Threonine synthase like 2

Overview
NameThreonine synthase like 2
Smed IDSMED30017384
Length (bp)958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Threonine synthase like 2 (SMED30017384) t-SNE clustered cells

Violin plots show distribution of expression levels for Threonine synthase like 2 (SMED30017384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Threonine synthase like 2 (SMED30017384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Threonine synthase like 2 (SMED30017384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30017384SMESG000081544.1 dd_Smed_v4_10188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Threonine synthase like 2 vs. Ensembl Human
Match: THNSL2 (threonine synthase like 2 [Source:HGNC Symbol;Acc:HGNC:25602])

HSP 1 Score: 183.726 bits (465), Expect = 1.576e-53
Identity = 100/312 (32.05%), Postives = 166/312 (53.21%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDT-----LVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH---KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    T  Q LQMTTV  +N    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    + DT     + V +P G  GNL    +  ++GLPI+L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + V +P ++  K+   +     SD   T +TM  C++E  Y +CPH+A A++Y Y    +++    +  L  AS +KF E  + AG+    E    +  L++KE   T+M   ++ +  L++ I
Sbjct:  161 IIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSL-DTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSVSVSDEAIT-QTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPASAAKFPEAVLAAGLTP--ETPAEIVALEHKETRCTLMRRGDNWMLMLRDTI 468          
BLAST of Threonine synthase like 2 vs. Ensembl Human
Match: THNSL2 (threonine synthase like 2 [Source:HGNC Symbol;Acc:HGNC:25602])

HSP 1 Score: 136.346 bits (342), Expect = 4.790e-38
Identity = 70/205 (34.15%), Postives = 112/205 (54.63%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDT-----LVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVI 600
            + VL P    T  Q LQMTTV  +N    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    + DT     + V +P G  GNL    +  ++GLPI+L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + V +P ++  K   V+
Sbjct:    3 IIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSL-DTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKHSPVL 206          
BLAST of Threonine synthase like 2 vs. Ensembl Human
Match: THNSL2 (threonine synthase like 2 [Source:HGNC Symbol;Acc:HGNC:25602])

HSP 1 Score: 135.961 bits (341), Expect = 3.134e-36
Identity = 69/200 (34.50%), Postives = 110/200 (55.00%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDT-----LVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEK 585
            + VL P    T  Q LQMTTV  +N    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    + DT     + V +P G  GNL    +  ++GLPI+L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + V +P ++  K
Sbjct:  161 IIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSL-DTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSK 359          
BLAST of Threonine synthase like 2 vs. Ensembl Human
Match: THNSL1 (threonine synthase like 1 [Source:HGNC Symbol;Acc:HGNC:26160])

HSP 1 Score: 105.531 bits (262), Expect = 1.399e-24
Identity = 70/277 (25.27%), Postives = 131/277 (47.29%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNI------SCLNSINCGRIICQMALHVFIYLQIAEK----VGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILC-TNENDLGDKLIKTGMVEKQETS-HFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEA 795
            V   FP + ++  Q+ Q+     ENG+A+G     D  +  I+ I +D +++    +      S  NSIN GR++ Q+  H   YL +  +     G  + V IP G +GN+L A     MG+PI+  +C +N+N +    IKTG  + +E     ++S ++D +   N+ R   + +  D        ++++      I   ++EK++   +  + S+  + L  ++S +N   Y + PHTA A       ++     ++  TA  SKF+   ++A
Sbjct:  403 VVAFFPENGVSDFQKAQIIGSQRENGWAVGVESDFDFCQTAIKRIFNDSDFTGFLTVEYGTILSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYDLRERKLAQTFSPSIDILKSSNLERHLHLMANKDGQLMTELFNRLESQHHFQIEKALVEKLQQDFVADWCSE-GECLAAINSTYNTSGYILDPHTAVAKVVADRVQDKTCPVIISSTAHYSKFAPAIMQA 678          
BLAST of Threonine synthase like 2 vs. Ensembl Human
Match: THNSL1 (threonine synthase like 1 [Source:HGNC Symbol;Acc:HGNC:26160])

HSP 1 Score: 105.531 bits (262), Expect = 1.399e-24
Identity = 70/277 (25.27%), Postives = 131/277 (47.29%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNI------SCLNSINCGRIICQMALHVFIYLQIAEK----VGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILC-TNENDLGDKLIKTGMVEKQETS-HFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEA 795
            V   FP + ++  Q+ Q+     ENG+A+G     D  +  I+ I +D +++    +      S  NSIN GR++ Q+  H   YL +  +     G  + V IP G +GN+L A     MG+PI+  +C +N+N +    IKTG  + +E     ++S ++D +   N+ R   + +  D        ++++      I   ++EK++   +  + S+  + L  ++S +N   Y + PHTA A       ++     ++  TA  SKF+   ++A
Sbjct:  403 VVAFFPENGVSDFQKAQIIGSQRENGWAVGVESDFDFCQTAIKRIFNDSDFTGFLTVEYGTILSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYDLRERKLAQTFSPSIDILKSSNLERHLHLMANKDGQLMTELFNRLESQHHFQIEKALVEKLQQDFVADWCSE-GECLAAINSTYNTSGYILDPHTAVAKVVADRVQDKTCPVIISSTAHYSKFAPAIMQA 678          
BLAST of Threonine synthase like 2 vs. Ensembl Zebrafish
Match: thnsl2 (threonine synthase-like 2 [Source:NCBI gene;Acc:641568])

HSP 1 Score: 168.703 bits (426), Expect = 4.665e-48
Identity = 96/291 (32.99%), Postives = 154/291 (52.92%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKV--GDTLVVA---IPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHK--KEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSI-FLTQLQNK 849
            + V+FP  RIT  Q LQMTT  +EN       GT D+I+  +R +  D +  +   +  LNS+N  RI+ Q A  +F YLQ+   +  GDTL V    +P GG GN+    +V  MG+P++L+   N ND+  + +++G      +   + + A+D   PYN+ R+FW+ SG D    KS M +  +  K+++P  + +++  V+     SD +  LE M  C+ + HY ICPHTA A+   Y    +  +N +  + TAS  KF +    AG+  +   S+  L QL+ +
Sbjct:  161 IVVVFPRGRITKIQELQMTTSVAENVHVFAADGTSDDIDVPLRKLFADADLVQRHRLMSLNSVNWSRIMVQTAHFLFAYLQLTPSLPEGDTLPVLEVLVPTGGAGNITAGIIVKRMGVPLRLVAMVNANDIVHRTVQSGDFSMSSSVTQTLAPAIDIQDPYNMERVFWLLSGGDGLMVKSLMEEFQKTHKLSLPASLHQQLSEVLSSGSVSD-DGILEAMRRCWQDNHYLICPHTAVAVWRHYQSPVRPGEN-RCCIATASPHKFQQAVQRAGLTLELPESLQVLDQLEMR 449          
BLAST of Threonine synthase like 2 vs. Ensembl Zebrafish
Match: thnsl2 (threonine synthase-like 2 [Source:NCBI gene;Acc:641568])

HSP 1 Score: 130.954 bits (328), Expect = 8.185e-35
Identity = 67/201 (33.33%), Postives = 110/201 (54.73%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKV--GDTLVVA---IPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKI 588
            + V+FP  RIT  Q LQMTT  +EN       GT D+I+  +R +  D +  +   +  LNS+N  RI+ Q A  +F YLQ+   +  GDTL V    +P GG GN+    +V  MG+P++L+   N ND+  + +++G      +   + + A+D   PYN+ R+FW+ SG D    KS M +  +  K+++P  + +++
Sbjct:  161 IVVVFPRGRITKIQELQMTTSVAENVHVFAADGTSDDIDVPLRKLFADADLVQRHRLMSLNSVNWSRIMVQTAHFLFAYLQLTPSLPEGDTLPVLEVLVPTGGAGNITAGIIVKRMGVPLRLVAMVNANDIVHRTVQSGDFSMSSSVTQTLAPAIDIQDPYNMERVFWLLSGGDGLMVKSLMEEFQKTHKLSLPASLHQQM 361          
BLAST of Threonine synthase like 2 vs. Ensembl Xenopus
Match: krtcap3 (keratinocyte associated protein 3 [Source:Xenbase;Acc:XB-GENE-5847078])

HSP 1 Score: 162.54 bits (410), Expect = 1.296e-45
Identity = 91/283 (32.16%), Postives = 148/283 (52.30%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAE----KVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEID----NVKVVLGTASISKFSEVGIEAGIIEKFENSI 825
            + VL P  R T  Q LQMTTV  +N       GT DE++  I+ +  D ++ K  NI   NS+N  RI+ Q+A   + YLQ       +    + + +P GG GN+   C+   MGLPI+L+   N ND+  + ++ G     +T+  + +SAMD   PYN+ R+ W+ +G D +  K  M +  + ++V IP ++ ++I  V+     +D N  L T+  C+ E HY +CPH+A  +  +YH + ID    + +  L  AS +KF +V ++A +       I
Sbjct:  161 IVVLLPRGRCTRIQELQMTTVIEDNVHVFAVDGTSDELDYPIKKLFADSDFVKTHNIISTNSVNWARILVQIAHFFYGYLQCVPPTELQCPTPVEIVVPTGGAGNITAGCIAQAMGLPIRLVAVVNRNDIIHRTVQHGDFSLGDTA-ATLASAMDIQEPYNMERILWLLAGSDRSHIKELMEEFQEKKRVKIPEQLHKRIAGVMTSCRVTDDN-ILGTIGRCWEENHYLLCPHSAVGV--YYHYQHIDGNQKSPRCCLAPASAAKFQDVIMKANLTPDIPQEI 439          
BLAST of Threonine synthase like 2 vs. Ensembl Xenopus
Match: slc49a4 (solute carrier family 49 member 4 [Source:Xenbase;Acc:XB-GENE-488397])

HSP 1 Score: 104.375 bits (259), Expect = 3.724e-24
Identity = 80/314 (25.48%), Postives = 146/314 (46.50%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFN------ISCLNSINCGRIICQMALHVFIYLQIAEK----VGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILC-TNENDLGDKLIKTGMVEKQETSHF-SWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKN 906
            V+ L+P + I+  Q+LQ+     EN   +G     D  ++ I+ +  + +Y+          +S  NSIN  R++ Q+  H   YL +  +     G  + V IP G +GN+L A    +MG+PI+ ++C +N+N +    +KTG  + +      S S A+D +   NI R   + + +D  F K    ++       +   ++  I+  II  + S+  D LE + S +    Y + PHTA A       ++     ++  TA  SKF+   ++A  I+  ++S  L+QL     F+ +   ++  +  LK 
Sbjct:  440 VFCLYPENGISQAQKLQIIACQGENSLGLGVGSDFDFCQNTIKKLFTNSDYTGFLTAEYGTVLSTANSINWVRLLPQVVYHASAYLDLVSQGIISFGSHVDVCIPTGNFGNILAALYAKQMGVPIRKLICASNQNHVLTDFLKTGHYDLRGKKLLQSCSPAIDILKSSNIERYLHLLTNNDGKFVKQLFVQLQNEGHFQLRSNLVCLIQEDIIGGWCSE-KDCLEMIHSVYEATGYILDPHTAIAKVVADRVQDRTCPVIISSTAHYSKFAPAILQALRIDSIKHSP-LSQLHLLNSFHPLPPTHKALIEMLKK 751          
BLAST of Threonine synthase like 2 vs. Ensembl Mouse
Match: Thnsl2 (threonine synthase-like 2 (bacterial) [Source:MGI Symbol;Acc:MGI:3041254])

HSP 1 Score: 177.563 bits (449), Expect = 2.317e-51
Identity = 97/307 (31.60%), Postives = 159/307 (51.79%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEI--DNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLK 903
            + VL P    +  Q LQMTTV  EN       G  DE+++ I+++  D  + +  N+  LNSIN  R++ QMA H F Y Q    +      T+ V +P G  GNL   C+  +MGLPI L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + + +P  +  K+   +     +D   T +TM+ C+ E  Y +CPH+ATA++Y Y + +    +++  L +AS  KF E    AG+  +    I    L++KE     M   +D    L+
Sbjct:  161 IIVLLPKGHCSKIQELQMTTVLKENVHVFEVEGNSDELDEPIKAVFADVAFVQRHNVMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPTVEVVVPTGAGGNLAAGCIAQKMGLPICLVVAVNRNDIIHRTVQKGDFSLCEVLRTTLASAMDIQVPYNMERIFWLLSGSDSQTTRALMEQFERTQSLQLPKDLHNKLSEAVTSESVTDEAIT-QTMARCWEENQYLLCPHSATAVNYHYQQTDSGQSSIRCCLASASAVKFPEAVQAAGLTPETPAEIL--ALEHKETRCIPMRRGDDWTQMLR 464          
BLAST of Threonine synthase like 2 vs. Ensembl Mouse
Match: Thnsl2 (threonine synthase-like 2 (bacterial) [Source:MGI Symbol;Acc:MGI:3041254])

HSP 1 Score: 177.563 bits (449), Expect = 2.317e-51
Identity = 97/307 (31.60%), Postives = 159/307 (51.79%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEI--DNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLK 903
            + VL P    +  Q LQMTTV  EN       G  DE+++ I+++  D  + +  N+  LNSIN  R++ QMA H F Y Q    +      T+ V +P G  GNL   C+  +MGLPI L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + + +P  +  K+   +     +D   T +TM+ C+ E  Y +CPH+ATA++Y Y + +    +++  L +AS  KF E    AG+  +    I    L++KE     M   +D    L+
Sbjct:  161 IIVLLPKGHCSKIQELQMTTVLKENVHVFEVEGNSDELDEPIKAVFADVAFVQRHNVMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPTVEVVVPTGAGGNLAAGCIAQKMGLPICLVVAVNRNDIIHRTVQKGDFSLCEVLRTTLASAMDIQVPYNMERIFWLLSGSDSQTTRALMEQFERTQSLQLPKDLHNKLSEAVTSESVTDEAIT-QTMARCWEENQYLLCPHSATAVNYHYQQTDSGQSSIRCCLASASAVKFPEAVQAAGLTPETPAEIL--ALEHKETRCIPMRRGDDWTQMLR 464          
BLAST of Threonine synthase like 2 vs. Ensembl Mouse
Match: Thnsl1 (threonine synthase-like 1 (bacterial) [Source:MGI Symbol;Acc:MGI:2139347])

HSP 1 Score: 102.064 bits (253), Expect = 1.469e-23
Identity = 71/282 (25.18%), Postives = 134/282 (47.52%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNI------SCLNSINCGRIICQMALHVFIYLQIAEK----VGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILC-TNENDLGDKLIKTGMVE-KQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEA-GIIE 807
            V   FP + ++  Q+ ++     ENG+AIG     D  +  IR I +D +++    +      S  NSIN  R++ Q+  H   YL++  +     G  + V +P G +GN+L A     MG+PI+  +C +N+N +    IKTG  + +      ++S ++D +   N+ R  ++ +  D     +   +++      I   ++EK++   +  + S+  + L  +S+ +N   Y + PHTA A       ++     ++  TA  SKF+   ++A GI E
Sbjct:  403 VVTFFPENGVSDFQKAEIIGSQRENGWAIGVRSDFDFCQTAIRKIFNDSDFTGFLAVEYGTILSSANSINWARLLPQIVYHASAYLELVNQRFISFGSPVDVCVPTGNFGNVLAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYDLRNRKLAQTFSPSIDILKSSNLERHLYLMANKDGQLMANLYHQLESQLHFRIEKMLVEKLQQEFVADWCSE-GECLAAISTTYNASGYILDPHTAVAKVVADKMQDKSCPVLIASTAHYSKFAPAIMQALGIKE 683          
BLAST of Threonine synthase like 2 vs. Ensembl Mouse
Match: Thnsl2 (threonine synthase-like 2 (bacterial) [Source:MGI Symbol;Acc:MGI:3041254])

HSP 1 Score: 69.3218 bits (168), Expect = 6.865e-14
Identity = 44/182 (24.18%), Postives = 80/182 (43.96%), Query Frame = 1
Query:  364 NENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEI--DNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLK 903
            N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + + +P  ++                                 CPH+ATA++Y Y + +    +++  L +AS  KF E    AG+  +    I    L++KE     M   +D    L+
Sbjct:    2 NRNDIIHRTVQKGDFSLCEVLRTTLASAMDIQVPYNMERIFWLLSGSDSQTTRALMEQFERTQSLQLPKDLL---------------------------------CPHSATAVNYHYQQTDSGQSSIRCCLASASAVKFPEAVQAAGLTPETPAEILA--LEHKETRCIPMRRGDDWTQMLR 148          
BLAST of Threonine synthase like 2 vs. UniProt/SwissProt
Match: sp|Q86YJ6|THNS2_HUMAN (Threonine synthase-like 2 OS=Homo sapiens OX=9606 GN=THNSL2 PE=2 SV=3)

HSP 1 Score: 183.726 bits (465), Expect = 7.568e-53
Identity = 100/312 (32.05%), Postives = 166/312 (53.21%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDT-----LVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH---KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    T  Q LQMTTV  +N    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    + DT     + V +P G  GNL    +  ++GLPI+L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + V +P ++  K+   +     SD   T +TM  C++E  Y +CPH+A A++Y Y    +++    +  L  AS +KF E  + AG+    E    +  L++KE   T+M   ++ +  L++ I
Sbjct:  161 IIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSL-DTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSVSVSDEAIT-QTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPASAAKFPEAVLAAGLTP--ETPAEIVALEHKETRCTLMRRGDNWMLMLRDTI 468          
BLAST of Threonine synthase like 2 vs. UniProt/SwissProt
Match: sp|Q5M7T9|THNS2_RAT (Threonine synthase-like 2 OS=Rattus norvegicus OX=10116 GN=Thnsl2 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.391e-52
Identity = 101/312 (32.37%), Postives = 159/312 (50.96%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVV----LGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    +  Q LQMTTV  EN    G  G  DE+++ I+++  D  + +  N+  LNSIN  R++ QMA H F Y Q    +      T+ V +P G  GNL   C+  +MGLPI L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ +G D+  T++ M + ++ + + +P  +  K+   +     SD   T +TM  C+ E  Y +CPH+ATA+SY Y + +      +    L  AS  KF E    AG+  +    I    L++KE   T M   +D    L++ I
Sbjct:  161 IIVLLPKGHCSKIQELQMTTVVKENVHVFGVEGNSDELDEPIKAVFADVAFVQRHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDMHLLPTVEVVVPTGAGGNLAAGCIAQKMGLPISLVVAVNRNDIIHRTVQKGDFSLCEVVRKTLASAMDIQVPYNMERIFWLLAGSDSQTTRALMEQFERTQSLHLPKDLHSKLSEAVTSESVSDEAIT-QTMGRCWEENQYLLCPHSATAVSYHYQQTDSGQPSSIPRCCLAPASAVKFPEAVQAAGLTPETPAEIL--ALEHKETRCTPMRRGDDWTQMLRDTI 469          
BLAST of Threonine synthase like 2 vs. UniProt/SwissProt
Match: sp|Q5RFE6|THNS2_PONAB (Threonine synthase-like 2 OS=Pongo abelii OX=9601 GN=THNSL2 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.110e-52
Identity = 100/312 (32.05%), Postives = 165/312 (52.88%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDT-----LVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH---KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    T  Q LQMTTV  EN    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    + DT     + V +P G  GNL    +  ++GLP++L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + V +P ++  K+   +     SD   T +TM  C++E  Y +CPH+A A++Y Y    +++    +  L  AS +KF E  + AG+    E    +  L++KE   T M   ++ +  L++ I
Sbjct:  161 IIVLLPKGHCTKIQELQMTTVLKENVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCMPSL-DTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPVRLVVAVNGNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSVSVSDEAIT-QTMGRCWDENQYLLCPHSAVAVNYHYQQMDRQQPSTPRCCLAPASAAKFPEAVLAAGLTP--ETPAEIVALEHKETRCTPMRRGDNWMLMLRDTI 468          
BLAST of Threonine synthase like 2 vs. UniProt/SwissProt
Match: sp|Q80W22|THNS2_MOUSE (Threonine synthase-like 2 OS=Mus musculus OX=10090 GN=Thnsl2 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.621e-50
Identity = 97/307 (31.60%), Postives = 159/307 (51.79%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEI--DNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLK 903
            + VL P    +  Q LQMTTV  EN       G  DE+++ I+++  D  + +  N+  LNSIN  R++ QMA H F Y Q    +      T+ V +P G  GNL   C+  +MGLPI L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + + +P  +  K+   +     +D   T +TM+ C+ E  Y +CPH+ATA++Y Y + +    +++  L +AS  KF E    AG+  +    I    L++KE     M   +D    L+
Sbjct:  161 IIVLLPKGHCSKIQELQMTTVLKENVHVFEVEGNSDELDEPIKAVFADVAFVQRHNVMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPTVEVVVPTGAGGNLAAGCIAQKMGLPICLVVAVNRNDIIHRTVQKGDFSLCEVLRTTLASAMDIQVPYNMERIFWLLSGSDSQTTRALMEQFERTQSLQLPKDLHNKLSEAVTSESVTDEAIT-QTMARCWEENQYLLCPHSATAVNYHYQQTDSGQSSIRCCLASASAVKFPEAVQAAGLTPETPAEIL--ALEHKETRCIPMRRGDDWTQMLR 464          
BLAST of Threonine synthase like 2 vs. UniProt/SwissProt
Match: sp|Q2YDP8|THNS2_DANRE (Threonine synthase-like 2 OS=Danio rerio OX=7955 GN=thnsl2 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.082e-47
Identity = 95/290 (32.76%), Postives = 151/290 (52.07%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKV--GDTLVVA---IPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKK-EIDNVKVVLGTASISKFSEVGIEAGIIEKFENSI-FLTQLQNK 849
            + V+FP  RIT  Q LQMTT  +EN       GT D+I+  +R +  D +  +   +  LNS+N  RI+ Q A  +F YLQ+   +  GDTL V    +P GG GN+    +V  MG+P++L+   N ND+  + +++G      +   + + A+D   PYN+ R+FW+ SG D    KS M +  +  K+++P  + +++  V+     SD +  LE M  C+ + HY ICPHTA A+   Y         +  + TAS  KF +    AG+  +   S+  L QL+ +
Sbjct:  161 IVVVFPRGRITKIQELQMTTSVAENVHVFAADGTSDDIDVPLRKLFADADLVQRHRLMSLNSVNWSRIMVQTAHFLFAYLQLTPSLPEGDTLPVLEVLVPTGGAGNITAGIIVKRMGVPLRLVAMVNANDIVHRTVQSGDFSMSSSVTQTLAPAIDIQDPYNMERVFWLLSGGDGLMVKSLMEEFQKTHKLSLPASLHQQLSEVLSSGSVSD-DGILEAMRRCWQDNHYLICPHTAVAVWRHYQSPVRPGESRCCIATASPHKFQQAVQRAGLTLELPESLQVLDQLETR 449          
BLAST of Threonine synthase like 2 vs. TrEMBL
Match: A0A485PR69 (Threonine synthase-like 2-like OS=Lynx pardinus OX=191816 GN=LYPA_23C014884 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 6.642e-54
Identity = 106/311 (34.08%), Postives = 165/311 (53.05%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG-DTLV---VAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDN---VKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    T  Q LQMTTV  EN    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q A  +  D L    V +P G  GNL   C+  +MGLPI+L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG ++  T++ M + ++ + V++P ++  K+   +     SD   T +TM+ C+ E  Y +CPH+A A+SY Y + E       +  L  AS +KF E  + AG+  +    I    L++K    T M + +D    L+N I
Sbjct:  161 IIVLLPKGHCTKIQELQMTTVLRENVHVFGVEGNSDELDEPIKAVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCASSLDMDPLPLVEVVVPTGAAGNLAAGCIAQKMGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVEQTLASAMDIQVPYNVERIFWLLSGSNSQVTRALMEQFERTQSVSLPKELHSKLSGAVTSESVSDKAIT-QTMARCWEENKYLLCPHSAVAVSYHYQQTEQQPPSLPRCCLAPASAAKFPEAVLAAGLTPETPAEIL--ALESKGTRCTPMRKGDDWTLMLRNTI 468          
BLAST of Threonine synthase like 2 vs. TrEMBL
Match: G3W9E2 (Threonine synthase like 2 OS=Sarcophilus harrisii OX=9305 GN=THNSL2 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 3.999e-53
Identity = 102/311 (32.80%), Postives = 165/311 (53.05%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHK---KEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P  R +  Q LQMTTV  EN    G  G  DE+++ I+ +  D  ++K  N+  LNSIN  R++ QMA H F Y Q    +      T+ V +P G  GNL   C+  EMGLPI+L+   N+ND+  + ++ G       +  + +SAMD  +PYN+ R+FW+ SG  +   ++ M + D+ + + +P K+  K+   I    ASD  D ++TM  C+ E HY +CPH+A A+SY Y +   ++    +  L  AS +KF +  ++A ++ +    I    L++ +   T +   +D    L+N I
Sbjct:  162 IIVLLPLGRCSKIQELQMTTVIEENVHVFGVDGNSDELDEPIKDVFADVAFAKKHNLMSLNSINWSRVLVQMAHHFFAYFQCVPSMDICPLPTVEVVVPTGAAGNLAAGCIAREMGLPIRLVAVVNQNDIIHRTVQKGDFSLSGITRLTLASAMDIQVPYNMERIFWLLSGSHSGLLRALMEQFDRTKNLCLPRKLHVKVSETISSLSASD-EDVIQTMQRCWEENHYLLCPHSAVAVSYHYQQLASEQPSLPRCCLAPASAAKFQDAVLQAQLVPEIPRDI--QALEHMKTRCTPLRRGDDWTQQLRNKI 469          
BLAST of Threonine synthase like 2 vs. TrEMBL
Match: A0A2I3HBL1 (Threonine synthase like 2 OS=Nomascus leucogenys OX=61853 GN=THNSL2 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.966e-52
Identity = 100/311 (32.15%), Postives = 164/311 (52.73%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH---KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    T  Q LQMTTV  EN    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    +       + V +P G  GNL+  C+  ++GLPI+L++  N ND+  + ++ G     E    + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ + V +P ++  K+   +     SD   T +TM  C++E  Y +CPH+A A++Y Y    +++    +  L  AS +KF E  + AG+    E    +  L++KE   T M   ++    L++ I
Sbjct:  161 IIVLLPKGHCTKIQELQMTTVLKENVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDMHPLPLVEVVVPTGAAGNLVAGCIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSESVSDEAIT-QTMGRCWDENQYLLCPHSAVAVNYHYQQMDRQQRSTPRCCLAPASAAKFPEAVLAAGLTP--ETPAEIVALEHKETRCTPMRRGDNWTLMLRDTI 468          
BLAST of Threonine synthase like 2 vs. TrEMBL
Match: G1P3S7 (Threonine synthase like 2 OS=Myotis lucifugus OX=59463 GN=THNSL2 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.362e-52
Identity = 104/311 (33.44%), Postives = 161/311 (51.77%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVG----DTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH---KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P    T  Q LQMTTV  EN    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    +       + V +P G  GNL   C+  +MGLPI L+   N ND+  + ++ G     ET   + +SAMD  +PYN+ R+FW+ SG D+  T+  M + ++ + V++P ++  K+ + +     SD   T +TM+ C+ E    +CPHTA A+SY Y    ++     +  L  AS +KF E  + AG+  +    I    L+ KE   T M  ++D    L++ I
Sbjct:  161 IIVLLPQGHCTKIQELQMTTVLEENVRVFGVEGNSDELDEPIKAVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCVPSLDLHPLPDVEVVVPTGAAGNLAAGCIAQKMGLPIHLVAAVNCNDIIHRTVQRGDFSLSETVKPTLASAMDIQVPYNMERIFWLLSGSDSQMTRGLMEQFERTQSVSLPEELQSKLSAAVTSESVSDEAIT-QTMARCWEENQSLLCPHTAVAVSYHYQQMLRQTPSPPRCCLAPASAAKFPEAIVAAGLSPETPTEIL--ALEGKETRCTPMRRSDDWTVMLRDTI 468          
BLAST of Threonine synthase like 2 vs. TrEMBL
Match: I3L5P4 (Threonine synthase like 2 OS=Sus scrofa OX=9823 GN=THNSL2 PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 9.655e-52
Identity = 105/311 (33.76%), Postives = 165/311 (53.05%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDT----LVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH---KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFI 912
            + VL P  R T  Q LQMTTV  EN    G  G  DE+++ I+++  D  + K  N+  LNSIN  R++ QMA H F Y Q    + DT    + V +P G  GNL   C+  +MGLPI+L++  N ND+  + ++ G     ET   + +SAMD  +PYN+ R+FW+ SG D+  T++ M + ++ ++V +P ++  K+   +      D   T +TM  C+ E  Y +CPH+A A+SY +    +++    +  L  AS +KF E  + AG+       I    L+ KE   T M + +D    L++ I
Sbjct:  161 IIVLLPKGRCTKIQELQMTTVLRENVHVFGVEGNSDELDEPIKAVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSL-DTHPLPVEVVVPTGA-GNLAAGCIAQKMGLPIRLVVAVNCNDIIHRTVQRGDFSLSETVKATLASAMDIQVPYNMERIFWLLSGSDSQMTRALMEQFERTQRVNVPKELHSKLSEAVTSESMMDEVIT-QTMLRCWEENQYLLCPHSAVAVSYHFQQTDRQQPSPPRCCLAPASAAKFPEAVLAAGLTPDTPADIL--ALERKEARCTPMRKGDDWTQMLRDTI 466          
BLAST of Threonine synthase like 2 vs. Ensembl Cavefish
Match: thnsl2 (threonine synthase-like 2 [Source:NCBI gene;Acc:641568])

HSP 1 Score: 118.242 bits (295), Expect = 1.002e-29
Identity = 80/296 (27.03%), Postives = 129/296 (43.58%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYH-KKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENED 885
            V V+FP  RIT  Q  QMTT   +N       G+ DEI+  +R +  D +  K      L S+N G ++   A                                C+V  MG+P++L+   N ND+  + ++ G     ++   + + A+D   PYN+ R+FW+ SG D    K  M +  +  ++T+P  + +++ SV+     SD    +E M  C+ E  Y +CPHTA AL + Y         +  + TAS +KF     +AG+      +  L  L+ KE     +   ED
Sbjct:  161 VVVVFPRGRITMVQEKQMTTHMEDNVHVFAADGSSDEIDVPLRKLFTDLDLVKSHG---LMSLNSGELVTNSA-------------------------------GCIVKRMGIPLRLVAVVNSNDILHRAVQNGDFSMAQSVKQTLAPAIDIQDPYNMERVFWLLSGEDGALVKDMMEQFQKTHRLTLPETLHKELCSVLSSGSVSD-EGIMEAMVRCWKENQYLVCPHTAVALCHHYRCPIPPGEKRCCIATASPAKFLSAVQKAGLSLDLPEA--LKSLETKETRCKDLERGED 419          
BLAST of Threonine synthase like 2 vs. Ensembl Cavefish
Match: THNSL1 (threonine synthase like 1 [Source:HGNC Symbol;Acc:HGNC:26160])

HSP 1 Score: 91.2781 bits (225), Expect = 4.887e-20
Identity = 71/279 (25.45%), Postives = 127/279 (45.52%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDK--------EYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEK----VGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILC-TNENDLGDKLIKTGMVE-KQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEA 795
            + V FP D ++  Q+LQMT     N  +I      D  +  I+ +  D         EY+ +  +S  NSIN  R++ Q+  H   YL + +      GD + V IP G +GN + A    +MG+PI+ I+C +N+N +    I TG  + +      S S A+D +   N+ R  +  SG D    +     +++ +   +   +++ +R  +   + S+  D L T+   +++  Y +  HTA A +      +     V+  TA   KF+   ++A
Sbjct:  270 LLVFFPEDGVSHIQKLQMTGFKEGNARSISVLSDFDFCQRSIKRMFGDSSLVGHLAVEYAAV--LSTANSINWARLLPQVVYHCSAYLDLLKSGTIGFGDQIDVCIPTGNFGNAMSAVYAKQMGIPIRKIICASNQNCVISDFISTGRYDLRGRKLIVSNSPAIDILKSSNLERFIYHASGGDGGLVRDLFQSLEKQQCFRVSENLLKTMRQEVHGGWCSE-EDCLATIHKVYSKTGYIMDTHTAVAKAVADRVHDRTCPLVLCSTAHHGKFAPAVLKA 545          
BLAST of Threonine synthase like 2 vs. Ensembl Yeast
Match: THR4 (Threonine synthase; conserved protein that catalyzes formation of threonine from O-phosphohomoserine; expression is regulated by the GCN4-mediated general amino acid control pathway [Source:SGD;Acc:S000000649])

HSP 1 Score: 135.961 bits (341), Expect = 1.018e-36
Identity = 86/280 (30.71%), Postives = 137/280 (48.93%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAE-KVGDTLVVAIPCGGWGNLLGACLVNEMGLPI-KLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFW------MYSGHDTN---FTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMS----SCFNEEHYCICPHTATALSYFYHKKEIDNVK----VVLGTASISKFSEV 783
            V++L+P  RI+P Q  QMTTV  EN   +   GT D  +D +++I  DKE++   N+  +NSIN  RI+ QM  + + + Q    K    +   +P G +G++L      +MGLPI KL + TNEND+ D+ +K+G+ E+ +    + S AMD ++  N  RL W      + +G D        +   ++    K  +   I+E           S+  +T ET+     S  N +HY + PHTA  +         DN K    + L TA  +KF++ 
Sbjct:  180 VFILYPTGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVNSINWARILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAIATNENDILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLKAGEIVNNWFQELKTNGKFQVDKSIIEGASKDFTSERVSN-EETSETIKKIYESSVNPKHYILDPHTAVGVCATERLIAKDNDKSIQYISLSTAHPAKFADA 458          
BLAST of Threonine synthase like 2 vs. Ensembl Nematostella
Match: EDO37536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFD7])

HSP 1 Score: 158.688 bits (400), Expect = 5.706e-45
Identity = 95/310 (30.65%), Postives = 157/310 (50.65%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVT-IPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKK--EIDNVKVV-LGTASISKFSEVGIEAGI-IEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFIA 915
            + VLFP       Q LQMTTV  +N     C G+ D+++  ++    D+     +N+  +NSIN GR++ Q+  + + Y ++ ++VG  +   +P G  GN+    +   MGLP+KL    N+N++  ++I  G     E+   +WS AMD  +PYN+ R++ + S  + +   S     ++   VT  P  +  K++SV+   + S    TL+TM   ++  HY +CPHTA  L     K+  E D   VV + TAS  KF E    AGI +    + + L ++  + EF   M + ED    L++ IA
Sbjct:  163 IVVLFPKGYCNTIQELQMTTVIEDNVHVFECEGSSDDLDIPVKKCLTDEGLVTKYNLGSINSINIGRLLAQIVFYFYAYFKVCKEVGSIVKFVVPTGAMGNITAGYVAYNMGLPLKLHAAVNDNNIVHRMISQGDFSLAESITKTWSPAMDIQMPYNMERMWLIASDFNYDLVSSLTQTFEEHSAVTSFPETLTNKLKSVVSSDWVSR-EATLDTMRRAWDSYHYLVCPHTAVGLRLALQKRDAEDDGTPVVCVATASPDKFPEAVKAAGIDVPPSPDILRLAEMPTRREF---MRQGEDWEKILRDKIA 468          
BLAST of Threonine synthase like 2 vs. Ensembl Medaka
Match: thnsl2 (threonine synthase like 2 [Source:NCBI gene;Acc:101172788])

HSP 1 Score: 147.132 bits (370), Expect = 4.525e-40
Identity = 84/275 (30.55%), Postives = 141/275 (51.27%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAE----KVGDTLV---VAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNV-KVVLGTASISKFSEVGIEAGI 801
            V V++P  R+TP Q   MTT   +N       G+ D+I+  +R +  D++      +  LNS+N  RI+ Q+A  V+ YL+++E    + G  L    V +P GG GN+  A +V +MG+P++L+   N ND+  + +  G     +    + ++A+D   PYN+ R+FW+  G D    K+ M +  +  + ++  +    +  V+     SD    LETM  C+ E  Y +CPHTA A+ + YH      V +  + TAS +KF     +AG+
Sbjct:  161 VVVVYPRGRVTPVQEKHMTTCLEDNVHVFAADGSSDDIDQPLRRLFADQQLVLSHGLMSLNSVNWSRILIQLAHFVYAYLELSEVERAEPGAALPELEVVVPTGGAGNIAAAFIVKQMGVPLRLVAMVNANDIVHRTVTRGDFSMADKVTQTLATAIDIQDPYNMERVFWLLLGRDGASVKAMMEEFQRSHRHSLSEEQRRLLSDVLSTGAVSD-EGILETMRRCWEENLYLLCPHTAVAVWHHYHCPHSWGVNRCYVATASPAKFQAAVQKAGL 434          
BLAST of Threonine synthase like 2 vs. Ensembl Medaka
Match: thnsl2 (threonine synthase like 2 [Source:NCBI gene;Acc:101172788])

HSP 1 Score: 112.464 bits (280), Expect = 4.500e-28
Identity = 57/192 (29.69%), Postives = 99/192 (51.56%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAE-------KVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEK 555
            V V++P  R+TP Q   MTT   +N       G+ D+I+  +R +  D++      +  LNS+N  RI+ Q+A  V+ YL+++E            L V +P GG GN+  A +V +MG+P++L+   N ND+  + +  G     +    + ++A+D   PYN+ R+FW+  G D    K+ M +  +  +
Sbjct:  161 VVVVYPRGRVTPVQEKHMTTCLEDNVHVFAADGSSDDIDQPLRRLFADQQLVLSHGLMSLNSVNWSRILIQLAHFVYAYLELSEVERAEPGAALPELEVVVPTGGAGNIAAAFIVKQMGVPLRLVAMVNANDIVHRTVTRGDFSMADKVTQTLATAIDIQDPYNMERVFWLLLGRDGASVKAMMEEFQRSHR 352          
BLAST of Threonine synthase like 2 vs. Ensembl Medaka
Match: THNSL1 (threonine synthase like 1 [Source:NCBI gene;Acc:101171618])

HSP 1 Score: 86.2705 bits (212), Expect = 2.611e-18
Identity = 76/323 (23.53%), Postives = 138/323 (42.72%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDK--------EYSKLFNISCLNSINCGRIICQMALHVFIYLQIAE----KVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILC-TNENDLGDKLIKTGMVEKQETSHF-SWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEA-GIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFIALHN 924
            V V FP + ++  Q+LQM      NG A+G     D  +  I+ +  +         EY  +  +S  NSIN  R++ Q+  H   YL +      + G+ + V IP G +GN + A    +MG+PI+ ++C +N N +   LI TG  + +      S S A+D +   N+ R  +  S  D    +   +++D  +   +   ++ ++R  +     S+ ++ L  +        Y +  HT  A +     ++     V+  TA   KF+    +A GI    E+ +   QL+  E        + D +  L+     H+
Sbjct:  378 VLVFFPEEGVSEIQKLQMLGFGEGNGRAVGVLSDFDFCQKSIKRMFGESGLVGHLAVEYGTV--LSTANSINWARLLPQVVYHSSCYLDLCRDGVIRFGEPVDVCIPTGNFGNAMSAVYAKQMGVPIRKVICASNHNRVITDLINTGEYDLRRRRLLPSHSPAIDILKSSNVERFIFHASDGDGGLVEDLFTRLDTQKHFRVAAPLLGRMRQEVQAGCCSE-DECLSAVRRVHARTGYLMDTHTGVAKAVADRLQDGSCPVVLCSTAHYGKFAPAVFKALGIQNPPEDPV--EQLRQLERTAPRPGGHRDMLRGLRGGSGAHS 695          
BLAST of Threonine synthase like 2 vs. Planmine SMEST
Match: SMESG000081544.1 (SMESG000081544.1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 308/308 (100.00%), Postives = 308/308 (100.00%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFIALHN 924
            VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFIALHN
Sbjct:  167 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFIALHN 474          
BLAST of Threonine synthase like 2 vs. Planmine SMEST
Match: SMESG000081526.1 (SMESG000081526.1)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 245/308 (79.55%), Postives = 285/308 (92.53%), Query Frame = 1
Query:    1 VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKEYSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWGNLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAMDTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVIIDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVLGTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFLKNFIALHN 924
            VYVLFPNDRITPTQRLQMTT N++NGFAI C GT DE++D IR INDDKE+SKLFNISCLNSINCGRIICQMALH+FIYLQ+AEK+GDT+V+AIPCGG GNL+ ACL NEMG+PI+LI+CTNENDLG+KLIKTG++EK+ETSH+SWSSAMDT +PYN+ RL W++S HDTNFTKSTMSKI+QGEKVTIP KIMEKIRSVIIDSYA++ ++TL+T+S+CFNEEHYCICPHTATALSYFYHK E+ N+  +LGTASI KFSE GIEAG+ +KFENSIFLTQLQ+K+E +TV+NENEDPVTFLKNFIALHN
Sbjct:  167 VYVLFPNDRITPTQRLQMTTANTDNGFAIQCSGTPDELDDVIRFINDDKEFSKLFNISCLNSINCGRIICQMALHIFIYLQLAEKIGDTVVIAIPCGGMGNLISACLANEMGIPIELIVCTNENDLGNKLIKTGIIEKKETSHYSWSSAMDTNMPYNLVRLLWIFSDHDTNFTKSTMSKIEQGEKVTIPLKIMEKIRSVIIDSYAANDDETLKTISTCFNEEHYCICPHTATALSYFYHKNEVGNINAILGTASIEKFSEAGIEAGLKDKFENSIFLTQLQSKKEDFTVLNENEDPVTFLKNFIALHN 474          
The following BLAST results are available for this feature:
BLAST of Threonine synthase like 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THNSL21.576e-5332.05threonine synthase like 2 [Source:HGNC Symbol;Acc:... [more]
THNSL24.790e-3834.15threonine synthase like 2 [Source:HGNC Symbol;Acc:... [more]
THNSL23.134e-3634.50threonine synthase like 2 [Source:HGNC Symbol;Acc:... [more]
THNSL11.399e-2425.27threonine synthase like 1 [Source:HGNC Symbol;Acc:... [more]
THNSL11.399e-2425.27threonine synthase like 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thnsl24.665e-4832.99threonine synthase-like 2 [Source:NCBI gene;Acc:64... [more]
thnsl28.185e-3533.33threonine synthase-like 2 [Source:NCBI gene;Acc:64... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
krtcap31.296e-4532.16keratinocyte associated protein 3 [Source:Xenbase;... [more]
slc49a43.724e-2425.48solute carrier family 49 member 4 [Source:Xenbase;... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Thnsl22.317e-5131.60threonine synthase-like 2 (bacterial) [Source:MGI ... [more]
Thnsl22.317e-5131.60threonine synthase-like 2 (bacterial) [Source:MGI ... [more]
Thnsl11.469e-2325.18threonine synthase-like 1 (bacterial) [Source:MGI ... [more]
Thnsl26.865e-1424.18threonine synthase-like 2 (bacterial) [Source:MGI ... [more]
back to top
BLAST of Threonine synthase like 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86YJ6|THNS2_HUMAN7.568e-5332.05Threonine synthase-like 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q5M7T9|THNS2_RAT1.391e-5232.37Threonine synthase-like 2 OS=Rattus norvegicus OX=... [more]
sp|Q5RFE6|THNS2_PONAB4.110e-5232.05Threonine synthase-like 2 OS=Pongo abelii OX=9601 ... [more]
sp|Q80W22|THNS2_MOUSE1.621e-5031.60Threonine synthase-like 2 OS=Mus musculus OX=10090... [more]
sp|Q2YDP8|THNS2_DANRE1.082e-4732.76Threonine synthase-like 2 OS=Danio rerio OX=7955 G... [more]
back to top
BLAST of Threonine synthase like 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A485PR696.642e-5434.08Threonine synthase-like 2-like OS=Lynx pardinus OX... [more]
G3W9E23.999e-5332.80Threonine synthase like 2 OS=Sarcophilus harrisii ... [more]
A0A2I3HBL14.966e-5232.15Threonine synthase like 2 OS=Nomascus leucogenys O... [more]
G1P3S75.362e-5233.44Threonine synthase like 2 OS=Myotis lucifugus OX=5... [more]
I3L5P49.655e-5233.76Threonine synthase like 2 OS=Sus scrofa OX=9823 GN... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thnsl21.002e-2927.03threonine synthase-like 2 [Source:NCBI gene;Acc:64... [more]
THNSL14.887e-2025.45threonine synthase like 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
THR41.018e-3630.71Threonine synthase; conserved protein that catalyz... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO375365.706e-4530.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Threonine synthase like 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
thnsl24.525e-4030.55threonine synthase like 2 [Source:NCBI gene;Acc:10... [more]
thnsl24.500e-2829.69threonine synthase like 2 [Source:NCBI gene;Acc:10... [more]
THNSL12.611e-1823.53threonine synthase like 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Threonine synthase like 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000081544.10.000e+0100.00SMESG000081544.1[more]
SMESG000081526.10.000e+079.55SMESG000081526.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017384 ID=SMED30017384|Name=Threonine synthase like 2|organism=Schmidtea mediterranea sexual|type=transcript|length=958bp
GTCTATGTTTTATTTCCAAATGATAGAATTACACCAACTCAAAGATTACA
AATGACTACAGTAAATAGCGAGAACGGCTTTGCAATTGGATGCCCTGGTA
CTTGCGATGAAATAGAAGACTATATTCGATCTATTAATGATGATAAGGAA
TATAGCAAATTATTTAACATCTCATGTCTCAATTCTATCAATTGCGGCCG
AATTATATGTCAAATGGCTCTACATGTTTTTATTTACTTACAAATAGCTG
AAAAAGTCGGCGATACGTTGGTGGTTGCCATACCATGTGGAGGATGGGGA
AATTTATTAGGTGCTTGTTTAGTGAATGAAATGGGCCTGCCAATTAAACT
TATACTTTGTACAAACGAGAATGATTTAGGAGATAAACTTATTAAAACTG
GAATGGTAGAAAAGCAAGAGACTTCTCATTTCTCTTGGTCATCTGCAATG
GATACTATTTTACCGTACAATATTGCGAGATTATTCTGGATGTATTCTGG
CCACGATACGAATTTCACTAAATCAACAATGAGCAAAATAGATCAAGGAG
AAAAAGTAACAATTCCACCTAAGATTATGGAAAAGATTCGTTCGGTGATA
ATTGATTCATACGCGTCTGACTGTAATGACACATTGGAAACAATGTCTTC
TTGTTTCAATGAAGAGCATTACTGTATTTGTCCTCATACTGCAACAGCTC
TTTCATACTTTTACCACAAAAAAGAGATTGATAATGTCAAAGTAGTTCTA
GGAACTGCAAGTATTTCAAAATTTAGCGAAGTCGGAATTGAAGCTGGCAT
AATAGAAAAATTTGAAAATAGCATCTTTTTAACTCAACTTCAAAATAAAG
AGGAATTTTATACTGTGATGAATGAAAATGAAGATCCAGTAACTTTTTTG
AAAAATTTTATAGCTTTGCACAATTGAACTGATAATTACTAAATTTGATA
ACACCAGA
back to top

protein sequence of SMED30017384-orf-1

>SMED30017384-orf-1 ID=SMED30017384-orf-1|Name=SMED30017384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
VYVLFPNDRITPTQRLQMTTVNSENGFAIGCPGTCDEIEDYIRSINDDKE
YSKLFNISCLNSINCGRIICQMALHVFIYLQIAEKVGDTLVVAIPCGGWG
NLLGACLVNEMGLPIKLILCTNENDLGDKLIKTGMVEKQETSHFSWSSAM
DTILPYNIARLFWMYSGHDTNFTKSTMSKIDQGEKVTIPPKIMEKIRSVI
IDSYASDCNDTLETMSSCFNEEHYCICPHTATALSYFYHKKEIDNVKVVL
GTASISKFSEVGIEAGIIEKFENSIFLTQLQNKEEFYTVMNENEDPVTFL
KNFIALHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036052Trypto_synt_PLP_dependent
IPR001926PLP-dep
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005125cytokine activity
GO:0016829lyase activity
GO:0030170pyridoxal phosphate binding
GO:0070905serine binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0009071serine family amino acid catabolic process
GO:0016311dephosphorylation
GO:00463602-oxobutyrate biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036052Tryptophan synthase beta subunit-like PLP-dependent enzymeGENE3DG3DSA:3.40.50.1100coord: 41..267
e-value: 1.9E-55
score: 189.7
IPR036052Tryptophan synthase beta subunit-like PLP-dependent enzymeSUPERFAMILYSSF53686Tryptophan synthase beta subunit-like PLP-dependent enzymescoord: 1..295
NoneNo IPR availablePANTHERPTHR42690FAMILY NOT NAMEDcoord: 1..305