  G  G  G++GVPGIPG+ G+ G PG +G  G  G+ G+ G PG  GP G  G  G  G +G +             GKPG  GKPG +GPKG+ 
Sbjct:  566 DGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVA 696          

HSP 9 Score: 63.1586 bits (152), Expect = 1.864e-9
Identity = 126/321 (39.25%), Postives = 155/321 (48.29%), Query Frame = 2
Query:  761 ELGAAGPIGLPGIRGD------LGSQGPIGSHGPEG---EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG---------VDGAPGIDGKDGSVGDPGAPGEH---GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGK---------------PGSRGPRGSQGLAGLPGKDGV------------VGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            ++G  GP G PG+RG+      LGSQG  G+ GP+G    PG  GR G  G+ G  G++G+PG  G  G  G  GI GK G  G         + G PG DGK G  G PG PG++   G  G  G +G  G +G  G+ GN G  G+ GL G IG  G  G  G  G NG SG  G+ G  G  G  G  G+ G  G  G  G  G  G  G QGP G  G  G  G +G  G+PG DG NGK                G RGP+G  G+ G PG  G+            +G  G+ G+PG   PPGP+G  G +GL G
Sbjct:  319 DIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPG 639          

HSP 10 Score: 62.3882 bits (150), Expect = 2.727e-9
Identity = 63/123 (51.22%), Postives = 72/123 (58.54%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            DDG  G +GP G  G PG  G PG   + G  GRDG RG+ G  G PG+PG+ GM G  G DG+ G  G+RGD G  GP GP GP G+ G  G  G  GK G +G PG  GP G  GNQG TG
Sbjct:  782 DDGKVGPIGPRGSIGLPGPSGVPG---IRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTG 901          

HSP 11 Score: 62.3882 bits (150), Expect = 2.797e-9
Identity = 85/184 (46.20%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATG 1138
            GR+G  GA GPQG  G PG  G+ G  G  GP G  G  G  G  G  G  GP GP G +G  GP G+PGIRG  G  GP G  G  G+PG+ G IG PGA G  G +G PG+ G  GT G  G  G  G  G  G PG  GK G     G PG+ G  G  G++G  GG GP+G  G+ G  G
Sbjct:  736 GRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPR---GPPGKMGPVGPVGNQGPTGGAGPEGSPGHLGVQG 916          

HSP 12 Score: 60.8474 bits (146), Expect = 9.602e-9
Identity = 50/107 (46.73%), Postives = 62/107 (57.94%), Query Frame = 2
Query: 2603 PGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            PG+PG DG PG  G PG  G++ + G QG LG  G PG++G +G PG  G PG +G++G  G PG  G  G  GS G  G  G+ G  G  GKPG  G  G +G QG
Sbjct:  413 PGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQG 519          

HSP 13 Score: 59.3066 bits (142), Expect = 2.737e-8
Identity = 91/223 (40.81%), Postives = 113/223 (50.67%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPG---ADGITGVSGMPGVIGP---TGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPG-------APGEHGSNGIPGSKGSQGGTGPQGII---GNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G +G NGA GPQGP G+ G +G+ G QG  G  G  G +G  G  G PG  G  G     GA G IG  G  G  G QG  G  GP G  G+ G IG  G     G+ G+ G PG++GP    G KGD+G+ G  G  GV G  G+ GK G  G  G       + G+ G  G PG  G  G +GP+G+    G  G  G  G  G IG  G+KG+ GP G++
Sbjct:  507 GIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGID 729          

HSP 14 Score: 57.3806 bits (137), Expect = 1.040e-7
Identity = 88/243 (36.21%), Postives = 114/243 (46.91%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMG---------------SQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIG------------------LPGIRGDLGSQGPIGSHGPEG---EPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            +G  G  G  GP GP+G PGL G               ++GPQG+ G  GP G  G KG  G  G  G  G  G+ G AG +G                  LPG  G  G  GP G  G  G   +PG  G +G  G  G +G  G+PG +GP G  G +G  G  G  G  G PG +G  G+ G+ G+ G +G  GI G  G+ G  GP+G  G+ G TG  G  G +G  G++G +G  G+
Sbjct:  311 IGELGSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGI 553          

HSP 15 Score: 57.3806 bits (137), Expect = 1.058e-7
Identity = 65/189 (34.39%), Postives = 84/189 (44.44%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGL------------DGFPGNQG------VPGVSGRDGERGDQGKLGVPGIPGETGMNGT---------------------------PGRDGRPGVAGMRGDTG---QPGPRGPAG---PEGSTGAPGLMGDIGKPGQ---------------KGKPGNTGPKGLTGNQGITGPM 2938
            G  G++GP G  G+PGL             GFPG +G       PG  GR G +G QG +G+ G+PG  G +G                            PG+DG+PG AG  G  G   QPGP+GP G   P G +G  G+ G++G PGQ               +G PG+ GP G  GN+G  GP 
Sbjct:  315 GSKGDIGPMGPSGSPGLRGNPGVIGSLGSQGFPGARGPQGILGSPGPRGRTGSKGSQGTIGIAGVPGTPGKDGKAGQVGIPGKNGPPGRPGPVGPIGLPGHPGKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPY 503          

HSP 16 Score: 56.9954 bits (136), Expect = 1.160e-7
Identity = 54/129 (41.86%), Postives = 67/129 (51.94%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRG------------PAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN 2917
            +G+DG++GP G+ G PG  G    QG+ G+ G  G  G  G++G PG  G  G +G PG DG+ G  G RG  G PGP G            P G  G  G PGL GDIG PG  G  G  G  G+ G+
Sbjct:  726 NGIDGSIGPPGRNGAPGAVG---PQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGD 851          

HSP 17 Score: 53.9138 bits (128), Expect = 1.097e-6
Identity = 54/135 (40.00%), Postives = 67/135 (49.63%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGV---SGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLM---------GDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            D G  G  GP G+ GN G+ G  G  G+PG    +G+D   G +G +G  G  G  G  G  G  G PG  G++GD G  GP G  G  G  G PG++         GD G PG  G PG  GP+GL G +G  G
Sbjct:  526 DLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAG 660          

HSP 18 Score: 53.9138 bits (128), Expect = 1.116e-6
Identity = 56/138 (40.58%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRD------GRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK---------PGQKGKPGNTGPKGLTGNQGITGPM 2938
            G  G +G  G PG  G DG PGN G PG SG  G  G  G  G  G+PG  G +GT G        G+PG+AG  G +G  GPRG  G  G+TG  G +G++G          PG  GK G  G   + G +G  GP+
Sbjct:  438 GPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPI 575          

HSP 19 Score: 53.5286 bits (127), Expect = 1.288e-6
Identity = 55/147 (37.41%), Postives = 72/147 (48.98%), Query Frame = 2
Query: 2579 GNVGPEGKPGNPGLDGFPGNQG---------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPG------------------LMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            G VG  G PG  G+ G PGNQG         +PG+ G +GE+G QG LG   I G  G +G PG DG+ G  G  GD G+ G  GP+G +G  G  G                  ++G++G  G  G  G +G  GL GN G+ G +
Sbjct:  198 GPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLG---IKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGPSGVKGDPGKTGNPGRSGRRGPRGPRGNRGIIGELGSKGDIGPMGPSGSPGLRGNPGVIGSL 341          

HSP 20 Score: 53.5286 bits (127), Expect = 1.538e-6
Identity = 87/225 (38.67%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQ-GPIGSHGPEGEPGVGGRIGFP------------------GADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            +G  G  G+ GP G  G PG+ G  G  G  GP+G  G++G  G+ G PG  GP+G  G+ G AG +G     G  G Q GP G  GP G+PG  G  G                    G+ G+ G  G  G+ G  G  G  G  G  G +G+ G PG  G  GSVG+ G PG+ G NG  G  G  G  GP   IG  G+ G PG  G+ GI+G +G  GP+G
Sbjct:  596 IGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPGNPGTPGVIGPQGLRGKRGKAGGLGKVSFTGRSGGQSGPRGKPGPSGKPGTSGPKGVAGPPGPMGEPGPTGPTGPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGP---IGPRGSIGLPGPSGVPGIRGQQGRDGPRG 817          

HSP 21 Score: 52.7582 bits (125), Expect = 2.307e-6
Identity = 55/135 (40.74%), Postives = 68/135 (50.37%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGK---------PGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGN---QGITG 2932
            DDG+ GNVGP G+         PGN G  G PG+ G  G  G  G +G  GK G+ G  G +G  G  G +G  G  G +G  G+ G  G  G  G+ G PG  G+ GK    G  GN GP G +G    QG+TG
Sbjct:  454 DDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTG 588          

HSP 22 Score: 52.373 bits (124), Expect = 3.154e-6
Identity = 56/128 (43.75%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGN---QGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK---PGQKGKPGNTGPKGLTGNQGITGP 2935
            G+ G+ G  G+ G  G+ G  GN   QG  G  GR G  G  G +G  G PG  G++G PG  G PG   M+G  G PG RGP G +GS G  G+ G IG+   PG  GK G  G  G  G  GI GP
Sbjct:  156 GVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPG---MQGPPGLPGLRGPEGEKGSQGGLGIKGSIGQDGYPGSDGKRGAPGEHGDPGKAGIDGP 280          

HSP 23 Score: 51.9878 bits (123), Expect = 3.895e-6
Identity = 45/100 (45.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query: 2651 GVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQP------GPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G++G+ G QG  G PGI G TG  G PG  G  GV G +G  G+       GPRG  GP+G TGAPG  G +G PG  G  G+ G +G++G  G  G
Sbjct:  120 GKPGKNGDPGPQGPTGEPGINGPTGPTGVPGMKGPLGVKGDKGQRGRMGKDGILGPRGNLGPQGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQG 219          

HSP 24 Score: 51.9878 bits (123), Expect = 4.202e-6
Identity = 52/121 (42.98%), Postives = 62/121 (51.24%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G DG  GP G PG PG +  PG QG  G  G  G+ GD G  G  G PG++G+ G  G  G  G  G+ G  G  G +G  G +G  G PG+ GD G  G +G  G  G  G TG QG  G
Sbjct:  417 GKDGKPGPAGFPGTPGKNMQPGPQGPLGERGPPGKSGDDGVPGNVGPPGQSGLQGPIGPPGNSGQRGLPGSNGPSGTKGNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVG 537          

HSP 25 Score: 51.6026 bits (122), Expect = 5.695e-6
Identity = 82/208 (39.42%), Postives = 93/208 (44.71%), Query Frame = 2
Query:  623 GPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRG---------DLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKD---------------GSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQG 1174
            GP G  GL G +GP G++G  GP G  G  G  GP G  G  G  G  G+ G IG PG  G         D G  GPIG  G  G PG  G  G  G  G  G  G  G+ G  G  GD G+ G  G +G  G PGI G                 G  G+PG PG+ G  G PG  G  G  G QG  G AG  G P   G +G+QG
Sbjct:  712 GPIGSIGLKGERGPNGIDGSIGPPGRNGAPGAVGPQGLIGLPGTPGTTGSVGEIGPPGQIGPNGNSGKPGDDGKVGPIGPRGSIGLPGPSGVPGIRGQQGRDGPRGEIGLNGDPGLPGDIGMPGASGSDGKAGEPGIRGDPGTSGPMGPPGPAGTVGPQGNPGFPGKKGPRGPPGKMGPVGPVGNQGPTGGAGPEGSP---GHLGVQG 916          

HSP 26 Score: 50.8322 bits (120), Expect = 9.944e-6
Identity = 58/145 (40.00%), Postives = 73/145 (50.34%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLG------------VPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGK---------PGQKGKPGNT---GPKGLTGNQGITG 2932
            G  G+ GP GKPG  G +G  G QG  G +G  G  G+QG +G             PGIPG+ G NG    DG  G  G  G +G+ GP+G  G +G  G+ GL GDIG          PG  GKPG     GP+G  G++G+ G
Sbjct:  495 GNKGSKGPYGKPGIAGDNGASGPQGPRGENGDLGNTGEQGPVGEVGNAGIRGVNGAPGIPGKDGENGKDAVDGAKGNIGPIGSSGRRGPQGMTGIQGPPGSIGLKGDIGSTGPMGRIGVPGIPGKPGIVGPPGPEGFKGDKGLPG 639          
BLAST of Fibrillar collagen vs. Planmine SMEST
Match: SMESG000045473.1 (SMESG000045473.1)

HSP 1 Score: 198.749 bits (504), Expect = 3.745e-51
Identity = 86/223 (38.57%), Postives = 136/223 (60.99%), Query Frame = 2
Query: 3527 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVV-EKTEYPAIIFT----DNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDLTLGSDSDIS-EFRLKLSKVCFS 4177
             +SDD + A+  G++ I  P GTK++PARSC HL   +  L DG Y+IDPNGG+++DA  V+C++ T +TCI P    +   S+ +     ++ +  ++GI  F+Y I+N QL +LK +S  A Q+I + C N A++ ++    + ++T    D++  L+       +KVIKDECQ     EAET+L V G + RLPI+D+ L  DSD S +  ++L +VC+S
Sbjct: 1035 TFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS 1257          

HSP 2 Score: 80.8777 bits (198), Expect = 7.348e-15
Identity = 179/467 (38.33%), Postives = 221/467 (47.32%), Query Frame = 2
Query:  218 LLEMDIKTFLFIFFI-LSAAQAEPLSRLKRQXXXXXXXXXXXXXXXXXXXXXXXXXXXSVKGPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSR---GPRGSQGLAGLPGKDGVVGP------FGLSGQPGANKPPGPQGKMGPRGLTG 1579
            +      + LF+  + ++A   E L+RLKRQA       G+     +         P       P+             GP G +G  G  G  G +                     G  G+ G  G +G  GP GP G+PGL GS GP+G  GP+G  G     GD G  G  G KG  GE G  GP GL G  G +G    QGP G  G +G  GV G +G  GA G  G SG+PG IG  G +G+ GI+G K   G  G PG+ GK G  G  G PG  G +G PG +G  G  GPQG +G  G  G+ G  G  G+ G KG  G +G  G  G  GS GP G  G  G PG  GD G  G  G  G  G KGS+G +GP G  G+PG DG   +PG +G +G PGS+   G RGS G  G PG +G  GP      FG +G PGA    GP+G MG  G+ G
Sbjct:    1 MWNSIFFSLLFVLCVSINARAEEKLNRLKRQATSPNQAKGSQGSRGDPGPMGKPGPPGDPGALGPI-------------GPPGRDGARGKSGKPGAS---------------------GIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRG---LTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAK---GDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDG---IPGKNGLHGNPGSQGEVGSRGSPGAMGKPGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRG 424          

HSP 3 Score: 80.1073 bits (196), Expect = 1.057e-14
Identity = 98/222 (44.14%), Postives = 115/222 (51.80%), Query Frame = 2
Query:  581 RMGRSGRNGAGGPQGPTGKPGLMGSQGPQG---MNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGS------------NGIPGSKGSQGGTGPQGIIGNAGATGRPG---LDGMIGIQGVKGDSG 1192
            R G  G  G  GPQGP GK G  G +GP G   ++GPKG  GE+GP G  G  G  GPKG  G+ G  G  G  G RG+ G  GP G+ G  GE G  G  G PG DGI G +G+ G  G  G  G RG  G  G  G++GAPG  G++G  G  G PG  G+             G+PG+ G+ G  GP GI G  G  G PG     G  GI GV GDSG
Sbjct:  248 RPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKNGLHGNPGSQGEVGSRGSPGAMGKPGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSG 469          

HSP 4 Score: 74.3294 bits (181), Expect = 5.931e-13
Identity = 120/289 (41.52%), Postives = 147/289 (50.87%), Query Frame = 2
Query:  392 VKGPAPLTGNRYVAGPAGLQGPDGPEGR------PGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG---PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIGFPGADGITGVSG---MPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGS---QGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            ++GP  L G     GPAG+QGP G  G+      PG  GP G  GP G+ G  G+ G              G  G +G  G +G +G PGL G  GP G  GP G    +G  G +G+AG  G +GP G +G+ G  GP G PG+ G  GSQG   PIG  G +G  G  G+ G PG  G TG  G     GV+GP G KG RG  G  G  G  G  GI GK+G  G+PG+ GE GS G PG+ G     G  GP+G  G  G  G PG  G +G +G  G  G +GL
Sbjct:  149 LQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIG------------NKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKNGLHGNPGSQGEVGSRGSPGAMGKPGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGL 425          

HSP 5 Score: 73.559 bits (179), Expect = 1.109e-12
Identity = 156/376 (41.49%), Postives = 185/376 (49.20%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGS---QGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG---------------------VDGAPGIDGKDG---------SVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG---LNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGP------RGSQGLAGLPGKD---GVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  G +G  GP GP G+PGL GS GP+G  GP+G  G     GD G  G  G KG  GE G  GP GL G  G +G    QGP G  G +G  GV G +G  GA G  G SG+PG IG  G +G+ GI+G KG  G                     VDG PG+ G+ G          VG  G  G  G+ G+ G KGSQG  GP GI G  G+ G  G  G  G  G  GD GP+G   + G +G  GS G  G  G  GNPG  G PG+ G  G  G  G  GS+G  G  G  G  GA G  G  G+ G NG PG++G        GS G+ GLPG     GV+GP G+ G  G    PG +G  G  G+TG
Sbjct:   91 GTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRG---LTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKNGLHGNPGSQGEVGSRGSPGAMGKPGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITG 463          

HSP 6 Score: 68.1662 bits (165), Expect = 4.581e-11
Identity = 58/129 (44.96%), Postives = 73/129 (56.59%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGT------PGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            DG+ G++GP+G  G PG  G PG  G  G+ G  G +G +G  G PG+ G+TG +G+      PG DGRPGV   RG+ G  GP+GP G  G  G  G  G+ G  G KG  G  GP G+ G QG  GP
Sbjct:  180 DGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGV---RGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGP 305          

HSP 7 Score: 66.6254 bits (161), Expect = 1.422e-10
Identity = 55/125 (44.00%), Postives = 69/125 (55.20%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            + G  G  GP+G PGNPG DG PG  G+ G  G  GE G +G    PG  G+ G+NG PG  G  GV G     G PG +G  GP+G+ G+PG+         +G PGNTG  G+ G  GI GP+
Sbjct:  335 NKGSRGESGPDGSPGNPGTDGIPGKNGLHGNPGSQGEVGSRGS---PGAMGKPGLNGAPGPRGENGVFGT---NGHPGAKGAVGPKGNMGSPGV---------RGLPGNTGTMGVMGPGGIRGPL 444          

HSP 8 Score: 66.2402 bits (160), Expect = 1.742e-10
Identity = 102/275 (37.09%), Postives = 122/275 (44.36%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEG---VDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTGK 1582
            G  G  G+PG  G  GS G +G  GP GEPG+ G IG  G  G  G  G+      TG KGD G+ G KG  G   + G  G+ G  G VG  G  G  G  G  G+ G  G  GPQG IG  G +G PG    IG +G++G+SG +G  G SG               NPG                              + G  G  G  G PG  G +G+PG RG  G  G  G  GK G  G  G SG PG + P G QG+ GP G+ GK
Sbjct:   79 GKPGASGIPGKDGTPGSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGL------TGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPG---EIGNKGIRGESGIKGAKGDSG---------------NPG------------------------------LAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGK 299          

HSP 9 Score: 61.2326 bits (147), Expect = 7.307e-9
Identity = 102/309 (33.01%), Postives = 129/309 (41.75%), Query Frame = 2
Query:  434 GPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGA---------------------AGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRI---------------GFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGA---------------PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G  G +GP GP G  G +GP GL                            G+ G  GA GP+G +GK G  G  GP G  G +GP G++G  G  G  G  G  G  G  GA                      GPIG PG  G+ G  G  G  G EG  G  G +               G PG  G  G  G  G +GP G +G RG  G  G +G+ G+PG++G+ G +G  GA                G  G+ G  G +G +G TGP G+ G  G +G PG DG  G  G+ G+ GPQG+ 
Sbjct:  715 GQVGPEGPRGPSGETGEQGPQGLP---------------------------GKPGDPGAEGPRGSSGKQGFQGPTGPIGPTGKQGPAGQRGSIGARGKDGQTGENGRAGSAGADGFPGFPGPNGPPGPTGPDGKMGPIGPPGEIGEHGEMGDPGPTGKEGLVGPQGNVGPPGPIGSPGNPGIAGPPGPQGKRGNRGNTGFVGPAGPRGKRGPVGPGGEKGIPGSPGLEGQRGQIGVSGARGNNGNNGKPGRTGRAGPAGTMGQKGVRGVKGFTGPNGLKGPQGPSGYPGEDGSPGPMGLIGERGPQGIT 996          

HSP 10 Score: 60.077 bits (144), Expect = 1.287e-8
Identity = 49/106 (46.23%), Postives = 59/106 (55.66%), Query Frame = 2
Query: 2606 GNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQG 2923
            G+PG DG PG  G PG+ G  G+ G +G  G  G  GE G  G PG+ G PG  G RG +G+ G +GP GP G TG  G  G  G  G +GK G TG  G  G+ G
Sbjct:  694 GDPGKDGKPGEPGTPGIDGPPGQVGPEGPRGPSGETGEQGPQGLPGKPGDPGAEGPRGSSGKQGFQGPTGPIGPTGKQGPAGQRGSIGARGKDGQTGENGRAGSAG 799          

HSP 11 Score: 58.9214 bits (141), Expect = 3.153e-8
Identity = 57/133 (42.86%), Postives = 67/133 (50.38%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPG------------VAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GL G+ G  G  G  GL G  G  G  G+ G  GERG QG  GVPG  G  G  G PG+ G PG            + G +GD+G PG  G  GP GS G PG  G  G+PG +G+ G  GP+G  G  G  G
Sbjct:  139 GLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRG 271          

HSP 12 Score: 56.9954 bits (136), Expect = 1.304e-7
Identity = 55/124 (44.35%), Postives = 64/124 (51.61%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMG---DIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G VGP G  G PGL G  G +G  G  G  G  GD+G +G+ G+ G  G  G  G  G  G AG  G  G  GP G  G +G+ G PG +G    IG PGQ G PG  G KG+ G  GI G
Sbjct:   94 GSHGVVGPIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKG 217          

HSP 13 Score: 55.8398 bits (133), Expect = 2.674e-7
Identity = 55/134 (41.04%), Postives = 71/134 (52.99%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQG------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGP------RGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G  G +G  GNPGL G  G  G       PGV GR G RG+ G +G  G  G+ G  G  G  G PG++G +G  G+ GP      +G AGP+G  G PG  G+ G  G +G+ G  GP G  G++G +GP
Sbjct:  211 GESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGP 344          

HSP 14 Score: 55.0694 bits (131), Expect = 4.955e-7
Identity = 51/121 (42.15%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  GP G PG  G  G  G +G  G+ G+ G  G +G+ G PG PGETG  G  G  G  G AG +G  G+ GP G  G  G+ G PG  G  G PG +G+ G+ G  G  G  G+ G
Sbjct:  268 GQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKNGLHGNPGSQGEVGSRGSPGAMGKPGLNG 388          

HSP 15 Score: 54.6842 bits (130), Expect = 7.247e-7
Identity = 46/94 (48.94%), Postives = 54/94 (57.45%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMG 2851
            G  G VGP+G  G+PG+ G PGN G  GV G  G RG  G +G P      G  G+ GR G  GVAG  GD G+ GP G  G EG +G+PG MG
Sbjct:  406 GAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSP------GDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMG 493          

HSP 16 Score: 54.299 bits (129), Expect = 8.226e-7
Identity = 53/121 (43.80%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G VGP+G  G  G  G  G  G PG+SG  G +G++G +G+ G  G  G  G  G  GRPG  G  G  G+ G  GPAG +GS G  G  G  G PG  G PG  G  G  G+QG  G
Sbjct:  253 GEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKNGLHGNPGSQGEVG 373          

HSP 17 Score: 52.7582 bits (125), Expect = 2.286e-6
Identity = 53/137 (38.69%), Postives = 70/137 (51.09%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIP------GETGMNGTPGRDGRPGVAGMRGDTGQP---GPRGPAGPEGSTGAPGLMGDIGKPGQK---GKPGNTGPKGLTGNQGITGPM 2938
              G+ G +G +G  G  G+ G  G+ G PG++G+ G  G  G  G PG+       GE G+ G  G  G+ G  G RG +G P   GP+G  G EG  G  G  G  G  GQK   G+PG TG +G  G +G+ GP 
Sbjct:  197 QSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPA 333          

HSP 18 Score: 52.373 bits (124), Expect = 3.206e-6
Identity = 94/265 (35.47%), Postives = 111/265 (41.89%), Query Frame = 2
Query:  413 TGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQG------------------MNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLD 1153
            TG   V GP G++GP GP G PG KG  G TG  G  G  G                +G  G  G  G +GP+G PG MG  G  G                    G  G NG+ G  G  G PG  G  GP G  G+ GP+G  G+ G +G +GP G  G  G PG  G  G PG  G  G SG PG +GP G  G RG                  + G +G  G PGE G  G+P  +    G    G+ G  G  G PG D
Sbjct:  429 TGTMGVMGPGGIRGPLGPVGSPGDKGSKGRTGITGVAGDSGD---------------LGEQGPPGEDGSEGPSGSPGPMGFPGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAPGKLGPVGITGSRG------------------RPGPIGSSGEPGEKGPQGLPEVEKPLAGRSVGGVSGPRGERGSPGDD 660          

HSP 19 Score: 51.2174 bits (121), Expect = 7.717e-6
Identity = 93/212 (43.87%), Postives = 108/212 (50.94%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGD------RGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            MG+ G NGA GP+G  G  G  G  G +G  GPKG  G  G +G  G  G  G  GP G  G  GP+G PG   D GS+G  G  G  G+ G  G  G PG DG  G SG PG +G  G  G        G  G  G  G +G PG +GKDG  G  G PG  G  G PG KGS G  G  G++G  G  G  GLDG++G  G  G +GP G
Sbjct:  381 MGKPGLNGAPGPRGENGVFGTNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSPG---DKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGFPGIAGKIGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKGSIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPG 589          
BLAST of Fibrillar collagen vs. Planmine SMEST
Match: SMESG000038928.1 (SMESG000038928.1)

HSP 1 Score: 194.512 bits (493), Expect = 8.339e-50
Identity = 90/226 (39.82%), Postives = 131/226 (57.96%), Query Frame = 2
Query: 3527 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISP-------KQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAVVEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRDL---TLGSDSDISEFRLKLSKVCF 4174
            + +DD   A  LG+D IS PLGT + PARSC HL   +    DG Y+IDPNGGK++DA +V+CK++  +TCI P       ++  F+  S S +  NK+IS           Y +D  Q+ FLKM+S +A+Q I I C NM V++ +  P  IFTDN+  L   D   SYKV++D CQ+ S + + T L ++    RLPI+D+   T+   S+ S+    + +VCF
Sbjct: 1079 IQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQKPKFNWFSQSND--NKFIS-----------YSLDQQQMTFLKMISNKASQFITINCRNMPVIKNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCF 1291          

HSP 2 Score: 73.9442 bits (180), Expect = 8.904e-13
Identity = 90/209 (43.06%), Postives = 112/209 (53.59%), Query Frame = 2
Query:  584 MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPG---ADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQG 1201
            +G  G  G  GP GPTG  G+ G+QGP G +G KGP GE+GP G  G              G  G +GLPG  G  G+ GP G  GP+G  G+ G  G PG     G  GV G PG++GPTG KG  G QG  G  G  G+PG++G  G +G PG  G  G +G  G KG     GP G++G  G +G PGL G +G  G +G  G +G
Sbjct:  106 IGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNS------------GDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGE---NGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEG 299          

HSP 3 Score: 73.9442 bits (180), Expect = 9.289e-13
Identity = 150/364 (41.21%), Postives = 179/364 (49.18%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGL---PGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT---KGDRGIQGKKGGEGV---------------DGAPGIDGKDGSVGDPGA------PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQ---GVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRG---PRGSQGLAGLPGKDGVVGPFGLSGQPGANKPPGPQGKMGPRGLTG 1579
            G  G  G  G  GP G+PG+MGS+G  G  G KG NG                      LG  GP GL   PG++G LG  GP GS G EG+ G  G  G PG+ G+ G  G  G  GP G    +G RG++G  G +GV               DG PGI G  G  GDPG+      PG  G +G  G +G +G  GP G  G+ GA G  G  G +G Q   G+ G+ G  G  G +G +G  GP G  GP GNPGN G+ G  G PG  G  G++G  G  G PG  GS G  G +GL G  G  G+PG  G   P G  G  GL GKDG  G  G  G PGA+ P GP+GK GP G  G
Sbjct:  230 GDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGP---------------------LGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPG 572          

HSP 4 Score: 66.6254 bits (161), Expect = 1.508e-10
Identity = 56/125 (44.80%), Postives = 75/125 (60.00%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQGVPGV---SGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            G  G +G  G PG+PG++G PG  G PG+    G+DG  G +G+ G  G+ G  G++G PG  G  G  G +G  G  G  GP GP GS G+PGL+G+IG+ G+ G  GN GP+G  G +G  GP
Sbjct:  221 GKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGP 345          

HSP 5 Score: 62.7734 bits (151), Expect = 1.952e-9
Identity = 54/116 (46.55%), Postives = 67/116 (57.76%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDT---GQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKG 2905
            +GL GN+GP G+PG  G  G  G  G  G+SG+DGE GD G +G PG  G  G  G  G  G PG+ G +G+T   G PG RG +G  G  G+PG +G  GK G+ G P   GP G
Sbjct:  508 EGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPVGVRGKVGKPGPPSKDGPPG 623          

HSP 6 Score: 61.6178 bits (148), Expect = 4.821e-9
Identity = 117/292 (40.07%), Postives = 143/292 (48.97%), Query Frame = 2
Query:  398 GPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKG------------------------PNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGI---IGNAGATGRPGLDGMIGIQGVKGDSG 1192
            GP  + G   V G  G  GP GP+G  GP GP G+ G QG  G  G  GP+G  GP GP G  G  G  G  GP G  G PG  G QGPQG  G +G                        P G +G  G  G  G  G  G  G  GA GPIG PGI G  G  GPIG  G  G       +G  G  G++G  G+ G +GP G +G +G +GK G  G  G+PG  G  G +G+ G  G  G+ G  G +G +G  GP+G+   +G  G  G PG+DGM GI+G+KG  G
Sbjct:   92 GPTGINGKPGVDGSIGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNSGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGP------LGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDG 377          

HSP 7 Score: 58.9214 bits (141), Expect = 3.694e-8
Identity = 59/139 (42.45%), Postives = 70/139 (50.36%), Query Frame = 2
Query: 2564 DDGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGE---------------TGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGP 2935
            + G DG  G  G  G  GL G PG++G PG SGR G +G +G  GV G+PG+                G  G  G  G+ GV G  GD G PG  G  GP    G PG+MG  GK G  G  G  GP GL G QG++GP
Sbjct:  144 EKGPDGPQGNSGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGP---IGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGP 279          

HSP 8 Score: 57.7658 bits (138), Expect = 7.020e-8
Identity = 56/133 (42.11%), Postives = 69/133 (51.88%), Query Frame = 2
Query:  767 GAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGR---IGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDG 1156
            G  G  G  G  G LG +G +G+ GP G+PG  G     G PG +G++G  G  G  GP G  G  G QG KG +G  G PG+ G+ G  G  G PG  G +G+PG  GS    GP G+ G  G  G P  DG
Sbjct:  491 GVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGS---PGPVGVRGKVGKPGPPSKDG 620          

HSP 9 Score: 56.225 bits (134), Expect = 2.493e-7
Identity = 107/309 (34.63%), Postives = 131/309 (42.39%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGP------KGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGI---TGVSGMPGVIGPTGTKGDRGIQGKKGGEG------------VDGAPGIDGKDGSVGDPGAPGEHGSN------------------GIPGSKGSQGGTGPQGIIGNAGAT------------GRPGLDGMIGIQGVKGDSGPQG 1201
            + GP GL GP G +G  GP GP G                             G  G+ G  GP G  G PGL+G  G +G NGP      +GP G +G  G  G  G  GP G  G  G  G  G+ G++G  G  G +G+ GP G  GV GR G  G  G     G  G PG IG  G +G  G QG+ G  G              G PG  G+ G  G+PG  GE G N                  G PG +GS+G  GP+G++GN G              G+PG +G+ G  G  GDSGP G
Sbjct:  270 LLGPQGLSGPPGLQGSLGPPGPQG---------------------------SKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVG 551          

HSP 10 Score: 55.4546 bits (132), Expect = 3.322e-7
Identity = 57/139 (41.01%), Postives = 69/139 (49.64%), Query Frame = 2
Query: 2570 GLDGNVGPEGKPGNPGLDGFPGNQG------------VPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGD------TGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            G  G  GP+G  G  G+DG PG  G            + G +G  G  G QG LG  G PG  G+NG PG  G+PG+ G RG        G+ GP G  GP+G +G PGL G +G PG +G  GN G  G  G  G  G
Sbjct:  173 GPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPG 311          

HSP 11 Score: 55.4546 bits (132), Expect = 3.554e-7
Identity = 114/302 (37.75%), Postives = 141/302 (46.69%), Query Frame = 2
Query:  398 GPAPLTGNRYVAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXR------MGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELG------------------------AAGPIGLPG---IRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGL 1204
            GPA   G+  + G  G +G +GP G PGP+GP GL G  G  G  G  GP G  G  G +G        G+ G  G+ G  GP G+ G+ G  GP+G  G  GPNG+ G  G  G  G +G  G  GE G                          GP G PG    +GD G  GP+G  G  G+PGV G+ G  G++G  G  G+ G +GP G  G  G  G  G  G +G  G DG+DG  G  GAPG  G  G  G  G  G  G  G  G  G  G PG  G+ G+ G+ G  GP G+
Sbjct:  305 GPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPVGV 606          

HSP 12 Score: 54.299 bits (129), Expect = 7.997e-7
Identity = 56/139 (40.29%), Postives = 72/139 (51.80%), Query Frame = 2
Query: 2588 GPEGKPGNPGLDG---------FPGNQGVPGVSGRDGERGDQGKLGVPGI------PGETGMNGTPGRDGRPGVAGMRGDTGQ---------PGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITG 2932
            GP G PGN G  G           G++G PGV G+ G++G +GKLG  G+       G+ G  GTPG DG+PG  G+ G  G+         PG  GP GP+G  G PG  G IG+ G+      TG  GL G +GI+G
Sbjct:  461 GPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGE------TGINGLPGRRGISG 593          

HSP 13 Score: 53.5286 bits (127), Expect = 1.408e-6
Identity = 57/145 (39.31%), Postives = 67/145 (46.21%), Query Frame = 2
Query: 2567 DGLDGNVGPEGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTG---------------------QPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
            DG  G  GP G PGN G DG  G++G  G  G DG +G+ G +GV G+PG  G  G PG  GR G  G RG  G                       GP G  G  G  G  G  GD G PG  G PG  G  G+ G++G  GP+
Sbjct:  115 DGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNSGDIGVLGLPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPI 259          

HSP 14 Score: 53.1434 bits (126), Expect = 1.682e-6
Identity = 108/297 (36.36%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  428 VAGPAGLQGPDGPEGRPGPKGPNGLTXXXXXXXXXXXXXXXXXXXXXXXXXRMGRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGPEGEPGVGGRIGFPGADGITGVSGMPGVIGPTGT------------------------KGDRGIQGKKGGEGV---------------DGAPGIDGKDGSVGDPGA------PGEHGSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKG 1183
            + GP G +G  GP GR GP+GP GL G  G PG+ G  GP G  GP G    MG +G  G  G QG  G  G  GS G  G  GP G  G  G                    G  GPIG+ G  G LG  GP G  GP   PG+ G +G PG  G  G  G  G +GP G+                        +G RG++G  G +GV               DG PGI G  G  GDPG+      PG  G +G  G +G +G  GP G  G+ GA G  G  G +G QG  G
Sbjct:  162 LPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPG---MMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMG------------------SRGKDGPIGIKGENGPLGLLGPQGLSGP---PGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETG 434          

HSP 15 Score: 51.9878 bits (123), Expect = 4.480e-6
Identity = 128/395 (32.41%), Postives = 164/395 (41.52%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQG---PIGSHGPEGEPGVGGRIG---------------------FPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGS------VGDPGAPGEHGSNGIPGS------------------KGSQGGTGPQGIIGNAG------------ATGRPGLDGMIGIQGVKGDSGPQGLNXXXXXXXXXXXXXXXXXXXNPGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADGRDGLPGIDGANGKPGSRGPRGSQGLAGLPGKDGVVGPFGLSGQP---GANKPPGPQGKMGPRGLTGK 1582
            G +G  G  GPQG +G PGL GS GP G  G KG  G+                  IG +G AG  G PG+ G++G +G   P G+ GP+G  G+ G  G                      PG  G+ G  G PG +G  G  G +G+ G+ G  G  G PG +G+DGS      +G  G  G  G  G+PG+                  +G +G TG  G +G  G            + G+PG+ G  G QG +G  GP+GL G  G  G  G  G+ GP G PG  G  G                               DG DG  G  GA G  G +GP+G  G  G PG  G  G  G++G P   G +  PG  G  GP G+ GK
Sbjct:  263 GENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGK------------------IGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGVSGPVGPPGMPGNPGIDGMPGIRGLKGKDGDPGSLGAMGPPGRQGVSGRDGPRGERGYPGPNGQDGSPGAIGEIGQRGKLGSQGETGLPGNVGDPGQPGPAGPMGPPGPRGQRGPTGNPGNLGEKGDNGPPGPLGPQGSRGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSG------------------------------KDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPVGVRGK 609          

HSP 16 Score: 51.6026 bits (122), Expect = 5.042e-6
Identity = 45/109 (41.28%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 2594 EGKPGNPGLDGFPGNQGVPGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQ 2920
            EG  G+PG DG     G  G  G+ G RGD+G  G  G  G+ G+ G PG +G PG +         GPRGP+G +G  G PG  G+ G  G +G  GN G +G+ G Q
Sbjct:  947 EGPLGHPGDDGLNAKDGEEGAPGKQGPRGDKGFTGEIGPDGKQGVKGKPGPNGIPGYS---------GPRGPSGSKGPIGNPGPTGEQGFQGDRGPNGNVGAQGIDGAQ 1046          

HSP 17 Score: 51.6026 bits (122), Expect = 5.349e-6
Identity = 50/118 (42.37%), Postives = 61/118 (51.69%), Query Frame = 2
Query: 2603 PGNPGLDGFPGNQGV------PGVSGRDGERGDQGKLGVPGIPGETGMNGTPGRDGRPGVAGMRGDTGQPGPRGPAGPEGSTGAPGLMGDIGKPGQKGKPGNTGPKGLTGNQGITGPM 2938
             G PG+ G PG QG        G+ G  G  G  GK G PG  G+ G NG  G+DG  G +G  G  G  GP+GP G +G  G PGL+G  G+ G  G PG  G  G+ G  G  GP+
Sbjct:  487 RGKPGVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNGLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPV 604          

HSP 18 Score: 50.8322 bits (120), Expect = 9.184e-6
Identity = 90/259 (34.75%), Postives = 110/259 (42.47%), Query Frame = 2
Query:  587 GRSGRNGAGGPQGPTGKPGLMGSQGPQGMNGPKGPNGEQXXXXXXXXXXXXXXXXXXXELGAAGPIGLPGIRGDLGSQGPIGSHGP-------------------------------------EGEPGVGGRIGFPGADGITGVSGMPGVIGPTGTKGDRGIQGKKGGEGVDGAPGIDGKDGSVGDPGAPGEH---------------GSNGIPGSKGSQGGTGPQGIIGNAGATGRPGLDGMIGIQGVKGDSGPQGLN 1207
            G SG++G  G  GP G PG  G QGP+G +GP G  G  G KG+ G  G  G +G  G  G  G  G  G+RG +G  GP    GP                                     +G  G  G+ G  G  G TG+SG PG  GP G  G  G+ G  G  G DG PG DG  G +G  G  G+                G NG+PG  G  G  GP   +G  G  GRPG DG+ G  G++G  G  G +
Sbjct:  536 GLSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGISGMPGMPGSPGPVGVRGKVGKPGPPSKDGPPGQAGPQGPPGLDGPPGPDGSVKISGRSGGGRGSPGPKGHKGQPGKNGMNGLQGPTGLSGNPGKQGPPGEAGPDGLLGPMGPPGKDGKPGEDGNLGPIGKTGKVGKDGPPGPPGPTGDVGPIGPNGLPGQNGKPGKAGP---LGPTGPVGRPGSDGIRGPNGLRGPPGKSGAD 791          
The following BLAST results are available for this feature:
BLAST of Fibrillar collagen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL2A11.713e-3231.82collagen type II alpha 1 chain [Source:HGNC Symbol... [more]
COL2A11.360e-3131.82collagen type II alpha 1 chain [Source:HGNC Symbol... [more]
COL5A23.651e-3132.88collagen type V alpha 2 chain [Source:HGNC Symbol;... [more]
COL5A29.696e-3132.88collagen type V alpha 2 chain [Source:HGNC Symbol;... [more]
COL1A12.850e-3032.42collagen type I alpha 1 chain [Source:HGNC Symbol;... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col-1353.327e-1635.62COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
col-1358.708e-1637.05COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
emb-98.091e-1543.20Collagen alpha-1(IV) chain [Source:UniProtKB/Swis... [more]
emb-91.287e-1443.20Collagen alpha-1(IV) chain [Source:UniProtKB/Swis... [more]
col-1646.888e-1442.25COLlagen [Source:UniProtKB/TrEMBL;Acc:Q22651][more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col4a12.218e-1442.99gene:FBgn0000299 transcript:FBtr0079003[more]
Col4a12.218e-1442.99gene:FBgn0000299 transcript:FBtr0079002[more]
Col4a12.218e-1442.99gene:FBgn0000299 transcript:FBtr0079001[more]
vkg7.470e-1038.39gene:FBgn0016075 transcript:FBtr0333541[more]
vkg7.470e-1038.39gene:FBgn0016075 transcript:FBtr0079036[more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col2a1a1.316e-3231.25collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col2a1a9.758e-3231.25collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col1a1a2.085e-3132.28collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GE... [more]
col2a1a2.195e-3131.25collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col2a1a5.290e-3131.25collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col1a13.476e-3232.58collagen, type I, alpha 1 [Source:NCBI gene;Acc:49... [more]
col1a19.832e-3032.58collagen, type I, alpha 1 [Source:NCBI gene;Acc:49... [more]
col1a21.098e-2929.06collagen type I alpha 2 [Source:NCBI gene;Acc:7801... [more]
col1a12.515e-2932.58collagen, type I, alpha 1 [Source:NCBI gene;Acc:49... [more]
col1a13.449e-2932.58collagen, type I, alpha 1 [Source:NCBI gene;Acc:49... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col1a21.736e-3229.61collagen, type I, alpha 2 [Source:MGI Symbol;Acc:M... [more]
Col3a11.175e-2830.56collagen, type III, alpha 1 [Source:MGI Symbol;Acc... [more]
Col1a18.285e-2831.67collagen, type I, alpha 1 [Source:MGI Symbol;Acc:M... [more]
Col2a12.781e-2529.87collagen, type II, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col2a11.354e-2429.87collagen, type II, alpha 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Fibrillar collagen vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02466|CO1A2_RAT4.095e-3230.47Collagen alpha-2(I) chain OS=Rattus norvegicus OX=... [more]
sp|Q01149|CO1A2_MOUSE1.215e-3129.61Collagen alpha-2(I) chain OS=Mus musculus OX=10090... [more]
sp|Q9YIB4|CO1A1_CYNPY1.490e-3133.20Collagen alpha-1(I) chain OS=Cynops pyrrhogaster O... [more]
sp|O46392|CO1A2_CANLF1.759e-3129.61Collagen alpha-2(I) chain OS=Canis lupus familiari... [more]
sp|P02458|CO2A1_HUMAN6.530e-3131.82Collagen alpha-1(II) chain OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Fibrillar collagen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6G2T31.202e-62100.00Collagen F-5 (Fragment) OS=Schmidtea mediterranea ... [more]
A0A0R3X7W11.214e-4937.72Fibrillar collagen NC1 domain-containing protein O... [more]
A0A0R3SR951.239e-4935.64Fibrillar collagen NC1 domain-containing protein O... [more]
W6UR322.879e-4938.50Collagen alpha-2(I) chain OS=Echinococcus granulos... [more]
A0A0R3TPT31.327e-4838.60Fibrillar collagen NC1 domain-containing protein O... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col1a1a2.618e-3132.68collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GE... [more]
col1a1b2.390e-2630.04collagen, type I, alpha 1b [Source:ZFIN;Acc:ZDB-GE... [more]
col1a26.083e-2528.09collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000043273.13.966e-2132.75pep primary_assembly:Astyanax_mexicanus-2.0:13:424... [more]
col27a1b7.191e-2126.61collagen, type XXVII, alpha 1b [Source:NCBI gene;A... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003197.14.211e-3029.55pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 g... [more]
ENSPMAT00000005318.14.428e-3031.84pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 ... [more]
ENSPMAT00000001576.13.534e-2831.05pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1... [more]
ENSPMAT00000001071.11.651e-2729.73pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gen... [more]
ENSPMAT00000009617.17.828e-2730.09pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibrillar collagen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447291.868e-3127.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493681.430e-2933.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429531.993e-2827.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494016.037e-2435.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446974.519e-2328.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibrillar collagen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col2a1a4.215e-3432.03collagen type II A [Source:NCBI gene;Acc:100682394... [more]
col2a1a3.136e-3332.03collagen type II A [Source:NCBI gene;Acc:100682394... [more]
col13.622e-3231.89collagen type I alpha 1 [Source:NCBI gene;Acc:1001... [more]
col2a1a6.205e-3232.17collagen alpha-1(II) chain [Source:NCBI gene;Acc:1... [more]
col2a1a2.595e-3132.17collagen alpha-1(II) chain [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Fibrillar collagen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024244.12.493e-17399.69SMESG000024244.1[more]
SMESG000026651.18.622e-6342.41SMESG000026651.1[more]
SMESG000026651.11.022e-6242.41SMESG000026651.1[more]
SMESG000045473.13.745e-5138.57SMESG000045473.1[more]
SMESG000038928.18.339e-5039.82SMESG000038928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017388 ID=SMED30017388|Name=Fibrillar collagen|organism=Schmidtea mediterranea sexual|type=transcript|length=4277bp
CTCTTCCGATCTCTACAGGTGACATTTATAGATTCAATATTGATTCGATA
TTCTGCTGCAATTTCTACCATTTATTGCCAATGTGTGCCACATCATATCT
ATACAGATCCTAATTTTCAATTTTTAATAACTGTATTATTTGTCTAAACA
TTTTTTGAAGTCAATTGTTTGATTTGTATTAAATTAATTTTGGATTAATT
GTTAAAAGGCTCTTGGCCTTCTTGAAATGGATATTAAAACGTTTCTATTT
ATTTTTTTCATCTTATCAGCAGCTCAAGCTGAACCACTTAGTAGATTAAA
AAGACAAGCAGAAGGTGAGTTTACTTTTGGCGGAGCAGGAGAAGAAGAAC
CTGAAACAACTGAAGCGCCTATGGAAACATTACCACCTAGTGTCAAAGGT
CCAGCTCCCTTAACAGGAAATCGTTATGTTGCAGGACCGGCTGGTCTACA
GGGTCCAGATGGACCGGAAGGTCGACCTGGTCCAAAAGGTCCTAATGGTT
TAACTGGACCGCAAGGCAAGCCTGGAAAAGATGGAAAGCCAGGACCAATC
GGTCCAGTTGGGCCACAAGGTCCAAATGGAAGGATGGGTAGATCTGGAAG
AAATGGTGCTGGAGGACCTCAAGGTCCAACTGGGAAACCTGGCCTTATGG
GGTCTCAAGGACCTCAAGGAATGAATGGTCCAAAAGGACCGAATGGTGAA
CAAGGTCCAAAAGGAGATGCAGGTCCACCTGGAGGTAAAGGCCCAAAAGG
TCCTATCGGAGAGCTTGGAGCTGCAGGTCCCATTGGTCTACCTGGAATTC
GTGGAGATCTGGGTTCACAAGGACCCATCGGATCTCATGGACCAGAAGGA
GAGCCTGGTGTTGGTGGTCGAATAGGGTTTCCCGGAGCTGACGGAATTAC
TGGAGTTTCAGGAATGCCGGGAGTAATTGGACCTACGGGAACCAAAGGTG
ATAGGGGAATTCAAGGAAAGAAAGGAGGGGAAGGAGTAGATGGCGCCCCA
GGAATTGATGGTAAAGATGGTTCTGTTGGTGATCCAGGAGCTCCAGGAGA
ACATGGCAGTAATGGTATTCCTGGATCTAAAGGTTCTCAAGGTGGGACTG
GTCCACAGGGTATCATAGGTAATGCCGGAGCAACTGGTAGACCTGGATTA
GACGGGATGATTGGGATTCAGGGAGTTAAAGGGGATTCAGGACCTCAAGG
ATTGAATGGTCGGTCAGGTATTATAGGAAGCGTAGGACCACCGGGTTCCT
TGGGGCCTATAGGAAATCCAGGAAATCGAGGAGATCCCGGAAGAATTGGA
ACTCCGGGTACTAGAGGAATTCCTGGTACAAAAGGATCACAGGGACCAAA
TGGTCCTCCTGGAATAAATGGAAGTCCAGGTGCTGATGGTAGAGATGGAT
TGCCTGGTATCGATGGTGCCAATGGTAAACCAGGATCTAGAGGACCTCGT
GGTTCACAAGGACTTGCTGGTCTTCCAGGAAAAGATGGAGTTGTCGGTCC
TTTTGGATTATCAGGCCAACCCGGTGCAAATAAACCTCCAGGACCTCAAG
GTAAAATGGGCCCCAGAGGACTTACTGGAAAACCAGGATCAAATGGTGTA
CCGGGACCAGTAGGTCAACCTGGTCCACCTGGTTCTCAAGGTTCTTCAGG
CTCACCAGGTCTTATTGGAGAAAATGGTTTATTGGGTAACATTGGAAAAC
CTGGTTCTAATGGTGCACCCGGGGCAATTGGGTCCGCTGGCGCTCCTGGT
GTTCCAGGAGATGATGGACCGCCAGGTCCAGCTGGTCTCAGAGGTCCGAT
CGGTAAAAAAGGAAAAGTTGGTGAACGCGGAGGACCTGGTGGCCAAGGAA
ATCAAGGAGCAAGAGGTGTGAGAGGCAAACCCGGTCCACCTGGAAAAGAT
GGTGTCAATGGTAAACCTGGAAAAGATGGAAAACCTGGTGACCTAGGAGT
AATTGGAATTACTGGTAAAAGCGGCCCACCAGGACCATCGGGTAAACCAG
GACCTGCAGGTTTAATGGGTCTAAAGGGTGACATTGGACCAACTGGTCCA
CTTGGTCCACTTGGTGTTACAGGCATTTCTGGATTACCAGGAATGAATGG
TCCTCCAGGACCTCAAGGATATAAAGGAACTATGGGGTTATCTGGGAAAA
CTGGTAAAGTAGGTTCACCTGGTCCTCCTGGTAACAGAGGCAAACCGGGA
TCTTCTGGTTCCACTGGCAACGTACAAATTGCAGGAAGAAGCAGTGGTGG
TTCGGGTACAAAAGGAAAACCCGGAGAAGATGGAGATGCTGGAAAACCTG
GAAGCCCAGGTTCACCTGGAGAAATCGGACCTCCGGGAGACATCGGCCCT
ACTGGCCAATCTGGAGCACTTGGTAAACCAGGACCTAAAGGACCGGTGGG
ATTTCCTGGTAAAGATGGAAGGGATGGCAGATTAGGCTTAGATGGTTCAC
AAGGACCTGCTGGGTCACCGGGAAAGGTTGGGCCTCAAGGTGCTAAAGGT
AAAGTTGGACCACAAGGACCTCCAGGGGGACCTGGTTCAACTGGAATGTC
CGGTCCGCAAGGAGATGATGGACTTGATGGTAACGTCGGACCCGAAGGTA
AACCTGGAAATCCAGGTCTTGATGGATTCCCTGGTAATCAAGGAGTTCCT
GGTGTTTCTGGTAGAGACGGAGAAAGAGGAGATCAAGGTAAATTAGGAGT
CCCTGGCATTCCTGGTGAAACAGGAATGAATGGAACTCCAGGAAGAGATG
GAAGACCTGGAGTTGCTGGAATGCGAGGAGATACGGGCCAGCCTGGTCCA
AGGGGACCTGCTGGACCAGAGGGTTCTACTGGAGCTCCTGGGTTAATGGG
GGATATCGGTAAGCCAGGGCAGAAGGGGAAACCAGGAAATACCGGACCTA
AAGGGTTAACCGGTAACCAAGGGATAACTGGTCCTATGGGAAACACTGGT
AAACCCGGTGCAGCTGGGAAAACAGGGGGTAAAGGATTACCTGGTCCTGA
TGGCCCATCGGGATCGGTCGGAAGAAGAGGAGAAAGTGGAGTCCCAGGAA
AATCAGGTGGATTTGGGAGTAAAGGTAAAAAAGGAGCTGAAGGTCCAGTT
GGTCCAGCCGGTAAAGAGGGCCTTCCTGGAAAGGTTGGACCTTTGGGTAA
ACCAGGCAAACCGGGTAAAGAAGGAAAACCGGGAAAAGATGGAAAAACTG
GGCCTGTAGGTGAGCCAGGTCATCCTGGGTGGATGGGGCCCCAAGGTTTA
TTGGGTCCACCTGGTCCTCAAGGAGATCGAGGTAAGCCAGGTGATCCTGG
ATCCCCGGGAATAGAAGGTTCTCCTGGAGATGTAGGAGACCAGGGAGTTC
CAGGTCCAAAAGGTCCAACTGGACCAAACGGAGAAATGGGATTAATGGGA
CCTATGGGTGTTACTGGACGAGATGGGCCATCTGGTCCACATGGATTAAT
GGGAAACGCCGGACCGCCTGGACCTCCTGGTCCCCCAGCTATGATGCTTC
CTAT