Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30017383
Length (bp)1713
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30017383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30017383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30017383SMESG000072546.1 dd_Smed_v4_8022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017383SMESG000072546.1 dd_Smed_v6_8022_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: HCK (HCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4840])

HSP 1 Score: 255.758 bits (652), Expect = 9.585e-78
Identity = 158/452 (34.96%), Postives = 254/452 (56.19%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G   K ++P      +    P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  +   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   58 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPC---MSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 491          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: HCK (HCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4840])

HSP 1 Score: 255.758 bits (652), Expect = 9.585e-78
Identity = 158/452 (34.96%), Postives = 254/452 (56.19%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G   K ++P      +    P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  +   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   58 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPC---MSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 491          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: HCK (HCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4840])

HSP 1 Score: 255.758 bits (652), Expect = 9.585e-78
Identity = 158/452 (34.96%), Postives = 254/452 (56.19%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G   K ++P      +    P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  +   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   58 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPC---MSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 491          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: HCK (HCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4840])

HSP 1 Score: 255.758 bits (652), Expect = 1.106e-77
Identity = 158/452 (34.96%), Postives = 254/452 (56.19%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G   K ++P      +    P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  +   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   57 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPC---MSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 490          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: HCK (HCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4840])

HSP 1 Score: 255.758 bits (652), Expect = 1.626e-77
Identity = 158/452 (34.96%), Postives = 254/452 (56.19%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G   K ++P      +    P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  +   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   78 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPC---MSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 511          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 222.246 bits (565), Expect = 1.782e-65
Identity = 140/471 (29.72%), Postives = 251/471 (53.29%), Query Frame = 2
Query:  212 IAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEG--WWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMI----IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEY 1579
            +A ++YDA    D+SF++++++ ++ +    W+          G +PSNYV ++    +S+E   W+   + R +AEK L++    +  +L+R S+ ++ D  +S+++ D+      VKH+ IR +      I       F+    +I H+++   G   + +  P     AP   +        + +  ++++ +IG   +G V    W  +  V  K L   ++    F+ E  +  KLR+ +++ +  +CT  +  PI+++ E +Q  +L  FL+  RG +  +  + E  A+++ GMAYLE    +H +L + NIL++  +SVKI+DFGL R++ ++ + E         KW APEAA  + FT+KSDVWSFGI+L EI+T+ + PYPG+   EV+Q+V AGYRM  P        CP  +Y++M +CW + P+ RPTF  ++ +++ L           N ++SEY
Sbjct:   63 VALFQYDARTDDDLSFKKDDILEILNDTQGDWWFARHKATGRTGYIPSNYVARE----KSIESQPWYFGKMRRIDAEKCLLHTLNEHGAFLVRDSESRQHDLSLSVRENDS------VKHYRIRQLDHGGYFIARR--RPFATLHDLIAHYQREADGL-CVNLGAPCAKSEAPQTTTFTYDDQWEVDRRSVRLIRQIGAGQFGEVWEGRWNVNVPVAVKKLKAGTADPTDFLAEAQIMKKLRHPKLLSLYAVCT--RDEPILIVTELMQE-NLLTFLQR-RGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENEYEARTGARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCP------AGCPVTLYDIMQQCWRSDPDKRPTFETLQWKLEDLF----------NLDSSEY 500          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 215.698 bits (548), Expect = 2.576e-63
Identity = 140/467 (29.98%), Postives = 245/467 (52.46%), Query Frame = 2
Query:  191 SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEG--WWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKK-NLPINNPFVNVRAPPI-HSV--NMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMS----VKISDFGL-RRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIY-NLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + ER  ++A Y YD+    D+SFQ+ + M ++   +  W+ V   +    G VP N+V KQ    Q++E   W+   I R  AE+L+++  +   T+LIR  +   R++ ++++  D+      VKH+ I+ + + ++  +     TF     ++ ++     G    L    P +    P + H    N  I +  + +  ++G  ++G V    W     V  K++   +   + F+ E  +  +  +  +V++  +CT  +  P  +I EY+ NGSL  +L++  G+ L +  + +  A+I+ GM YLE + LVH +L + N+LV   +S    VK++DFGL R++++E + +         KW APEAAT   FT KSDVWS+GI+L+EI+T  + PYPG+   EV+++V  GYRM  P+       CP +IY  ++++CWD  P+ RPTF  + +  D   V
Sbjct:   14 AQERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQ----QTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRL-DHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCT--REEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPR------GCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFV 466          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 215.698 bits (548), Expect = 1.064e-62
Identity = 140/467 (29.98%), Postives = 245/467 (52.46%), Query Frame = 2
Query:  191 SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEG--WWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKK-NLPINNPFVNVRAPPI-HSV--NMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMS----VKISDFGL-RRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIY-NLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + ER  ++A Y YD+    D+SFQ+ + M ++   +  W+ V   +    G VP N+V KQ    Q++E   W+   I R  AE+L+++  +   T+LIR  +   R++ ++++  D+      VKH+ I+ + + ++  +     TF     ++ ++     G    L    P +    P + H    N  I +  + +  ++G  ++G V    W     V  K++   +   + F+ E  +  +  +  +V++  +CT  +  P  +I EY+ NGSL  +L++  G+ L +  + +  A+I+ GM YLE + LVH +L + N+LV   +S    VK++DFGL R++++E + +         KW APEAAT   FT KSDVWS+GI+L+EI+T  + PYPG+   EV+++V  GYRM  P+       CP +IY  ++++CWD  P+ RPTF  + +  D   V
Sbjct:   70 AQERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQ----QTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRL-DHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCT--REEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPR------GCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFV 522          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 215.698 bits (548), Expect = 1.064e-62
Identity = 140/467 (29.98%), Postives = 245/467 (52.46%), Query Frame = 2
Query:  191 SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEG--WWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKK-NLPINNPFVNVRAPPI-HSV--NMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMS----VKISDFGL-RRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIY-NLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + ER  ++A Y YD+    D+SFQ+ + M ++   +  W+ V   +    G VP N+V KQ    Q++E   W+   I R  AE+L+++  +   T+LIR  +   R++ ++++  D+      VKH+ I+ + + ++  +     TF     ++ ++     G    L    P +    P + H    N  I +  + +  ++G  ++G V    W     V  K++   +   + F+ E  +  +  +  +V++  +CT  +  P  +I EY+ NGSL  +L++  G+ L +  + +  A+I+ GM YLE + LVH +L + N+LV   +S    VK++DFGL R++++E + +         KW APEAAT   FT KSDVWS+GI+L+EI+T  + PYPG+   EV+++V  GYRM  P+       CP +IY  ++++CWD  P+ RPTF  + +  D   V
Sbjct:   70 AQERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQ----QTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRL-DHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCT--REEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPR------GCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFV 522          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 215.312 bits (547), Expect = 1.285e-62
Identity = 140/467 (29.98%), Postives = 245/467 (52.46%), Query Frame = 2
Query:  191 SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEG--WWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKK-NLPINNPFVNVRAPPI-HSV--NMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMS----VKISDFGL-RRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIY-NLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + ER  ++A Y YD+    D+SFQ+ + M ++   +  W+ V   +    G VP N+V KQ    Q++E   W+   I R  AE+L+++  +   T+LIR  +   R++ ++++  D+      VKH+ I+ + + ++  +     TF     ++ ++     G    L    P +    P + H    N  I +  + +  ++G  ++G V    W     V  K++   +   + F+ E  +  +  +  +V++  +CT  +  P  +I EY+ NGSL  +L++  G+ L +  + +  A+I+ GM YLE + LVH +L + N+LV   +S    VK++DFGL R++++E + +         KW APEAAT   FT KSDVWS+GI+L+EI+T  + PYPG+   EV+++V  GYRM  P+       CP +IY  ++++CWD  P+ RPTF  + +  D   V
Sbjct:   74 AQERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQ----QTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRL-DHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCT--REEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPR------GCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFV 526          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100508)

HSP 1 Score: 232.261 bits (591), Expect = 1.119e-68
Identity = 140/457 (30.63%), Postives = 244/457 (53.39%), Query Frame = 2
Query:  200 RMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRD-YIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG-----KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + +V+A Y Y +    D+SF + + M V+ + +  W+ V+ +  +  GL+P N+V ++     + E W+   + R EA+KLL+  +    T+L+RPS+   + Y +S+K  ++  + Y+VKH+ I+ +      I  N   TF     ++  + K+ +G      +  P   P +    P +     I + E IQ++ ++G+ ++G V    W  S  V  K+L   +     F+ E  +  K R+ R+V +  +C++    PI ++ EY+  GSL DFL+   G  L+  D+     +++ GM YLE K L+H +L + N+L+  +   KI DFGL R+I D++   ++      KW APEA     F+ KSDVWS+GI+L E+ T+ + PYPG+ + EV++ +  G+RM  P  ++     P  IY L+++CWD  PE RPTF  + +  ++  V
Sbjct:   97 KRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSV--NSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWED-GRGYHVKHYRIKPLDNGGYYIATN--QTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSE-IQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHY----FPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100505)

HSP 1 Score: 232.261 bits (591), Expect = 1.119e-68
Identity = 140/457 (30.63%), Postives = 244/457 (53.39%), Query Frame = 2
Query:  200 RMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRD-YIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG-----KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + +V+A Y Y +    D+SF + + M V+ + +  W+ V+ +  +  GL+P N+V ++     + E W+   + R EA+KLL+  +    T+L+RPS+   + Y +S+K  ++  + Y+VKH+ I+ +      I  N   TF     ++  + K+ +G      +  P   P +    P +     I + E IQ++ ++G+ ++G V    W  S  V  K+L   +     F+ E  +  K R+ R+V +  +C++    PI ++ EY+  GSL DFL+   G  L+  D+     +++ GM YLE K L+H +L + N+L+  +   KI DFGL R+I D++   ++      KW APEA     F+ KSDVWS+GI+L E+ T+ + PYPG+ + EV++ +  G+RM  P  ++     P  IY L+++CWD  PE RPTF  + +  ++  V
Sbjct:   97 KRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSV--NSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWED-GRGYHVKHYRIKPLDNGGYYIATN--QTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSE-IQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHY----FPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100504)

HSP 1 Score: 232.261 bits (591), Expect = 1.119e-68
Identity = 140/457 (30.63%), Postives = 244/457 (53.39%), Query Frame = 2
Query:  200 RMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRD-YIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG-----KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + +V+A Y Y +    D+SF + + M V+ + +  W+ V+ +  +  GL+P N+V ++     + E W+   + R EA+KLL+  +    T+L+RPS+   + Y +S+K  ++  + Y+VKH+ I+ +      I  N   TF     ++  + K+ +G      +  P   P +    P +     I + E IQ++ ++G+ ++G V    W  S  V  K+L   +     F+ E  +  K R+ R+V +  +C++    PI ++ EY+  GSL DFL+   G  L+  D+     +++ GM YLE K L+H +L + N+L+  +   KI DFGL R+I D++   ++      KW APEA     F+ KSDVWS+GI+L E+ T+ + PYPG+ + EV++ +  G+RM  P  ++     P  IY L+++CWD  PE RPTF  + +  ++  V
Sbjct:   97 KRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSV--NSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWED-GRGYHVKHYRIKPLDNGGYYIATN--QTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSE-IQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHY----FPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0304990)

HSP 1 Score: 232.261 bits (591), Expect = 1.119e-68
Identity = 140/457 (30.63%), Postives = 244/457 (53.39%), Query Frame = 2
Query:  200 RMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRD-YIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG-----KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + +V+A Y Y +    D+SF + + M V+ + +  W+ V+ +  +  GL+P N+V ++     + E W+   + R EA+KLL+  +    T+L+RPS+   + Y +S+K  ++  + Y+VKH+ I+ +      I  N   TF     ++  + K+ +G      +  P   P +    P +     I + E IQ++ ++G+ ++G V    W  S  V  K+L   +     F+ E  +  K R+ R+V +  +C++    PI ++ EY+  GSL DFL+   G  L+  D+     +++ GM YLE K L+H +L + N+L+  +   KI DFGL R+I D++   ++      KW APEA     F+ KSDVWS+GI+L E+ T+ + PYPG+ + EV++ +  G+RM  P  ++     P  IY L+++CWD  PE RPTF  + +  ++  V
Sbjct:   97 KRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSV--NSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWED-GRGYHVKHYRIKPLDNGGYYIATN--QTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSE-IQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHY----FPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0304989)

HSP 1 Score: 232.261 bits (591), Expect = 1.119e-68
Identity = 140/457 (30.63%), Postives = 244/457 (53.39%), Query Frame = 2
Query:  200 RMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRD-YIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG-----KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + +V+A Y Y +    D+SF + + M V+ + +  W+ V+ +  +  GL+P N+V ++     + E W+   + R EA+KLL+  +    T+L+RPS+   + Y +S+K  ++  + Y+VKH+ I+ +      I  N   TF     ++  + K+ +G      +  P   P +    P +     I + E IQ++ ++G+ ++G V    W  S  V  K+L   +     F+ E  +  K R+ R+V +  +C++    PI ++ EY+  GSL DFL+   G  L+  D+     +++ GM YLE K L+H +L + N+L+  +   KI DFGL R+I D++   ++      KW APEA     F+ KSDVWS+GI+L E+ T+ + PYPG+ + EV++ +  G+RM  P  ++     P  IY L+++CWD  PE RPTF  + +  ++  V
Sbjct:   97 KRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSV--NSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWED-GRGYHVKHYRIKPLDNGGYYIATN--QTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSE-IQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHY----FPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: lyn (LYN proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040912-7])

HSP 1 Score: 267.7 bits (683), Expect = 2.294e-82
Identity = 166/449 (36.97%), Postives = 251/449 (55.90%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            IV+A Y Y+AI + D+ F++ E + +++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +YLIR S+  K  Y +S++  D   ++  VKH+ IR +   N   Y +   TFSD   +I+H+ K   G   K +     P       P       I K+ I++V ++G   +G V  A +  S  V  K+L   +   + F++E  L   L++ R+V +  + T  K  PI +I EY+ NGSL DFLKS  G+K+ L  + +  A+I+EGMAY+E+K  +H +L++ N+LV   +  KI+DFGL R+I D+Q    E      KW APEA     FT KSD+WSFG++L+EI+T+ K PYPG+  +EVM  V  GYRM  P+       CP E+Y +M  CW NKPE RPTF  I++ +D
Sbjct:   65 IVVALYPYEAIHADDLGFKKGEKLKIIEEHGE-WWKARSLTTRKEGFIPSNYVAEAD--TMETEEWFYKDITRKDAERQLLAPANKPGSYLIRESETSKGSYSLSIRDVDAQGQDV-VKHYKIRSLD--NGGYYISPKITFSDISSMIKHYHKQSDGLCRKLDKACEKPKAQ---KPWDKDAWEISKDSIKMVKKLGAGQFGEVWMAFYNNSTKVAVKTLKPGTMSVEAFLEEANLMKTLQHDRLVRLYAVVT--KTEPIYIITEYMANGSLLDFLKSQAGSKIQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSEMLLCKIADFGLARVIEDDQYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITYGKIPYPGMSNSEVMSSVQRGYRMPRPE------NCPVELYEIMTTCWKNKPEDRPTFDYIQSVLD 496          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: blk (BLK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040724-106])

HSP 1 Score: 239.965 bits (611), Expect = 3.882e-72
Identity = 147/458 (32.10%), Postives = 250/458 (54.59%), Query Frame = 2
Query:  185 NYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNV-KHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAP--PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            N + +  +VIAQY +      D+ F++ + + ++KE  ++W     +     G +PS YV +       VE W+   + R + E+LL+ P     ++L+R S+  +    SL  +D+  ++ +V KH+ IR +   N   Y +  ++FS    +++++ +   G     + NP  +  AP  P       I +E +++V ++G   +G V    +  +  V  K+L   + + + F+ E  L  +L+++R+V++  + T     PI ++ EY+ NGSL DFLK+  G KL L  + +  A+I+EGMAY+ERK  +H +L++ NILV   +  KI+DFGL R+I+ +   +E      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +   YRM  P        CP E+Y++M +CW  KPE RPTF  +++ ++   +
Sbjct:   35 NNNQDEDVVIAQYDFQPASENDLQFKKGDRLRIIKENGEWWL-AKSLVTGYEGFIPSTYVAR--AQTLQVERWFFKDMNRRDTERLLLAPGNKPGSFLVRESETTKG-AFSLSIRDSTPEQGDVVKHYKIRALD--NGGYYISPSTSFSSLQELVKYYSRTADGLCQR-LGNPCKST-APQRPWAQDEWEIPRETLKLVKKLGAGQFGEVWMGFYKNNQKVAIKTLKEGTMEPEAFLQEANLMKQLQHERLVKLHAVVT---REPIYIVTEYMANGSLLDFLKTDDGHKLKLSKLIDMTAQIAEGMAYIERKNYIHRDLRAANILVSETLHCKIADFGLARIIETEYTAQEGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTYGRVPYPGMTNPEVIRNLDRNYRMPCPD------ACPGELYDIMTKCWMEKPEDRPTFEYLQDTLNDFFI 475          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: blk (BLK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040724-106])

HSP 1 Score: 239.965 bits (611), Expect = 3.882e-72
Identity = 147/458 (32.10%), Postives = 250/458 (54.59%), Query Frame = 2
Query:  185 NYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNV-KHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAP--PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            N + +  +VIAQY +      D+ F++ + + ++KE  ++W     +     G +PS YV +       VE W+   + R + E+LL+ P     ++L+R S+  +    SL  +D+  ++ +V KH+ IR +   N   Y +  ++FS    +++++ +   G     + NP  +  AP  P       I +E +++V ++G   +G V    +  +  V  K+L   + + + F+ E  L  +L+++R+V++  + T     PI ++ EY+ NGSL DFLK+  G KL L  + +  A+I+EGMAY+ERK  +H +L++ NILV   +  KI+DFGL R+I+ +   +E      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +   YRM  P        CP E+Y++M +CW  KPE RPTF  +++ ++   +
Sbjct:   35 NNNQDEDVVIAQYDFQPASENDLQFKKGDRLRIIKENGEWWL-AKSLVTGYEGFIPSTYVAR--AQTLQVERWFFKDMNRRDTERLLLAPGNKPGSFLVRESETTKG-AFSLSIRDSTPEQGDVVKHYKIRALD--NGGYYISPSTSFSSLQELVKYYSRTADGLCQR-LGNPCKST-APQRPWAQDEWEIPRETLKLVKKLGAGQFGEVWMGFYKNNQKVAIKTLKEGTMEPEAFLQEANLMKQLQHERLVKLHAVVT---REPIYIVTEYMANGSLLDFLKTDDGHKLKLSKLIDMTAQIAEGMAYIERKNYIHRDLRAANILVSETLHCKIADFGLARIIETEYTAQEGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTYGRVPYPGMTNPEVIRNLDRNYRMPCPD------ACPGELYDIMTKCWMEKPEDRPTFEYLQDTLNDFFI 475          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: blk (BLK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040724-106])

HSP 1 Score: 239.965 bits (611), Expect = 3.882e-72
Identity = 147/458 (32.10%), Postives = 250/458 (54.59%), Query Frame = 2
Query:  185 NYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNV-KHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAP--PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            N + +  +VIAQY +      D+ F++ + + ++KE  ++W     +     G +PS YV +       VE W+   + R + E+LL+ P     ++L+R S+  +    SL  +D+  ++ +V KH+ IR +   N   Y +  ++FS    +++++ +   G     + NP  +  AP  P       I +E +++V ++G   +G V    +  +  V  K+L   + + + F+ E  L  +L+++R+V++  + T     PI ++ EY+ NGSL DFLK+  G KL L  + +  A+I+EGMAY+ERK  +H +L++ NILV   +  KI+DFGL R+I+ +   +E      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +   YRM  P        CP E+Y++M +CW  KPE RPTF  +++ ++   +
Sbjct:   35 NNNQDEDVVIAQYDFQPASENDLQFKKGDRLRIIKENGEWWL-AKSLVTGYEGFIPSTYVAR--AQTLQVERWFFKDMNRRDTERLLLAPGNKPGSFLVRESETTKG-AFSLSIRDSTPEQGDVVKHYKIRALD--NGGYYISPSTSFSSLQELVKYYSRTADGLCQR-LGNPCKST-APQRPWAQDEWEIPRETLKLVKKLGAGQFGEVWMGFYKNNQKVAIKTLKEGTMEPEAFLQEANLMKQLQHERLVKLHAVVT---REPIYIVTEYMANGSLLDFLKTDDGHKLKLSKLIDMTAQIAEGMAYIERKNYIHRDLRAANILVSETLHCKIADFGLARIIETEYTAQEGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTYGRVPYPGMTNPEVIRNLDRNYRMPCPD------ACPGELYDIMTKCWMEKPEDRPTFEYLQDTLNDFFI 475          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: fyna (FYN proto-oncogene, Src family tyrosine kinase a [Source:NCBI gene;Acc:373872])

HSP 1 Score: 239.195 bits (609), Expect = 2.957e-71
Identity = 145/446 (32.51%), Postives = 234/446 (52.47%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMI-IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIK 1507
            + +A Y Y+A    D+SF++ E   ++   +  W+E   +     G +PSNYV   D      E W+   + R +AE+ L++      T+LIR S+  K  Y +S++  D  TK  +VKH+ IR  K  N   Y    + F     ++ H+     G   +  +P +     +    + + ++  I +E +Q++  +G   +G V    W  +  V  K+L   +   + F++E  +  KLR+ ++V++  + +E    PI ++ EY+  GSL DFLK   G  L L ++ +  A+++ GMAY+ER   +H +L+S NILV   +  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LM++CW   PE RPTF  ++
Sbjct:   86 LFVALYDYEARSEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSI--QAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDE-TKGDHVKHYKIR--KLDNGGYYITTRAQFETLQQLVHHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSE---EPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQ------DCPSSLHELMLQCWKRDPEERPTFEYLQ 517          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: pdcd2l (programmed cell death 2-like [Source:Xenbase;Acc:XB-GENE-5805051])

HSP 1 Score: 244.588 bits (623), Expect = 1.593e-73
Identity = 158/469 (33.69%), Postives = 250/469 (53.30%), Query Frame = 2
Query:  146 KLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            +LH  S      P    +  IVIA Y Y  I   D++F++ E + V++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P      +LIR S+  K  Y +S++  D  T +  +KH+ IR +   N   Y +   TF+    +I+H++K   G   K + P  +P       P       I +E I++V ++G   +G V    +  S  V  K+L   +   Q F++E  L   L++ ++V +  + +  K  PI +I E++  GSL DFLKS  GAK+ L  + +  A+I+EGMAY+E+K  +H +L++ N+LV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFG++L+EI+T  K PYPG+  ++VM  +  GYRM   +       CP E+Y++M  CW  K E RPTF  +++ +D
Sbjct:   37 RLHIYSEYQLVPPKIEEQGNIVIALYPYQGIHQDDLTFKKGEKLKVIEEHGE-WWKAKSLSSKKEGFIPSNYVARVNT--LETEEWFFKDITRKDAERQLLAPGNNPGAFLIRESETSKGSYSLSIRDYDPKTGDV-IKHYKIRTLD--NGGYYISPRITFTSICDMIQHYQKQADGLCRKLDKPCYSPKPQ---KPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGFYNNSTKVAVKTLKPGTMSVQAFMEEANLMKSLQHDKLVRLYAVVS--KEEPIYIITEFMAKGSLLDFLKSDEGAKVILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGMSNSDVMTALQRGYRMPRME------NCPVELYDIMKECWKEKAEERPTFDYLQSVLD 488          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: yes1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:493548])

HSP 1 Score: 241.891 bits (616), Expect = 4.961e-73
Identity = 149/446 (33.41%), Postives = 239/446 (53.59%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            + +A Y Y+A  + D+SF++ E   ++   +  W+E   +     G +PSNYV   D S Q+ E ++  + R +AE+LL+NP     T+L+R S+  K  Y +S++  D    + NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L    P V  +   +      I +E +++  ++G+  +G V    W  +  V  K+L   +   + F+ E  +  KLR+ ++V +  + +E    PI ++ EY+  GSL DFLK   G  L L  + +  A+I++GMAY+ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LM  CW   P+ RPTF  I++ ++
Sbjct:   10 VFVALYDYEARTTEDLSFRKGERFQIINNTEGDWWEARSIATGKTGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLNPGNQRGTFLVRESETTKGAYSLSIRDWDEVRGD-NVKHYKIR--KLDNGGYYITTRAQFESLQKLVKHYSEHADGLCYRLTTVCPTVKPQTQGLSKDAWEIPRESLRLDVKLGQGCFGEVWIGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSE---EPIYIVTEYMTKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQ------GCPESLHELMKLCWKKDPDERPTFEYIQSFLE 442          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: yes1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:493548])

HSP 1 Score: 241.891 bits (616), Expect = 5.565e-73
Identity = 149/446 (33.41%), Postives = 239/446 (53.59%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            + +A Y Y+A  + D+SF++ E   ++   +  W+E   +     G +PSNYV   D S Q+ E ++  + R +AE+LL+NP     T+L+R S+  K  Y +S++  D    + NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L    P V  +   +      I +E +++  ++G+  +G V    W  +  V  K+L   +   + F+ E  +  KLR+ ++V +  + +E    PI ++ EY+  GSL DFLK   G  L L  + +  A+I++GMAY+ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LM  CW   P+ RPTF  I++ ++
Sbjct:   16 VFVALYDYEARTTEDLSFRKGERFQIINNTEGDWWEARSIATGKTGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLNPGNQRGTFLVRESETTKGAYSLSIRDWDEVRGD-NVKHYKIR--KLDNGGYYITTRAQFESLQKLVKHYSEHADGLCYRLTTVCPTVKPQTQGLSKDAWEIPRESLRLDVKLGQGCFGEVWIGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSE---EPIYIVTEYMTKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQ------GCPESLHELMKLCWKKDPDERPTFEYIQSFLE 448          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: yes1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:493548])

HSP 1 Score: 241.891 bits (616), Expect = 6.528e-73
Identity = 149/446 (33.41%), Postives = 239/446 (53.59%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            + +A Y Y+A  + D+SF++ E   ++   +  W+E   +     G +PSNYV   D S Q+ E ++  + R +AE+LL+NP     T+L+R S+  K  Y +S++  D    + NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L    P V  +   +      I +E +++  ++G+  +G V    W  +  V  K+L   +   + F+ E  +  KLR+ ++V +  + +E    PI ++ EY+  GSL DFLK   G  L L  + +  A+I++GMAY+ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LM  CW   P+ RPTF  I++ ++
Sbjct:   25 VFVALYDYEARTTEDLSFRKGERFQIINNTEGDWWEARSIATGKTGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLNPGNQRGTFLVRESETTKGAYSLSIRDWDEVRGD-NVKHYKIR--KLDNGGYYITTRAQFESLQKLVKHYSEHADGLCYRLTTVCPTVKPQTQGLSKDAWEIPRESLRLDVKLGQGCFGEVWIGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSE---EPIYIVTEYMTKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQ------GCPESLHELMKLCWKKDPDERPTFEYIQSFLE 457          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: yes1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:493548])

HSP 1 Score: 241.891 bits (616), Expect = 6.798e-73
Identity = 149/446 (33.41%), Postives = 239/446 (53.59%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            + +A Y Y+A  + D+SF++ E   ++   +  W+E   +     G +PSNYV   D S Q+ E ++  + R +AE+LL+NP     T+L+R S+  K  Y +S++  D    + NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L    P V  +   +      I +E +++  ++G+  +G V    W  +  V  K+L   +   + F+ E  +  KLR+ ++V +  + +E    PI ++ EY+  GSL DFLK   G  L L  + +  A+I++GMAY+ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LM  CW   P+ RPTF  I++ ++
Sbjct:   16 VFVALYDYEARTTEDLSFRKGERFQIINNTEGDWWEARSIATGKTGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLNPGNQRGTFLVRESETTKGAYSLSIRDWDEVRGD-NVKHYKIR--KLDNGGYYITTRAQFESLQKLVKHYSEHADGLCYRLTTVCPTVKPQTQGLSKDAWEIPRESLRLDVKLGQGCFGEVWIGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSE---EPIYIVTEYMTKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQ------GCPESLHELMKLCWKKDPDERPTFEYIQSFLE 448          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Hck (hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI:96052])

HSP 1 Score: 257.299 bits (656), Expect = 1.706e-78
Identity = 166/476 (34.87%), Postives = 261/476 (54.83%), Query Frame = 2
Query:  155 DNSALSKRAPNYS----------MERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNL--PINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            D ++ SK  PN S           E  IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +       Y +  STFS    ++ H+KK   GK  L   ++ P V+ +   P       I +E +Q+  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + ++    PI ++ E++  GSL DFLKS  G+K  L  + +  A+ISEGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P        CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   32 DPTSSSKLGPNNSNSMPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGE-WWKARSLATKKEGYIPSNYVARVNS--LETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGD-TVKHYKIRTLDSGG--FYISPRSTFSSLQELVLHYKK---GKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVSQ---EPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPD------NCPEELYNIMIRCWKNRPEERPTFEYIQSVLD 489          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Hck (hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI:96052])

HSP 1 Score: 257.299 bits (656), Expect = 1.706e-78
Identity = 166/476 (34.87%), Postives = 261/476 (54.83%), Query Frame = 2
Query:  155 DNSALSKRAPNYS----------MERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNL--PINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            D ++ SK  PN S           E  IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +       Y +  STFS    ++ H+KK   GK  L   ++ P V+ +   P       I +E +Q+  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + ++    PI ++ E++  GSL DFLKS  G+K  L  + +  A+ISEGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P        CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   32 DPTSSSKLGPNNSNSMPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGE-WWKARSLATKKEGYIPSNYVARVNS--LETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGD-TVKHYKIRTLDSGG--FYISPRSTFSSLQELVLHYKK---GKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVSQ---EPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPD------NCPEELYNIMIRCWKNRPEERPTFEYIQSVLD 489          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Hck (hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI:96052])

HSP 1 Score: 257.299 bits (656), Expect = 2.977e-78
Identity = 167/473 (35.31%), Postives = 263/473 (55.60%), Query Frame = 2
Query:  140 SSKLHDNSALSKRAPNY--SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNL--PINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            SSKL  N++ S   P +    E  IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +       Y +  STFS    ++ H+KK   GK  L   ++ P V+ +   P       I +E +Q+  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + ++    PI ++ E++  GSL DFLKS  G+K  L  + +  A+ISEGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P        CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   57 SSKLGPNNSNS-MPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGE-WWKARSLATKKEGYIPSNYVARVNS--LETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGD-TVKHYKIRTLDSGG--FYISPRSTFSSLQELVLHYKK---GKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVSQ---EPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPD------NCPEELYNIMIRCWKNRPEERPTFEYIQSVLD 510          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Hck (hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI:96052])

HSP 1 Score: 257.299 bits (656), Expect = 3.072e-78
Identity = 167/473 (35.31%), Postives = 263/473 (55.60%), Query Frame = 2
Query:  140 SSKLHDNSALSKRAPNY--SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNL--PINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            SSKL  N++ S   P +    E  IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +       Y +  STFS    ++ H+KK   GK  L   ++ P V+ +   P       I +E +Q+  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + ++    PI ++ E++  GSL DFLKS  G+K  L  + +  A+ISEGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P        CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   57 SSKLGPNNSNS-MPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGE-WWKARSLATKKEGYIPSNYVARVNS--LETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGD-TVKHYKIRTLDSGG--FYISPRSTFSSLQELVLHYKK---GKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVSQ---EPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPD------NCPEELYNIMIRCWKNRPEERPTFEYIQSVLD 510          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Lyn (LYN proto-oncogene, Src family tyrosine kinase [Source:MGI Symbol;Acc:MGI:96892])

HSP 1 Score: 238.039 bits (606), Expect = 2.281e-71
Identity = 154/446 (34.53%), Postives = 237/446 (53.14%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            IV+A Y YD I   D+SF++ E M V++E  + W++   +  K  G +PSNYV K +      E W+   I R +AE+ L+ P  +   +LIR S+  K  + +S++  D    +  +KH+ IR +   N   Y +   TF     +I+H++K   G                P       I +E I++V ++G   +G V    +  S  V  K+L   +   Q F++E  L   L++ ++V +  + T  K  PI +I E++  GSL DFLKS  G K+ L  + +  A+I+EGMAY+ERK  +H +L++ N+LV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L+EI+T+ K PYPG    +VM  +  GYRM   +       CP E+Y++M  CW  K E RPTF  +++ +D
Sbjct:   46 IVVALYPYDGIHPDDLSFKKGEKMKVLEEHGE-WWKAKSLSSKREGFIPSNYVAKVN--TLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDV-IKHYKIRSLD--NGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVT--KEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRME------NCPDELYDIMKMCWKEKAEERPTFDYLQSVLD 477          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P42687|SPK1_GIRTI (Tyrosine-protein kinase SPK-1 OS=Girardia tigrina OX=6162 PE=2 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 1.425e-160
Identity = 233/495 (47.07%), Postives = 337/495 (68.08%), Query Frame = 2
Query:  125 MGQYFSSKL-----HDNSALSKRAPNYSME----RMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRN-TFKSYYNN 1561
            MGQ FS K      + N++  ++ P  + E      +V A+YKY A G  DISF++ E+M V+++FD+FW +V+K KD   GLVPSNYV KQDGSPQSVE W  I+RWEAEK LM   +   TY+IRPS+K+  Y +S++  D   K   VKHF I+ ++++  + Y   +  F +   +I+ ++K+GIG  ++P+ +P  +   PP+H  ++ I +E+I+I++EIG+  +G V+RA WG+SY V AK L  S ++R++F+ E  + +KLR+++IVE+LG+CTEP+  P+++I EY++NGSLK++LK+  G K NL  M    AEISEGMAYLE + +VH +L+++NILV  D++ K++DFGL  + D  L D+E        KW APEAA   +FTSKSDVWS+GIV+FEILTW  +PYP IPA EV++KV  GYRM NP+ +  GVCCP EIY +M+ CWD  PE RPTF  ++ +MD LIV   T  +YY++
Sbjct:    1 MGQKFSIKCKKQSKNKNTSKCQKIPKKAYEGPPGSYMVKAKYKYAASGDTDISFEEKEIMYVLEQFDEFWLKVVKQKDNKEGLVPSNYVSKQDGSPQSVEAWREIQRWEAEKSLMKIGLQKGTYIIRPSRKENSYALSVRDFDEKKKICIVKHFQIKTLQDEKGISYSVNIRNFPNILTLIQFYEKNGIGNTHIPLTDPMPDNYQPPVHFQDIEINRENIEILNEIGRGFFGSVHRAKWGRSYEVAAKMLQSSKAEREKFVLEAKIMHKLRHRKIVELLGVCTEPQDMPMLIIVEYMKNGSLKEYLKTPDGKKTNLNQMVHMMAEISEGMAYLESEKVVHRDLRADNILVANDLTRKVADFGLTELTDGSLGDQEKKTLRFPYKWTAPEAAKSKVFTSKSDVWSYGIVMFEILTWASSPYPDIPAKEVIEKVSKGYRMPNPEKFITGVCCPDEIYKIMIWCWDANPEKRPTFLVLQEKMDLLIVDTLTNNAYYSH 495          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P08103|HCK_MOUSE (Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4)

HSP 1 Score: 257.299 bits (656), Expect = 2.082e-77
Identity = 167/473 (35.31%), Postives = 263/473 (55.60%), Query Frame = 2
Query:  140 SSKLHDNSALSKRAPNY--SMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNL--PINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            SSKL  N++ S   P +    E  IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +       Y +  STFS    ++ H+KK   GK  L   ++ P V+ +   P       I +E +Q+  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + ++    PI ++ E++  GSL DFLKS  G+K  L  + +  A+ISEGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P        CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   57 SSKLGPNNSNS-MPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGE-WWKARSLATKKEGYIPSNYVARVNS--LETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGD-TVKHYKIRTLDSGG--FYISPRSTFSSLQELVLHYKK---GKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVSQ---EPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPD------NCPEELYNIMIRCWKNRPEERPTFEYIQSVLD 510          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q95M30|HCK_MACFA (Tyrosine-protein kinase HCK OS=Macaca fascicularis OX=9541 GN=HCK PE=2 SV=3)

HSP 1 Score: 254.988 bits (650), Expect = 8.362e-77
Identity = 159/452 (35.18%), Postives = 257/452 (56.86%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKK--HGIGKKNLPINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G+ +K   ++ P V+ +   P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA      T KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   57 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGSDGLCQK---LSVPCVSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSSTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 490          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P08631|HCK_HUMAN (Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5)

HSP 1 Score: 255.373 bits (651), Expect = 9.576e-77
Identity = 158/452 (34.96%), Postives = 254/452 (56.19%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E +IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +   N   Y +  STFS    +++H+KK   G   K ++P      +    P       I +E +++  ++G   +G V  A + K   V  K++   S   + F+ E  +   L++ ++V++  + T+    PI +I E++  GSL DFLKS  G+K  L  + +  A+I+EGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P+       CP E+YN+M+RCW N+PE RPTF  I++ +D
Sbjct:   79 EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDS--LETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLD--NGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPC---MSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE------NCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 512          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P50545|HCK_RAT (Tyrosine-protein kinase HCK OS=Rattus norvegicus OX=10116 GN=Hck PE=1 SV=4)

HSP 1 Score: 253.447 bits (646), Expect = 5.019e-76
Identity = 159/452 (35.18%), Postives = 253/452 (55.97%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNL--PINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            E  IV+A Y Y+AI   D+SFQ+ + MVV++E  + W++   +  K  G +PSNYV + +      E W+   I R +AE+ L+ P     +++IR S+  K  Y +S++  D    +  VKH+ IR +       Y +  STFS    ++ H+KK   GK  L   ++ P V+ +   P       I +E +Q+  ++G   +G V  A + K   V  K++   S   + F+ E  L   L++ ++V++  + ++    PI ++ E++  GSL DFLKS  G+K  L  + +  A+ISEGMA++E++  +H +L++ NILV   +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +  GYRM  P        CP E+Y++M+RCW N+PE RPTF  I++ +D
Sbjct:   77 EDTIVVALYDYEAIHREDLSFQKGDQMVVLEESGE-WWKARSLATKKEGYIPSNYVARVNS--LETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGD-TVKHYKIRTLDSGG--FYISPRSTFSSLQELVVHYKK---GKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLHAVVSQ---EPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPD------NCPEELYSIMIRCWKNRPEERPTFEYIQSVLD 510          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A5K3ET40 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.236e-98
Identity = 175/474 (36.92%), Postives = 275/474 (58.02%), Query Frame = 2
Query:  164 ALSKRAPNYSMERMI-VIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEE----DDKWLAPEAA-TDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCN 1567
            ALS+R+P     R++ V A Y Y A  + D+SFQ+ +VM+V     + W+    ++    G +PSNYV  ++G    ++ W+ I R +A+++L+ P +   TY+IRPS   R Y +S++ Q      Y +KH+ IR  ++     Y    + F+    +I H++    G     +  P      PP+   ++   ++ ++ + E+GK S+G V RA W K++ V  K   ++++ R  FI+E  + +KL ++RIV +LG+CTEP   P+ +I E L+ G+L++FL SA G +L L D+ +  A+I+EGMAYLE    VH +L++ NILVD D SVK++DFGL +M+D             KW APEAA  DH+F+ KSDVWSFG++++EI+T+   PYP     E +Q+V  GYRM NP    P   CP ++Y +M++CW  +PE RPTF N+ +  +   V NT   Y +  N
Sbjct:  106 ALSERSP-----RVVRVHALYTYVAQNADDLSFQKGDVMLVQAGLSEAWWMARHLRTGQHGYIPSNYVSVENGLLTQMDAWYDITRKDADRMLLMPGLPQGTYIIRPSSDSRSYALSIRFQTE-KNMYAIKHYKIRT-RDNGAGFYITNRTNFATVADLISHYQSINDGL-CCALTQPCPRKYKPPVQFRDIEANRKSLEFICELGKGSFGEVYRARWNKTFDVAVKQ-RLATTDRALFIEEAKVMHKLHHRRIVRLLGVCTEPPEEPVFIITELLEKGALRNFLDSAEGRQLVLSDLIDMIAQIAEGMAYLEEMNFVHRDLRAANILVDRDNSVKVADFGLAKMLDSNTPVGGVIKFPIKWTAPEAALPDHLFSIKSDVWSFGVLMYEIVTYGGTPYPRFTNRETVQQVERGYRMPNPST--PTQPCPDDLYVIMLQCWSARPEDRPTFRNLYDIFENWAV-NTEGQYVDGQN 567          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: W6U3R5 (Tyrosine-protein kinase OS=Echinococcus granulosus OX=6210 GN=EGR_09408 PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.761e-98
Identity = 161/437 (36.84%), Postives = 260/437 (59.50%), Query Frame = 2
Query:  209 VIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEE----DDKWLAPEAA-TDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNI 1504
            V A Y Y A  + D+SFQ+ +VM+V     + W+    ++   +G +PSNYV  ++G    +E W+ I R +AE++L+ P +   TY++RP    R Y +S++ +      Y +KH+ IR  ++     Y    + F+    +I H++    G     ++ P      PP+   ++   +  ++ + E+G  S+G+V RA W K++ V  K   ++++ R  FI+E  + +KL ++RIV +LG+CTEP   P+ +I E L+ G+L++FL S  G +L L D+ +  A+I+EGMAYLE    VH +L++ NILVD D SVK++DFGL +M+D  ++++       KW APEAA  DH F+ KSDVWSFG++++EI+T+   PYP     E +Q+V  GYRM NP    P   CP ++Y++M++CW  +PE RPTF N+
Sbjct:   93 VHALYTYVAQNADDLSFQKGDVMLVESGLSEAWWLARHLRTGQQGYIPSNYVTVENGLSTQMEAWYDITRKDAERMLLMPGLPQGTYILRPCSDSRSYALSIRFEIERNM-YAIKHYKIRT-RDNGAGFYITNRTNFASVADLISHYQSTSDGL-CCRLSQPCPRKYTPPVQFRDIEANRRSLEFICELGNGSFGMVYRARWNKTFDVAVKK-RLATTDRALFIEEAKVMHKLHHRRIVRLLGVCTEPADEPVFIITELLEKGALRNFLSSEEGRQLFLSDLIDMIAQIAEGMAYLEEMNFVHRDLRAANILVDRDNSVKVADFGLAKMLDSDIQNDGVIKFPIKWTAPEAALPDHHFSIKSDVWSFGVLMYEIVTYGGTPYPRFTNRETVQQVERGYRMPNPNT--PTQPCPDDLYDIMMQCWSARPEDRPTFRNL 523          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: I4ENX2 (Tyrosine-protein kinase OS=Echinococcus multilocularis OX=6211 GN=tk6 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.052e-97
Identity = 161/437 (36.84%), Postives = 260/437 (59.50%), Query Frame = 2
Query:  209 VIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEE----DDKWLAPEAA-TDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNI 1504
            V A Y Y A  + D+SFQ+ +VM+V     + W+    ++   +G +PSNYV  ++G    +E W+ I R +AE++L+ P +   TY++RP    R Y +S++ +      Y +KH+ IR  ++     Y    + F+    +I H++    G     ++ P      PP+   ++   +  ++ + E+G  S+G+V RA W K++ V  K   ++++ R  FI+E  + +KL ++RIV +LG+CTEP   P+ +I E L+ G+L++FL S  G +L L D+ +  A+I+EGMAYLE    VH +L++ NILVD D SVK++DFGL +M+D  ++++       KW APEAA  DH F+ KSDVWSFG++++EI+T+   PYP     E +Q+V  GYRM NP    P   CP ++Y++M++CW  +PE RPTF N+
Sbjct:  117 VHALYTYVAQNADDLSFQKGDVMLVESGLSEAWWLARHLRTGQQGYIPSNYVTVENGLSTQMEAWYDITRKDAERMLLMPGLPQGTYILRPCSDSRSYALSIRFEIERNM-YAIKHYKIRT-RDNGAGFYITNRTNFASVADLISHYQSTSDGL-CCRLSQPCPRKYTPPVQFRDIEANRRSLEFICELGNGSFGMVYRARWNKTFDVAVKK-RLATTDRALFIEEAKVMHKLHHRRIVRLLGVCTEPADEPVFIITELLEKGALRNFLSSEEGRQLFLSDLIDMIAQIAEGMAYLEEMNFVHRDLRAANILVDRDNSVKVADFGLAKMLDSDVQNDGVIKFPIKWTAPEAALPDHHFSIKSDVWSFGVLMYEIVTYGGTPYPRFTNRETVQQVERGYRMPNPNT--PTQPCPDDLYDIMMQCWSARPEDRPTFHNL 547          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A087VZ06 (Tyrosine-protein kinase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000132100 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.402e-97
Identity = 161/437 (36.84%), Postives = 260/437 (59.50%), Query Frame = 2
Query:  209 VIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEE----DDKWLAPEAA-TDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNI 1504
            V A Y Y A  + D+SFQ+ +VM+V     + W+    ++   +G +PSNYV  ++G    +E W+ I R +AE++L+ P +   TY++RP    R Y +S++ +      Y +KH+ IR  ++     Y    + F+    +I H++    G     ++ P      PP+   ++   +  ++ + E+G  S+G+V RA W K++ V  K   ++++ R  FI+E  + +KL ++RIV +LG+CTEP   P+ +I E L+ G+L++FL S  G +L L D+ +  A+I+EGMAYLE    VH +L++ NILVD D SVK++DFGL +M+D  ++++       KW APEAA  DH F+ KSDVWSFG++++EI+T+   PYP     E +Q+V  GYRM NP    P   CP ++Y++M++CW  +PE RPTF N+
Sbjct:  117 VHALYTYVAQNADDLSFQKGDVMLVESGLSEAWWLARHLRTGQQGYIPSNYVTVENGLSTQMEAWYDITRKDAERMLLMPGLPQGTYILRPCSDSRSYALSIRFEIE-RNMYAIKHYKIRT-RDNGAGFYITNRTNFASVADLISHYQSTSDGL-CCRLSQPCPRKYTPPVQFRDIEANRRSLEFICELGNGSFGMVYRARWNKTFDVAVKK-RLATTDRALFIEEAKVMHKLHHRRIVRLLGVCTEPADEPVFIITELLEKGALRNFLSSEEGRQLFLSDLIDMIAQIAEGMAYLEEMNFVHRDLRAANILVDRDNSVKVADFGLAKMLDSDVQNDGVIKFPIKWTAPEAALPDHHFSIKSDVWSFGVLMYEIVTYGGTPYPRFTNRETVQQVERGYRMPNPNT--PTQPCPDDLYDIMMQCWSARPEDRPTFHNL 547          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A068WX09 (Tyrosine-protein kinase OS=Echinococcus granulosus OX=6210 GN=EgrG_000132100 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.680e-97
Identity = 161/437 (36.84%), Postives = 260/437 (59.50%), Query Frame = 2
Query:  209 VIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEE----DDKWLAPEAA-TDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNI 1504
            V A Y Y A  + D+SFQ+ +VM+V     + W+    ++   +G +PSNYV  ++G    +E W+ I R +AE++L+ P +   TY++RP    R Y +S++ +      Y +KH+ IR  ++     Y    + F+    +I H++    G     ++ P      PP+   ++   +  ++ + E+G  S+G+V RA W K++ V  K   ++++ R  FI+E  + +KL ++RIV +LG+CTEP   P+ +I E L+ G+L++FL S  G +L L D+ +  A+I+EGMAYLE    VH +L++ NILVD D SVK++DFGL +M+D  ++++       KW APEAA  DH F+ KSDVWSFG++++EI+T+   PYP     E +Q+V  GYRM NP    P   CP ++Y++M++CW  +PE RPTF N+
Sbjct:  117 VHALYTYVAQNADDLSFQKGDVMLVESGLSEAWWLARHLRTGQQGYIPSNYVTVENGLSTQMEAWYDITRKDAERMLLMPGLPQGTYILRPCSDSRSYALSIRFEIERNM-YAIKHYKIRT-RDNGAGFYITNRTNFASVADLISHYQSTSDGL-CCRLSQPCPRKYTPPVQFRDIEANRRSLEFICELGNGSFGMVYRARWNKTFDVAVKK-RLATTDRALFIEEAKVMHKLHHRRIVRLLGVCTEPADEPVFIITELLEKGALRNFLSSEEGRQLFLSDLIDMIAQIAEGMAYLEEMNFVHRDLRAANILVDRDNSVKVADFGLAKMLDSDIQNDGVIKFPIKWTAPEAALPDHHFSIKSDVWSFGVLMYEIVTYGGTPYPRFTNRETVQQVERGYRMPNPNT--PTQPCPDDLYDIMMQCWSARPEDRPTFHNL 547          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: lyn (tyrosine-protein kinase Lyn-like [Source:NCBI gene;Acc:103026730])

HSP 1 Score: 264.233 bits (674), Expect = 3.658e-81
Identity = 167/449 (37.19%), Postives = 247/449 (55.01%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            IVIA Y Y+AI + D+ F++ E + V++E  + W++   +  +  G +PSNYV + D      E W+   I R +AE+ L+ P      YLIR S+  K  Y +S++       +  VKH+ IR +   N   Y +   TF D   +I H+ K   G   K   P   P       P       I KE I++V ++G   +G V  A +  +  V  K+L   +   + F++E  L   L+++R+V +  + T  K  PI +I E++ NGSL DFLKS  G+KL L  + +  A+I+EGMAY+E+K  +H +L++ N+LV   +  KI+DFGL R+I D+Q    E      KW APEA     FT KSD+WSFGI+L+EI+T+ K PYPG+   EVM  V  GYRM  P+       CP E+Y++M  CW NKP+ RPTF  I++ +D
Sbjct:   70 IVIALYPYEAIHTDDLGFKKGEKLRVLEEHGE-WWKAKSLSTRKEGFIPSNYVAQADT--METEEWFFKEITRKDAERQLLAPANKPGAYLIRESETSKGSYSLSIRDAGPQGSDV-VKHYKIRSLD--NGGYYISPKITFPDIIKMIHHYHKQADGLCRKLERPCEKPKAQK---PWDKDAWEISKESIKMVKKLGAGQFGEVWMAYYNNTTKVAVKTLKPGTMSVEAFLEEANLMKTLQHERLVRLYAVVT--KIEPIYIITEFMANGSLLDFLKSDAGSKLQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLLCKIADFGLARVIEDDQYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGILLYEIITYGKIPYPGMSNGEVMTSVQRGYRMPRPE------SCPTELYDIMNTCWKNKPDDRPTFDYIQSVLD 501          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:103036768])

HSP 1 Score: 245.743 bits (626), Expect = 2.838e-74
Identity = 146/447 (32.66%), Postives = 247/447 (55.26%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            I IA Y Y+ +   D+ F++ + + +++E  + W+  + +     G +PSNYV K        E W+   + R +AE+ L+ P   + +++IR S+  K  Y +S++  D+ + E  VKH+ IR +   N   Y +   TFS    +I H+KK G G     + NP V+ +   P       I +E +++   +G   +G V  A + K   V  K++   +   + F+ E  L   L++ ++V +  + T  K  PI +I E+++ GSL DF+K+  G ++ L  + +  A+I+EGMAY+E++  +H +L++ NILV+  +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+++ + PYPG+   EV++ +  GYRM+          CP E+Y++M+ CW NKPE RPTF  +++ ++
Sbjct:   59 IAIALYDYEGLHDGDLGFKKGDKLKILQESGE-WWRAMSLSSGEEGFIPSNYVAK---DTLQTEDWFFKGVSRKDAERQLLAPGNKSGSFMIRDSETTKGSYSLSVRDSDHQSGE-TVKHYKIRTLD--NGGFYISPRITFSTLQELITHYKKQGDGLCQA-LTNPCVSAKPQKPWEKDAWEIPRESLKLDKRLGAGQFGEVWMATYNKHTKVAVKTMKPGTMSVEAFLMEANLMKSLQHDKLVRLNAVVT--KEEPIYIITEFMEKGSLLDFIKTDEGNRVQLPKLIDFSAQIAEGMAYIEQRNYIHRDLRAANILVNKSLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLTEIISYGRTPYPGMTNPEVIRSLERGYRMQRLD------SCPQELYDIMLECWKNKPEDRPTFEYLQSVLE 489          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000007450.2 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:103026537])

HSP 1 Score: 239.195 bits (609), Expect = 2.586e-71
Identity = 144/444 (32.43%), Postives = 234/444 (52.70%), Query Frame = 2
Query:  212 IAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQD-NYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            +A Y Y+A  + D+SF++ E   ++   +  W+E   +    +G +PSNYV   D S Q+ E ++  + R +AE+LL+ P +    +L+R S+  +    SL   D    K  NVKH+ +R +       Y    + FS    +I+H+  H  G    L    P V      +      I ++ + +  ++G+  +G V    W  S  V  K+L   +   + F+ E  +  KLR+ ++V++  + ++    PI ++ E++  GSL DFLK   G  L L  + +  A+IS+GMA++ER   +H +L++ NILV  +M  KI+DFGL R+I++             KW APEAA    F+ KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  P        CP  ++ LM++CW  +P+ RPTF  IK  ++
Sbjct:  100 VALYDYEARTTDDLSFKKGERFQIINNTEGDWWEACSLSSGLQGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLQPGIQRGMFLMRESETTKG-AFSLSICDWEEDKGENVKHYKVRTLDSGG--YYITTRAQFSTLQSLIKHYTAHADGLCHRLTGVCPTVRPHTQGLAKDAWEISRDSLSLEVKLGQGCFGEVWMGTWKSSTKVAVKTLKPGTMSPEAFLQEAQIMKKLRHDKLVQLYAVVSQ---EPIYIVTEFMSKGSLLDFLKEGEGKVLKLPQLVDMAAQISDGMAFIERMNYIHRDLRAANILVTDNMVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGKFSIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVDRGYRMPCPP------ACPASLHELMLQCWRREPDERPTFDYIKGFLE 530          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: clul1 (tyrosine-protein kinase yes [Source:NCBI gene;Acc:103029125])

HSP 1 Score: 238.039 bits (606), Expect = 6.501e-71
Identity = 147/444 (33.11%), Postives = 240/444 (54.05%), Query Frame = 2
Query:  212 IAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            +A Y Y+A  S D+SF++ +   ++   +  W+E   +    +G +PSNYV   D S Q+ E ++  + R +AE+LL+ P     T+L+R S+  K  Y +S++  D+  K  NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L    P V  +   +      I +E +++  ++G+  +G V    W  +  V  K+L   +   + F+ E  +  KLR+ ++V +  + +E    PI ++ EY+  GSL DFLK   G  L L  + +  A+I++GMA++ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ +M  CW  +P+ RPTF  I++ ++
Sbjct:  101 VALYDYEARTSDDLSFKKGDRFQIINNTEGDWWEARSINTGKKGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLVPGNQRGTFLVRESETTKGAYSLSIRDWDD-MKGDNVKHYKIR--KLDNGGYYITTRAQFETLQKLVKHYTEHADGLCYRLTTVCPTVKPQTQGLAKDAWEIPRESLRLELKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLYAVVSE---EPIYIVTEYMGKGSLLDFLKEGEGKYLKLPQLVDMAAQIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQ------GCPESLHEMMRLCWKKEPDERPTFEYIQSFLE 531          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: fyna (tyrosine-protein kinase fyna [Source:NCBI gene;Acc:103043249])

HSP 1 Score: 236.884 bits (603), Expect = 1.562e-70
Identity = 143/446 (32.06%), Postives = 235/446 (52.69%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMI-IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIK 1507
            + +A Y Y+A    D+SF++ E   ++   +  W+E   +     G +PSNYV   D      E W+   + R +AE+ L++      T+LIR S+  K  Y +S++  D+   ++ VKH+ IR  K  N   Y    + F     +++H+     G   +  +P +     +    + + ++  I +E +Q++  +G   +G V    W  +  V  K+L   +   + F++E  +  KLR+ ++V++  + +E    PI ++ EY+  GSL DFLK   G  L L ++ +  A+++ GMAY+ER   +H +L+S NILV   +  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LM++CW   PE RPTF  ++
Sbjct:   86 LFVALYDYEARTEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSI--QAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDDIKGDH-VKHYKIR--KLDNGGYYITTRAQFETLQQLVQHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSE---EPIYIVTEYMGKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQ------DCPISLHELMLQCWKRDPEERPTFEYLQ 517          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 238.424 bits (607), Expect = 1.441e-72
Identity = 148/460 (32.17%), Postives = 250/460 (54.35%), Query Frame = 2
Query:  212 IAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKM-------KDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPI--HSVNMI----IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD--------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            +A Y YD   + D+SF++ E++ V  + +  W+   K        +  TRG +P+NYV +        E W+   I+R +AEK L+    T   +LIR S+ +K DY +S++  D  T    VKH+ IR + E N   + +   TF +   +++++K +  G   + +  P V + AP     S N +    I +  IQ+   +G   +G V + +W  S +V  K+L   + K+++FI E  +  +LR+  ++++  +C++    PI +I E +++GSL D+L+   G +L   ++ +   +I+ GMAYLE +  +H +L + NILV      K++DFGL R+I  + +DE +         KW APEA   H F+ KSDVWSFGI+L+E++T+ + PYP +   EV++++  GYRM  P        CP   Y++M+ CW+ K E RPTF  ++  +D
Sbjct:    2 VALYDYDGRTNEDLSFKEGELLEVTDKTNSDWWYAQKKTASTSNERYNTRGYIPANYVAEYQS--LDAEPWFFGDIKRADAEKYLLADVNTTGAFLIRQSESRKTDYSLSVR--DGST----VKHYRIRQLDE-NGGFFISRRVTFQNLIELVQYYKSNSDGL-CMALQKPCVVIEAPTTIGLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQGLWNNSTLVAVKTLKPGAMKKEEFIGEAQIMKQLRHANLIQLYAVCSQ--EEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPD------NCPPLFYSIMLECWNKKEEERPTFETLQWRLD 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 237.269 bits (604), Expect = 2.471e-72
Identity = 143/453 (31.57%), Postives = 250/453 (55.19%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKH--GIGKKNLPINNPFVNVRAPPIHSVNMI-IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            +V+A Y ++ +   D+ F++ + M +++E  ++W   + M    +G +PSNYV K +      E W+   + R E E+LL+ P  +   YL+R S+  K  Y +S++  D  T    V+H+ IR +   N   + +   TF D   +I+H+  H  G+ +K L    P V+ +   +   +   I ++ +++   +G   +G V   I+     V  K++   S   + F+DE  L   L++ R+V +  + T+    PI ++ E+++NGSL D+LKS  G+ L +  M +  A+I+EGMA++ERK  +H +L++ NILV+  ++ KI+DFGL R+I++      +      KW APEA     F+ KSDVWSFGI+L EI+T+ + PYPG+  ++V++++  GYRM  P+        P ++Y +M+ CW  +PE RPTF  ++  ++    
Sbjct:    2 LVVALYDFEQLNPDDMGFKKGDKMRIIQERGEWWMAEL-MDGSHKGYIPSNYVAKANS--LETEEWFFSGVSRKEGERLLLAPGNSIGAYLLRDSESNKGSYSLSVRDYD-ITNGDVVRHYKIRTLD--NGGYFISARLTFPDLFALIQHYTAHSDGLCQKLL---RPCVSKKPQQLWEKDAWEIPRDSLKLSKRLGAGQFGEVWMGIYNNRTKVAIKTMKPGSMSPEAFLDEANLMKTLQHPRLVRLYAVVTQ---EPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMSNSDVIRQLERGYRMPCPE------QAPKQLYGVMMDCWKERPEERPTFEYLQGVLEDFFT 436          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 234.572 bits (597), Expect = 5.179e-71
Identity = 149/453 (32.89%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNE----------VMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIK 1507
            + +A Y YDA    D+SF++ E          V VV +E D  W+E   +    +G +PSNYV   D      E W+   + R +AE+ L+ P     T+LIR S+  K  Y +S++  D   K  NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L +  P    +   +      + ++ +++  ++G+  +G V    W  +  V  K+L   +   + F++E  +  KLR+ ++V++  + +E    PI ++ E++  GSL DFLK   G  L L  + +  A+I+ GMAY+ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  P        CP  ++ LM++CW   PE RPTF  ++
Sbjct:   17 LFVALYDYDARTQDDLSFRKGEKFQIINNTIEVAVVYREGD--WWEARSLSTGNKGYIPSNYVAPADSV--QAEEWYFGKVSRKDAERQLLCPGNPRGTFLIRESETTKGAYSLSIRDWDE-VKGDNVKHYKIR--KLDNGGYYITTRAQFDTLQKLVQHYSEHADGLCYKLTLVCPNEKPQTQGLARDAWEMPRDSLKLELKLGQGCFGEVWAGTWNGTTKVAIKTLKPGTMSPEAFLEEAQIMKKLRHDKLVQLYAVVSE---EPIYIVTEFMSKGSLLDFLKEGDGRYLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPP------SCPESLHELMMQCWKKDPEERPTFEYLQ 453          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 232.646 bits (592), Expect = 7.891e-70
Identity = 148/458 (32.31%), Postives = 253/458 (55.24%), Query Frame = 2
Query:  182 PNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYF-NGLSTFSDFGMII--EHFKKHGIGKKNLPINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            PN  ++ ++V+A Y YD I + D+ F++ + +V+V+E +  W++   +  K  G +PSN+V K +   +  E W+   + R +AE+ L+       +YLIR S+  K  Y +S++       +  VKH+ IR +   +K  YF     TF     ++   H K  G+ +K   +  P + ++   P       I +E I++  ++G   +G V   ++ K   V  K +   S   Q F++E  L   L++ ++V +  + T+    PI ++ EY++ GSL DFLK++ G++L    M +  A+++EGMA++E K  +H +L++ NILV+ ++  KI+DFGL R+I++      +      KW APEA     F+ KSDVWSFGI+L E++T+ + PYPG+   EV++ +  GYRM  P        CPCE+Y++M  CW  KPE RPTF  +++ ++
Sbjct:   59 PNRYVDGLLVVALYDYDPIHADDLCFRRGDQLVIVEEGND-WWKARSVATKKEGYIPSNFVAKVNSIEK--EEWFFKGLSRKDAERQLLLCGNKIGSYLIRDSETNKGSYSLSVRDHIVEVGD-TVKHYKIRTL---DKGGYFITSRITFHTLQELVVYYHLKADGLCQK---LGKPCIAIQPQKPWEKDAWEIPRESIKLEKKLGAGQFGDVWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDKLVRLHAVVTD---EPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERGYRMPKPD------NCPCELYSIMQECWRQKPEERPTFEYLQSLLE 497          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 5.228e-61
Identity = 120/376 (31.91%), Postives = 205/376 (54.52%), Query Frame = 2
Query:  437 LMNPDVTNETYLIRPSKKK-RDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIH--SVNMI----IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD--------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            LM     + ++L+R S+     Y +S++  D       VKH+ IRV+++ +   +    + F+    +++ + +   G   + +N P +    P     S +M     I +  +Q+V  +G   +G V + +W K+  V  K+L   +  R  F+ E  L  +LR+ +++++  +CT+    PI +I E + NGSL ++L++  G  L+L+++ +  A+++ GMAYLE +  +H +L + NILV    + K++DFGL R+I    +DE +         KW APEAA  + F+ KSDVWSFG++L EI+T+ K PYPG    EV+  V  GYRM  P    PG  CP   Y+LM+ CW+   + RPTF  ++ +++
Sbjct:   10 LMKSGNVHGSFLVRQSETSGHGYSLSVRDGDT------VKHYKIRVLEKGS--FFITRRNQFATLRDLVQSYSRDANGL-CVTLNQPCLKKEMPQTEGLSSDMADKWEIPRSSVQLVKRLGAGQFGEVWQGLWNKTTPVAIKTLKQGTMDRDDFLREAQLMKRLRHPKLIQLYAVCTQ--EEPIYIITELMSNGSLANYLQTPEGRSLDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEYEARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVDRGYRMPCP----PG--CPQAFYDLMLECWNVDDQARPTFETLQWQLE 368          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 82.0333 bits (201), Expect = 1.022e-16
Identity = 70/267 (26.22%), Postives = 125/267 (46.82%), Query Frame = 2
Query:  704 VRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQ--QFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFL-KSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQ-LKDEEDDKWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPT 1492
            V   PI   +    + H++ V  IG+ SYG+V +AI   +  V A    +  +  +    + E+ L   L +  IV+  G     K   + ++ EY  NGSL+  + +S+ G   N  +      +   G+ YL  +G++H ++K+ NIL+  D +VK++DFG+  +++   L       W+APE   +   ++ SD+WS G  + E+LT    PY  +    +       Y +EN   Y+P       + + + +C+      RPT
Sbjct:   10 VNLTPIQRASEKSVQYHLKQV--IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIR--KSYELYILLEYCANGSLRRLISRSSTGLSEN--ESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTK-NPPYHNLTDANIY------YAVEN-DTYYPPSSFSEPLKDFLSKCFVKNMYKRPT 262          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 76.2554 bits (186), Expect = 5.271e-15
Identity = 51/173 (29.48%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  830 VTAKSLSISSSKRQQFI-DEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTER-----FAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGL-RRMIDEQLKDEE---DDKWLAPEAATDHIFTSKSDVWSFGIVLFEIL 1318
            V  K + +S   R++ I +E+L+    R+K IV  L          + ++ E+++ GSL D ++++     +   +TE        E  +G+ +L  K ++H ++KS+N+L+D    VKI+DFG   R+ D++ K         W+APE      +  K DVWS GI+  E+L
Sbjct:  591 VAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDD-LWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEML 762          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 73.559 bits (179), Expect = 5.111e-14
Identity = 63/219 (28.77%), Postives = 102/219 (46.58%), Query Frame = 2
Query:  884 EVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAE---------ISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDK-----WLAPEAA-TDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEI-YNLMVRCWDNKPELRPT 1492
            EV     L +  IV+ LG   E K++   L  EY+  GS+            +L+ M  RF E         + +G+AYL  KG++H ++K++N+L+D D   KISDFG+ R   +   + +        W+APE   T   +++K D+WS G ++ E+    K P+  +     M K+  G     P      +    +I  N +  C++  PE RPT
Sbjct: 1228 EVSTLKDLDHLNIVQYLGF--ENKNNIYSLFLEYVAGGSVG-----------SLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLEVVAAMFKI--GKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPT 1430          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 72.7886 bits (177), Expect = 6.410e-14
Identity = 53/180 (29.44%), Postives = 88/180 (48.89%), Query Frame = 2
Query:  884 EVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDK-------WLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENP 1402
            E+ L  +L ++ IV   G   E  +  I L  EY+  GS+   L +    + +L+    R  +I  G+AYL +K ++H ++K  NIL+D    VKI+DFG+ + +    K +           W++PE       T+K+D+WS G V+ E+ T  K P+P     + + K+      E P
Sbjct:  504 EMNLLKELHHENIVTYYGASQEGGNLNIFL--EYVPGGSVSSMLNNYGPFEESLITNFTR--QILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTG-KHPFPDFSQMQAIFKIGTNTTPEIP 678          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 72.0182 bits (175), Expect = 9.874e-14
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  830 VTAKSLSISSSKRQQFI-DEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSA-------RGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEE----DDKWLAPEAATDHIFTSKSDVWSFGIVLFEIL 1318
            V  K + +S   ++Q I +E+L+ N  R + IV  L          + +I EY++ G L D L +          + LN   M     E  +G+ +L  K ++H ++KS+NIL++    VKI+DFG    + E+            W+APE      +  K DVWS GI+L E++
Sbjct:  403 VAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEE-LWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMI 576          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 178.718 bits (452), Expect = 9.861e-52
Identity = 90/269 (33.46%), Postives = 153/269 (56.88%), Query Frame = 2
Query:  740 IKKEHIQIVSEIGKTSYGIVNRAIWGK-SYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLI 1528
            I++  I +  ++G   YG V    W K +  V  K+L   + + ++F+ E  +   ++++ +V++LG+CT  +  P  +I E++ NG+L D+L+S +G  L+ + +     ++   M+YLE    +H +L + N LV  +  VK++DFGL R++ E +           KW APEA   + F+ KSDVW+FGI+L+E+ T+  +PYPGI  ++V  K+  GYRM  P+       CP E+Y+LM  CW   P  RP+F  I  +++T+ 
Sbjct:    9 IERTEIAMKHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEEFLKEASVMKGIKHQNLVQLLGVCT--REPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLVSEDIYTAHQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPE------GCPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTMF 269          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA0])

HSP 1 Score: 155.992 bits (393), Expect = 7.555e-43
Identity = 96/288 (33.33%), Postives = 159/288 (55.21%), Query Frame = 2
Query:  746 KEHIQIVSEIGKTSYGIVNRA----IWGKSYIVTA--KSLSISSSKRQQF--IDEVLLFNKL-RNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAK-----------LNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMID--EQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIV 1531
            + ++ I   +G+ ++G V RA    + G S   T   K L   +++++ F  + E+ +   + ++  I+ +LG CT+  H P+ ++ EY + G+L+ FL+  R  K           L LL++     +I++GM YL  +  +H +L + NILV  D  +KI+DFGL R +   +  +   D     KW+A EA  D ++T++SDVWSFGIV++EI+T+   PYPG+P  ++   +  GYRME P      V C  E+Y +M  CW+  PE RPTF+++    D L+ 
Sbjct:   56 RTYLVIREVLGEGAFGKVMRAEAFGLHGNSACTTVAVKMLKEDATEQELFDLVSEMEVMKSIGKHINIINLLGTCTQ--HGPLFVLVEYARWGNLRQFLRDRRPVKDYDDVMEPAETLTLLNLMTFCYQIAKGMEYLASRKCIHRDLAARNILVADDNILKIADFGLARDVHNVDYYRKTTDGRLPVKWMAFEALFDRVYTTQSDVWSFGIVVWEIITFGGTPYPGVPIEKLCMLLNTGYRMERP------VNCSKELYEIMRNCWNENPEARPTFTSLVQAFDDLVA 335          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 154.451 bits (389), Expect = 1.111e-42
Identity = 92/277 (33.21%), Postives = 149/277 (53.79%), Query Frame = 2
Query:  740 IKKEHIQIVSEIGKTSYGIVNRA-----IWGKSYI-VTAKSLSISSSKRQ--QFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARG--------AKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDK------WLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNI 1504
            + +E I+++ E+G  S+G+V        +  K    V  K++S ++S R   +F+ E  +    +   +V +LG+ ++ +  P +++ E + NG LK+FL+S R             L  M +   EI++GMAYL  +  VH +L + N +V+ +++VKI DFG+ R I E     +  K      W+APE+  D +FTS SDVWSFG+V++E+ T    PYPG    EV++ V+ G  M  P        CP  +++LM  CW   P+ RPTF +I
Sbjct:   13 VPREKIKLIRELGNGSFGMVYEGEATDIVPNKPKCKVAVKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDGQ--PTLVVMELMDNGDLKNFLRSHRPEVTMESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQPYPGKSNEEVLKYVVDGGVMPKPD------DCPDRLFDLMTLCWQFSPKARPTFLSI 281          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO35594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL46])

HSP 1 Score: 152.525 bits (384), Expect = 1.593e-42
Identity = 85/238 (35.71%), Postives = 133/238 (55.88%), Query Frame = 2
Query:  869 QQFIDEVLLFNKL-RNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAK-----------LNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLI 1528
            ++F+ E+ L  KL  +K IV  L  C      P +L+ E+L  G L D+L+  R  +           +   D+     +I+ GM YL +KG VH +L + N+LV  +  VK++DFGL R + E+   +         KW++PEA  D IFT++SDVWS+G+VL+EI T   APYP I   +V   + +GYRME P        C  E+Y +M  CW+++P+ RPTFS+++ + + ++
Sbjct:   12 EEFLKEISLMKKLGSHKNIVNFL--CCSTVKEPFMLVVEFLPKGDLLDYLRRNRSKQNDETGEQEDEMITPQDLLSFSYQIAAGMEYLSKKGFVHRDLAARNVLVADNKQVKVADFGLTRDLYEESAYQGHSNRKLPIKWMSPEAIYDQIFTTESDVWSYGVVLWEIATLGGAPYPTISTRDVFVMLRSGYRMEKPD------ICSDEVYTIMKHCWEDQPKKRPTFSDLRMKFEYML 241          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW8])

HSP 1 Score: 154.836 bits (390), Expect = 1.856e-42
Identity = 100/286 (34.97%), Postives = 155/286 (54.20%), Query Frame = 2
Query:  773 IGKTSYGIVNRA-IWG-------KSYIVTAKSLSISSS--KRQQFIDEVLLFNKL-RNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSAR--------------GAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVR 1534
            +G  ++G V +A I G       K  +V  K L+  ++   R+ F+ E+ +  +L ++  IV +LG  T      + LI EY   G L+++L++ R              G +L   D+     +I+ GM YL +K  VH +L + NIL+  D  VKISDFGL R + E  +  +         KW+APEA   ++ T+KSDVW+FG+VL+EI+T   +PYPG    E  +K+  GYRME P      +C P E+Y +M  CW + PE RPTF+ ++N+++ L+ R
Sbjct:   24 VGSGAFGKVTKATIVGLPGGPENKETVVAVKKLNAMATMEDRRNFLSEIEMMKQLGKHLNIVSILGCVTHAGQ--LCLITEYCPYGDLRNYLRAIRDKVSTRDSLAGRAPGRELTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDNLVKISDFGLTRDVYESSEYHKMHNTGKLPLKWMAPEAIFQNVHTTKSDVWAFGVVLWEIVTLGGSPYPGQSGKEFYKKLKNGYRMEKPD-----MCSP-ELYAMMRSCWASSPEDRPTFTKLRNQLEQLMDR 301          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: lyn (tyrosine-protein kinase Lyn [Source:NCBI gene;Acc:101167902])

HSP 1 Score: 254.218 bits (648), Expect = 2.792e-77
Identity = 156/449 (34.74%), Postives = 254/449 (56.57%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHF--KKHGIGKKNLPINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMI-DEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            IVI  Y Y+A+ S D+ F++ E M V++E  + W++   +     G +P NYV +   +    E W+   + R +AE+ LM P     +YLIR S+  K  Y +S++ +DN   +  VKH+ IR  K  N   + +   +F+D G +++H+  K  G+ +K   + +P V  +A  P       I K+ I++V ++G   +G V  A +  +  V  K+L   +   + F++E  +   L+++R+V +  + T  K  PI +I EY+ NGSL DFLKS  G KL L  + +  A+I+EGM+++E++  +H +L++ N+LV   +  KI+DFGL R+I D++    E      KW APEA     FT KSD+WSFG++L+EI+T+ K PYPG+   EV+  +  GYRM  P+       CP ++Y +M  CW  +PE RPTF  +++ +D
Sbjct:   66 IVIGLYPYEAVHSDDLGFKKGEKMKVLEERGE-WWKARSLTTNKEGFIPCNYVAQ--ANTMETEEWFFKDLTRKDAERQLMAPANKPGSYLIRESETSKGSYSLSIRDRDNQGMDL-VKHYKIR--KLDNGGFFISPKISFNDIGSMVKHYHSKADGLCRK---LESPCVKPKAQKPWAKDAWEISKDSIKMVKKLGAGQFGEVWMAYYNNTTKVAVKTLKPGTMTVEAFLEEANIMKTLQHERLVRLYAVVT--KTEPIYIITEYMANGSLLDFLKSEVGGKLQLPKLIDFSAQIAEGMSFIEKRNYIHRDLRAANVLVSESLLCKIADFGLARVIEDDEYSAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITFGKIPYPGMTKGEVVSSIQRGYRMPRPE------NCPTQLYEIMTSCWKFRPEDRPTFEYMQSVLD 497          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: YES1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:101158313])

HSP 1 Score: 245.358 bits (625), Expect = 1.476e-73
Identity = 148/444 (33.33%), Postives = 243/444 (54.73%), Query Frame = 2
Query:  212 IAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC-IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGK-KNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMD 1519
            +A Y Y+A  S D++F++ +   ++   +  W+E   +    +G +PSNYV   D S Q+ E ++  + R +AE+LL+NP     T+L+R S+  K  Y +S++  D+  K  NVKH+ IR  K  N   Y    + F     +++H+ +H  G    L    P V  +   +      I +E +Q+  ++G+  +G V    W  +  V  K+L   +   + F+ E  +  KLR+ ++V +  + +E    PI ++ EY+  GSL DFLK   G  LNL+ + +  A+I++GMA++ER   +H +L++ NILV  ++  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ +M  CW  +P+ RPTF  +++ ++
Sbjct:  104 VALYDYEARTSDDLTFKKGDRFQIINNTEGDWWEARSITTGKKGYIPSNYVAPAD-SIQAEEWYFGKMGRKDAERLLLNPGNDRGTFLVRESETTKGAYSLSIRDWDS-AKGDNVKHYKIR--KLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHRLTTVCPTVKPQTQGLAKDAWEISRESLQLELKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLFAVVSE---EPIYIVTEYMSKGSLLDFLKEGEGKFLNLVMLVDMAAKIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQ------GCPESLHEMMKLCWKKEPDERPTFEYLQSFLE 534          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: blk (BLK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:101163706])

HSP 1 Score: 240.35 bits (612), Expect = 2.138e-72
Identity = 149/458 (32.53%), Postives = 249/458 (54.37%), Query Frame = 2
Query:  152 HDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSK-KKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTF 1495
            H  +  ++R  N S++  + +AQ+ + A    D+SF++ + + ++ E  + W     +     G +PSNYV + D     VE W+   + R E E+LL+ P     T+LIR S+  K  Y +S++  D    +  VKH+ IR + +     Y +  +TFS    +++++ +   G   + N P      + + P  H     I ++ +++  ++G   +G V    +  +  V  K+L   + + + F+ E  L  +L++ R+V +  + T+    PI+++ EY+ NGSL DFLKS  G KL +  + +  A+I+EGMAY+E+K  +H +L++ NILV   +  KI+DFGL R+I+ +   +E      KW APEA     FT KSDVWSFGI+L EI+T+ + PYPG+   EV++ +   YRM  P        CP E+Y++M+ CW  +PE RPTF
Sbjct:   27 HSPNNTAQRG-NTSLDNDVFVAQHDFKATNGSDLSFKKGDKLKILHERGE-WCLAKSISTGDEGYIPSNYVARADS--LEVEKWFFKDVSRRETERLLLAPGNKPGTFLIRESETSKGSYSLSIRDHDQQQGDV-VKHYKIRCLDKGG--FYISPSTTFSSLSELVKYYSRTADGLCERLNSPCKPK--DPQEPWAHD-EWEIPRDTLKMTKKLGAGQFGEVWMGYYKNTQKVAIKTLKEGTMEPEAFLQEANLMKQLQHDRLVRLHAVVTK---EPILIVTEYMVNGSLLDFLKSDEGGKLKMNKLIDMSAQIAEGMAYIEKKNYIHRDLRAANILVSETLHCKIADFGLARIIETEYTAQEGAKFPIKWTAPEAINFGTFTIKSDVWSFGILLTEIVTYGRIPYPGMTNPEVVRCLDQSYRMPRPD------DCPVELYDIMMMCWRQRPEERPTF 465          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: fyna (tyrosine-protein kinase fyna [Source:NCBI gene;Acc:101157019])

HSP 1 Score: 239.58 bits (610), Expect = 1.555e-71
Identity = 144/446 (32.29%), Postives = 234/446 (52.47%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWC--IERWEAEKLLMNPDVTNETYLIRPSKK-KRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIG---KKNLPINNPFVNVRAPPIHSVNMI-IKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIK 1507
            + +A Y Y+A    D+SF++ E   ++   +  W+E   +     G +PSNYV   D      E W+   + R +AE+ L++      T+LIR S+  K  Y +S++  D+   ++ VKH+ IR  K  N   Y    + F     +++H+     G   +   P +     +    + + ++  I +E +Q++  +G   +G V    W  +  V  K+L   +   + F++E  +  KLR+ ++V++  + +E    PI ++ EY+  GSL DFLK   G  L L ++ +  A+++ GMAY+ER   +H +L+S NILV   +  KI+DFGL R+I++             KW APEAA    FT KSDVWSFGI+L E++T  + PYPG+   EV+++V  GYRM  PQ       CP  ++ LMV+CW   PE RPTF  ++
Sbjct:   86 LFVALYDYEARTEDDLSFRKGERFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSI--QAEDWYFGKLGRKDAERQLLSSGNARGTFLIRESETTKGAYSLSIQDWDDIKGDH-VKHYKIR--KLDNGGYYITTRAQFETLQQLVQHYSARAAGLCCRLIAPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSE---EPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDGLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQ------DCPTSLHELMVQCWKKDPEERPTFEYLQ 517          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:101163900])

HSP 1 Score: 237.269 bits (604), Expect = 4.750e-71
Identity = 145/453 (32.01%), Postives = 244/453 (53.86%), Query Frame = 2
Query:  179 APNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW--CIERWEAEKLLMNPDVTNETYLIRPSKKKR-DYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAP-PIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKN 1510
             PN S    + IA Y Y+AI   D+ F++ + + +++E  + W++   +     G +PSNYV K        E W+   + R +AE+ L+       +++IR S+  R  Y +S++  D    +  VKH+ IR +   N   Y +   TF     ++ H+KK G G     + +P ++ +   P       I +  +++  ++G   +G V  A + K   V  K++   S   + F+ E  L  +L++ ++V +  + T  K  PI +I E+++ GSL DFLKS  G ++ L  + +  A+I+EGMAY+E+   +H +L++ NILV+  +  KI+DFGL R+I++      +      KW APEA     FT KSDVWSFGI+L EI+++ + PYPG+   EV++ +  GYRM+  +       CP E+Y++M+ CW NK E RPTF  +++
Sbjct:   45 GPNSSEGESVAIALYDYEAIHEGDLGFKKGDRLKILEESGE-WWKAKSISSGQEGFIPSNYVAKDT---LETEDWFFKGVSRKDAERQLLASGNKTGSFMIRDSETTRGSYSLSVRDHDPQAGD-TVKHYKIRTLD--NGGFYISPRITFRTLQELVSHYKKQGDGLCQ-SLTSPCLSPKPEKPWEKDAWEIPRSSLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFMMEANLMKRLQHDKLVRLNAVVT--KEEPIYIITEFMEKGSLLDFLKSDEGNRVQLPKLIDFSAQIAEGMAYIEQNNYIHRDLRAANILVNKALVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLTEIISYGRTPYPGMTNPEVIRSLEKGYRMQRLE------SCPTELYDIMLDCWKNKAEERPTFDYLQS 481          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000072546.1 (SMESG000072546.1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 485/488 (99.39%), Postives = 486/488 (99.59%), Query Frame = 2
Query:  125 MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDKWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS 1588
            MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW IERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLR+KRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDKWLAPE ATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS
Sbjct:    1 MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWYIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRHKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDKWLAPEVATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS 488          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000072546.1 (SMESG000072546.1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 471/488 (96.52%), Postives = 472/488 (96.72%), Query Frame = 2
Query:  125 MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDDKWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS 1588
            MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWW IERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLR+KRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERK              DYDMSVKISDFGLRRMIDEQLKDEEDDKWLAPE ATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS
Sbjct:    1 MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWYIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRHKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERK--------------DYDMSVKISDFGLRRMIDEQLKDEEDDKWLAPEVATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS 474          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000072548.1 (SMESG000072548.1)

HSP 1 Score: 448.358 bits (1152), Expect = 7.173e-153
Identity = 215/456 (47.15%), Postives = 311/456 (68.20%), Query Frame = 2
Query:  206 IVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD------KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYY 1555
            +V A+YKY A    DISF+  EVM V++ FD+ W  V     K +GLVP+NYV KQDGSPQSVE W  I+RWEAEKLLM   +   TY+IRPS+K+  + +S++  D   K + VKHF I+V  E    +Y   +  F D   +I+ ++K+GIG  ++P+ +P  +   PPIH  ++ I +E+I+I++EIG+  +G V++A WG++Y V AK L  + ++R++F+ E  + +KLR+++IVE+LG+CTEP+  P+I+I E+++ GSLK++LKS  G K NL  M    AEISEGMAYLE + +VH +L+++NILV  D++VK++DFGL  + +   +++E        KW APEAA   +FTSKSDVWSFGIV++EILTW   PYP  PA EV+ KV +GYRM NP+ + PGV CP EIY +M+ CW   P  RPTF++++ ++DTLIV N    +Y
Sbjct:   35 MVKAKYKYTATAETDISFEDKEVMFVLEVFDEHWLRVELKNSKLQGLVPANYVSKQDGSPQSVEAWREIQRWEAEKLLMRVGLQKGTYIIRPSRKENCFALSVRDFDEKKKIFLVKHFQIKVNIEDKNTLYSINVRGFPDILTLIQFYEKNGIGNSHVPLTDPLPDNYQPPIHFQDIEINRENIEILNEIGRGCFGSVHKAKWGRAYEVAAKMLQSTKAEREKFLQEAKIMHKLRHRKIVELLGVCTEPQDMPMIIIVEFMKFGSLKEYLKSDEGKKTNLSQMIHMMAEISEGMAYLESEKVVHRDLRADNILVADDLTVKVADFGLTEITEGANENQEKKNLRFPYKWTAPEAAKSKVFTSKSDVWSFGIVMYEILTWSNPPYPDTPAKEVIDKVSSGYRMPNPETFIPGVHCPDEIYKIMIDCWHADPAQRPTFASLQEQLDTLIVENASNGFY 490          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000077919.1 (SMESG000077919.1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.305e-141
Identity = 203/455 (44.62%), Postives = 311/455 (68.35%), Query Frame = 2
Query:  209 VIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD-----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKNEMDTLIVRNTFKSYYN 1558
            V A+YKY+A+  +DISF+ NE+M VV E D+ W EV+K + + +GL+PS+YV KQDGS +SV+GW  I+RWEAEKLLM   +   TY+IRPS+K+  + +S++     +K + V+HF I++ + K K++Y +G   F     +I+ F+K GIG   + + +PF +   PPIH  ++ I ++++ +++EIG   +G V RA WG++Y V  K ++ + S+R  F+ E  + +KLR+++IVE+LGIC+EP+ SPI++I E+++NGSLK +L S +   L+L  M    A+I+EGM+YLE K +VH +L+++NILVD D++VK++DFGL    D+  K+E  +     KW APEAA   IFTSKSD+WSFG+V++E++TW K PYP I A  V+  ++ GYRM NP+  +  V CP  IY +MV CW+ KPE RP+FS + +  D++IV +  K  +N
Sbjct:   39 VKAKYKYEAMREVDISFEINEIMQVVNEIDENWLEVVKPQSQIKGLIPSSYVSKQDGSQKSVDGWQDIQRWEAEKLLMKMGLEKGTYIIRPSRKENSFALSVRDLCKNSKIFRVRHFQIKISESKGKLLYISGNQKFYSIPSMIKFFQKTGIGNARIRLKSPFPDNYQPPIHFQDIEINRDNVNMLNEIGHGCFGSVYRAKWGRAYEVAVKVMNSTKSERNIFLQEAKIMHKLRHRKIVELLGICSEPQESPILIILEFMKNGSLKHYLNSDKERLLDLSKMVHMMADIAEGMSYLESKNVVHRDLRADNILVDLDLTVKVADFGLTEFKDD--KNEVKNTRFPFKWTAPEAAKSKIFTSKSDIWSFGVVMYEVVTWGKMPYPDILATRVIDILLTGYRMPNPETIYKDVKCPNIIYQIMVECWNGKPEKRPSFSCLLDRFDSIIVDDISKVDFN 491          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000045588.1 (SMESG000045588.1)

HSP 1 Score: 315.849 bits (808), Expect = 5.624e-101
Identity = 164/443 (37.02%), Postives = 260/443 (58.69%), Query Frame = 2
Query:  197 ERMIVIAQYKYDAIGSMDISFQQNEVMVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWEAEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVIKEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKK-NLPINNPFVNVRAPPIHSVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQFIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSARGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKISDFGLRRMIDEQLKDEEDD----KWLAPEAATDHIFTSKSDVWSFGIVLFEILTWCKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNKPELRPTFSNIKN 1510
            +R  V A + Y+A  + D+ F + ++M +  +  + W+  +    K  G +PSNYV+  DGSP S EGW+ I   EA+K L+       TY+IRP    + Y +S++  D     Y VKH+ IR + + N   Y +  S F +   +I++++ +  G    L ++ P      PPI   ++ + ++ I++   +G  S+G V    W  S  V  K L  +S  R +FI E  L +KL + RIV++LG+CT+P   P+ +I E + NG+L ++L+S  G KL L +M +  ++I+EGMAYLE +  VH +L++ NILVD D+SVK++DFGL R+ D+    +       KW APEA     F+ KSDVWSFG++++EI+T+ + PYPGIP  +V+ +V  GYR+ NP      + CP E+Y + ++CWD  PE RPTFS++++
Sbjct:   65 QRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTL-DNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCP--QRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAG--GKIVCPDELYAIKLKCWDAYPENRPTFSHLQD 502          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCK9.585e-7834.96HCK proto-oncogene, Src family tyrosine kinase [So... [more]
HCK9.585e-7834.96HCK proto-oncogene, Src family tyrosine kinase [So... [more]
HCK9.585e-7834.96HCK proto-oncogene, Src family tyrosine kinase [So... [more]
HCK1.106e-7734.96HCK proto-oncogene, Src family tyrosine kinase [So... [more]
HCK1.626e-7734.96HCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
src-21.782e-6529.72Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
src-12.576e-6329.98Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.064e-6229.98Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.064e-6229.98Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.285e-6229.98Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Src64B1.119e-6830.63gene:FBgn0262733 transcript:FBtr0100508[more]
Src64B1.119e-6830.63gene:FBgn0262733 transcript:FBtr0100505[more]
Src64B1.119e-6830.63gene:FBgn0262733 transcript:FBtr0100504[more]
Src64B1.119e-6830.63gene:FBgn0262733 transcript:FBtr0304990[more]
Src64B1.119e-6830.63gene:FBgn0262733 transcript:FBtr0304989[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyn2.294e-8236.97LYN proto-oncogene, Src family tyrosine kinase [So... [more]
blk3.882e-7232.10BLK proto-oncogene, Src family tyrosine kinase [So... [more]
blk3.882e-7232.10BLK proto-oncogene, Src family tyrosine kinase [So... [more]
blk3.882e-7232.10BLK proto-oncogene, Src family tyrosine kinase [So... [more]
fyna2.957e-7132.51FYN proto-oncogene, Src family tyrosine kinase a [... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd2l1.593e-7333.69programmed cell death 2-like [Source:Xenbase;Acc:X... [more]
yes14.961e-7333.41YES proto-oncogene 1, Src family tyrosine kinase [... [more]
yes15.565e-7333.41YES proto-oncogene 1, Src family tyrosine kinase [... [more]
yes16.528e-7333.41YES proto-oncogene 1, Src family tyrosine kinase [... [more]
yes16.798e-7333.41YES proto-oncogene 1, Src family tyrosine kinase [... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hck1.706e-7834.87hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI... [more]
Hck1.706e-7834.87hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI... [more]
Hck2.977e-7835.31hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI... [more]
Hck3.072e-7835.31hemopoietic cell kinase [Source:MGI Symbol;Acc:MGI... [more]
Lyn2.281e-7134.53LYN proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42687|SPK1_GIRTI1.425e-16047.07Tyrosine-protein kinase SPK-1 OS=Girardia tigrina ... [more]
sp|P08103|HCK_MOUSE2.082e-7735.31Tyrosine-protein kinase HCK OS=Mus musculus OX=100... [more]
sp|Q95M30|HCK_MACFA8.362e-7735.18Tyrosine-protein kinase HCK OS=Macaca fascicularis... [more]
sp|P08631|HCK_HUMAN9.576e-7734.96Tyrosine-protein kinase HCK OS=Homo sapiens OX=960... [more]
sp|P50545|HCK_RAT5.019e-7635.18Tyrosine-protein kinase HCK OS=Rattus norvegicus O... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ET401.236e-9836.92Uncharacterized protein OS=Mesocestoides corti OX=... [more]
W6U3R52.761e-9836.84Tyrosine-protein kinase OS=Echinococcus granulosus... [more]
I4ENX21.052e-9736.84Tyrosine-protein kinase OS=Echinococcus multilocul... [more]
A0A087VZ063.402e-9736.84Tyrosine-protein kinase OS=Echinococcus multilocul... [more]
A0A068WX093.680e-9736.84Tyrosine-protein kinase OS=Echinococcus granulosus... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyn3.658e-8137.19tyrosine-protein kinase Lyn-like [Source:NCBI gene... [more]
hck2.838e-7432.66HCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSAMXT00000007450.22.586e-7132.43YES proto-oncogene 1, Src family tyrosine kinase [... [more]
clul16.501e-7133.11tyrosine-protein kinase yes [Source:NCBI gene;Acc:... [more]
fyna1.562e-7032.06tyrosine-protein kinase fyna [Source:NCBI gene;Acc... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frk1.441e-7232.17fyn-related Src family tyrosine kinase [Source:ZFI... [more]
hck2.471e-7231.57HCK proto-oncogene, Src family tyrosine kinase [So... [more]
clul15.179e-7132.89clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
hck7.891e-7032.31HCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSPMAT00000006670.15.228e-6131.91pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC151.022e-1626.22Protein kinase of the Mitotic Exit Network; locali... [more]
CLA45.271e-1529.48Cdc42p-activated signal transducing kinase; member... [more]
BCK15.111e-1428.77MAPKKK acting in the protein kinase C signaling pa... [more]
STE116.410e-1429.44Signal transducing MEK kinase; involved in pheromo... [more]
SKM19.874e-1429.71Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471959.861e-5233.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493157.555e-4333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476521.111e-4233.21Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO355941.593e-4235.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491261.856e-4234.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyn2.792e-7734.74tyrosine-protein kinase Lyn [Source:NCBI gene;Acc:... [more]
YES11.476e-7333.33YES proto-oncogene 1, Src family tyrosine kinase [... [more]
blk2.138e-7232.53BLK proto-oncogene, Src family tyrosine kinase [So... [more]
fyna1.555e-7132.29tyrosine-protein kinase fyna [Source:NCBI gene;Acc... [more]
hck4.750e-7132.01HCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072546.10.000e+099.39SMESG000072546.1[more]
SMESG000072546.10.000e+096.52SMESG000072546.1[more]
SMESG000072548.17.173e-15347.15SMESG000072548.1[more]
SMESG000077919.11.305e-14144.62SMESG000077919.1[more]
SMESG000045588.15.624e-10137.02SMESG000045588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017383 ID=SMED30017383|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1713bp
ACCGTTCAAAGTCAAGAATTCAGTCAACATAGAATGTGTTTCAGCTATTG
AAAACATTGCAATCATTGTAAAACCATTTCATACCTGAATTATTTGATTT
TCGGCGAAGGTTATCCTTTGTAAAATGGGCCAATATTTTTCATCAAAATT
ACATGACAACAGTGCATTGAGCAAAAGAGCTCCCAATTATTCGATGGAAA
GAATGATCGTCATTGCACAGTACAAATACGACGCTATAGGATCAATGGAC
ATCTCTTTCCAGCAAAACGAAGTAATGGTAGTTGTGAAAGAATTTGATCA
ATTCTGGTATGAAGTCATCAAAATGAAGGATAAAACAAGAGGTTTAGTGC
CTTCAAATTATGTCATGAAACAAGACGGTAGTCCTCAAAGTGTTGAAGGA
TGGTGGTGTATAGAAAGGTGGGAAGCTGAGAAGCTATTAATGAATCCAGA
CGTGACAAACGAAACATATCTTATAAGACCTTCAAAAAAAAAAAGAGATT
ACATTATATCGCTAAAGAAGCAAGACAATTATACAAAGGAGTACAATGTC
AAGCATTTTATAATCAGGGTCATAAAAGAGAAAAACAAAGTTATTTACTT
CAATGGTTTGTCTACATTTTCAGATTTTGGAATGATAATCGAACATTTTA
AAAAACACGGAATAGGAAAGAAAAACTTGCCAATAAACAATCCATTTGTT
AATGTCAGGGCCCCTCCAATTCATTCAGTGAACATGATTATCAAAAAAGA
ACATATACAAATCGTTTCAGAGATTGGAAAGACGTCGTACGGTATTGTCA
ATAGGGCAATCTGGGGGAAGTCGTATATAGTTACTGCGAAATCACTTTCC
ATAAGCTCATCAAAAAGACAACAGTTTATAGATGAAGTTTTATTATTTAA
TAAACTACGAAACAAAAGAATAGTCGAAGTCTTGGGAATATGTACGGAAC
CGAAACATTCGCCAATTATTCTAATTTGTGAATATTTACAAAATGGTTCT
TTGAAAGATTTTCTGAAATCGGCTAGAGGAGCTAAATTAAATTTGTTGGA
CATGACTGAAAGATTTGCTGAGATTTCCGAAGGAATGGCTTATCTGGAAA
GGAAAGGTTTGGTTCACTGCAATTTAAAATCAGAAAATATACTTGTAGAT
TATGATATGAGTGTCAAAATTTCAGATTTTGGTCTAAGGAGAATGATTGA
TGAACAGTTAAAAGACGAAGAAGACGACAAATGGCTAGCGCCCGAAGCAG
CTACTGATCATATTTTCACATCAAAATCGGATGTCTGGTCTTTCGGTATT
GTGCTCTTTGAAATCCTAACATGGTGTAAAGCACCTTACCCAGGGATTCC
TGCAAATGAAGTAATGCAAAAGGTAATTGCCGGATATAGGATGGAAAATC
CACAGTGCTATTTCCCCGGTGTATGCTGCCCTTGTGAAATTTATAATTTA
ATGGTTCGCTGCTGGGACAATAAACCTGAATTACGTCCAACATTTTCGAA
TATCAAAAACGAAATGGACACCTTGATAGTACGGAACACTTTCAAGTCAT
ATTACAACAACTGCAATGCTTCTGAATATTGTAATTCATGAAAAGAATGA
TTAAAAGAATGATGATAATTTTAGGAATAATAGAAAATGTCAACTTTTTT
TTATTAAAAAAATATGAAAATATATCTGCAAAACATGAGTATTGTTGGGT
TATTATTATTGAA
back to top

protein sequence of SMED30017383-orf-1

>SMED30017383-orf-1 ID=SMED30017383-orf-1|Name=SMED30017383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
MGQYFSSKLHDNSALSKRAPNYSMERMIVIAQYKYDAIGSMDISFQQNEV
MVVVKEFDQFWYEVIKMKDKTRGLVPSNYVMKQDGSPQSVEGWWCIERWE
AEKLLMNPDVTNETYLIRPSKKKRDYIISLKKQDNYTKEYNVKHFIIRVI
KEKNKVIYFNGLSTFSDFGMIIEHFKKHGIGKKNLPINNPFVNVRAPPIH
SVNMIIKKEHIQIVSEIGKTSYGIVNRAIWGKSYIVTAKSLSISSSKRQQ
FIDEVLLFNKLRNKRIVEVLGICTEPKHSPIILICEYLQNGSLKDFLKSA
RGAKLNLLDMTERFAEISEGMAYLERKGLVHCNLKSENILVDYDMSVKIS
DFGLRRMIDEQLKDEEDDKWLAPEAATDHIFTSKSDVWSFGIVLFEILTW
CKAPYPGIPANEVMQKVIAGYRMENPQCYFPGVCCPCEIYNLMVRCWDNK
PELRPTFSNIKNEMDTLIVRNTFKSYYNNCNASEYCNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036028SH3-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001452SH3_domain
IPR000980SH2
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004713protein tyrosine kinase activity
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 285..298
score: 45.58
coord: 366..376
score: 41.49
coord: 385..407
score: 57.7
coord: 323..341
score: 44.38
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 212..463
e-value: 2.2E-68
score: 230.4
IPR001452SH3 domainSMARTSM00326SH3_2coord: 27..84
e-value: 2.1E-12
score: 57.2
IPR001452SH3 domainPFAMPF00018SH3_1coord: 30..77
e-value: 2.2E-7
score: 30.4
IPR001452SH3 domainPROSITEPS50002SH3coord: 24..85
score: 18.633
IPR000980SH2 domainSMARTSM00252SH2_5coord: 91..181
e-value: 2.3E-11
score: 53.7
IPR000980SH2 domainPFAMPF00017SH2coord: 96..175
e-value: 5.9E-8
score: 32.7
IPR000980SH2 domainPROSITEPS50001SH2coord: 96..191
score: 12.599
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 86..187
e-value: 2.6E-12
score: 48.5
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 61..181
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 21..85
e-value: 1.4E-12
score: 48.8
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 203..470
e-value: 2.6E-72
score: 245.0
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 301..488
e-value: 1.2E-37
score: 127.2
coord: 219..316
e-value: 5.5E-5
score: 19.1
NoneNo IPR availablePANTHERPTHR24418:SF402TYROSINE PROTEIN-KINASE SRC-1coord: 25..471
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 25..471
NoneNo IPR availableCDDcd00192PTKccoord: 216..465
e-value: 6.94713E-82
score: 252.845
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 211..468
score: 36.4
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 12..85
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 191..462