DJ-1

Overview
NameDJ-1
Smed IDSMED30017379
Length (bp)1078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DJ-1 (SMED30017379) t-SNE clustered cells

Violin plots show distribution of expression levels for DJ-1 (SMED30017379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DJ-1 (SMED30017379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DJ-1 (SMED30017379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017379SMESG000003454.1 dd_Smed_v4_1223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017379SMESG000003454.1 dd_Smed_v4_1223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017379SMESG000003454.1 dd_Smed_v4_1223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017379SMESG000003454.1 dd_Smed_v4_1223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017379SMESG000003454.1 Contig52188newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017379SMESG000038196.1 SMESG000023001.1 SMESG000015236.1 SMESG000003454.1 Contig18756newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017379SMESG000038196.1 SMESG000023001.1 SMESG000015236.1 SMESG000003454.1 Contig18756uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017379SMESG000003454.1 Contig35504newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017379SMESG000003454.1 Contig35504uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DJ-1 vs. Ensembl Human
Match: PARK7 (Parkinsonism associated deglycase [Source:HGNC Symbol;Acc:HGNC:16369])

HSP 1 Score: 135.961 bits (341), Expect = 5.890e-38
Identity = 73/181 (40.33%), Postives = 108/181 (59.67%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLED K    YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    I  GS +T++P  KD++++   Y Y E RV  D  ++TSRGPGT+ EF L +VE L  ++    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Human
Match: PARK7 (Parkinsonism associated deglycase [Source:HGNC Symbol;Acc:HGNC:16369])

HSP 1 Score: 135.961 bits (341), Expect = 5.890e-38
Identity = 73/181 (40.33%), Postives = 108/181 (59.67%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLED K    YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    I  GS +T++P  KD++++   Y Y E RV  D  ++TSRGPGT+ EF L +VE L  ++    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Human
Match: PARK7 (Parkinsonism associated deglycase [Source:HGNC Symbol;Acc:HGNC:16369])

HSP 1 Score: 135.961 bits (341), Expect = 5.890e-38
Identity = 73/181 (40.33%), Postives = 108/181 (59.67%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLED K    YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    I  GS +T++P  KD++++   Y Y E RV  D  ++TSRGPGT+ EF L +VE L  ++    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Human
Match: PARK7 (Parkinsonism associated deglycase [Source:HGNC Symbol;Acc:HGNC:16369])

HSP 1 Score: 135.961 bits (341), Expect = 5.890e-38
Identity = 73/181 (40.33%), Postives = 108/181 (59.67%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLED K    YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    I  GS +T++P  KD++++   Y Y E RV  D  ++TSRGPGT+ EF L +VE L  ++    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Human
Match: PARK7 (Parkinsonism associated deglycase [Source:HGNC Symbol;Acc:HGNC:16369])

HSP 1 Score: 135.961 bits (341), Expect = 5.890e-38
Identity = 73/181 (40.33%), Postives = 108/181 (59.67%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLED K    YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    I  GS +T++P  KD++++   Y Y E RV  D  ++TSRGPGT+ EF L +VE L  ++    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Celegans
Match: djr-1.1 (Glutathione-independent glyoxalase DJR-1.1 [Source:UniProtKB/Swiss-Prot;Acc:P90994])

HSP 1 Score: 160.614 bits (405), Expect = 6.210e-48
Identity = 86/180 (47.78%), Postives = 122/180 (67.78%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 690
            I+ A G+E++EV+ T DVL+RG I VV AG++G+  VK A    IVPD  LEDV+T  +D VI+PGG  G   L+ +  V+++L +  ++  +IG+ICA P+ L + G+ A   +TS+PSVK++L    YKY E+RVVV   +ITSRGPGTA EF LK+VE+L+ +D    L   ML+KL
Sbjct:    9 ILAAEGAEEMEVIITGDVLARGEIRVVYAGLDGAEPVKCARGAHIVPDVKLEDVETEKFDIVILPGGQPGSNTLAESLLVRDVLKSQVESGGLIGAICAAPIALLSHGVKA-ELVTSHPSVKEKLEKGGYKYSEDRVVVSGKIITSRGPGTAFEFALKIVELLEGKDKATSLIAPMLLKL 187          
BLAST of DJ-1 vs. Ensembl Celegans
Match: djr-1.2 (Glutathione-independent glyoxalase DJR-1.2 [Source:UniProtKB/Swiss-Prot;Acc:O16228])

HSP 1 Score: 127.872 bits (320), Expect = 2.395e-35
Identity = 74/172 (43.02%), Postives = 106/172 (61.63%), Query Frame = 1
Query:  169 SEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLV 684
            +E+IEV+ T DVL RGG+ V+ AG   +  VK A    IVPD +L+DVK   +D +IIPGG G  K L+    + E+L    K+  +IG+ICAGP VL   GI A   +T + +VKD++    YKY ++ VV+   +ITS+GPGTA EF LK+VE L+  +    L + + +
Sbjct:   16 AEEIEVIVTGDVLVRGGLQVLYAG-SSTEPVKCAKGARIVPDVALKDVKNKTFDIIIIPGGPGCSK-LAECPVIGELLKTQVKSGGLIGAICAGPTVLLAHGIVA-ERVTCHYTVKDKMTEGGYKYLDDNVVISDRVITSKGPGTAFEFALKIVETLEGPEKTNSLLKPLCL 184          
BLAST of DJ-1 vs. Ensembl Fly
Match: dj-1beta (gene:FBgn0039802 transcript:FBtr0445215)

HSP 1 Score: 152.525 bits (384), Expect = 1.271e-44
Identity = 78/182 (42.86%), Postives = 121/182 (66.48%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVV-DRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLV 684
            +  +I+A G+E++E +  +DVL R GI V +AG+ G   VK +    I+PD SL  V +  +D V++PGG+GG  A+  +  V ++L + +    +I +ICA P VL+  G+A+G +LTSYPS+K QL++ +Y Y +++ VV D NLITSRGPGTA EF LK+ E L  ++ V+ +A+ +LV
Sbjct:    4 SALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVN-NYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184          
BLAST of DJ-1 vs. Ensembl Fly
Match: DJ-1alpha (gene:FBgn0033885 transcript:FBtr0087615)

HSP 1 Score: 133.65 bits (335), Expect = 4.495e-37
Identity = 76/179 (42.46%), Postives = 109/179 (60.89%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVV-DRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQML 681
            II+A G+E++E   ++DVL RG I V +AG+     VK +   VIVPD SLE+  T   YD V++PGG+ G KAL  +  V ++L   +    +I +ICA P  L+  GI  G ++TS+P +K QL    Y Y +++ VV D N+ITSRGPGT  +F LK+ E L   +  K +A+ ML
Sbjct:   35 IILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQL-KELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAML 212          
BLAST of DJ-1 vs. Ensembl Zebrafish
Match: park7 (parkinson protein 7 [Source:NCBI gene;Acc:449674])

HSP 1 Score: 152.14 bits (383), Expect = 2.415e-44
Identity = 79/181 (43.65%), Postives = 116/181 (64.09%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDV-KTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSD-YKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ + + +I PD SLED  K   YD V++PGG+ G + LS +  VKE+L + +  K +I +ICAGP  L   GIA GST+T++P  KD++++ D YKY E RV  D N+ITSRGPGT+ EF L +VE L   +    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIAVTVAGLAGKEPVQCSREVMICPDSSLEDAHKQGPYDVVLLPGGLLGAQNLSESPAVKEVLKDQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKMMAGDHYKYSEARVQKDGNVITSRGPGTSFEFALTIVEELMGAEVAAQVKAPLILK 188          
BLAST of DJ-1 vs. Ensembl Xenopus
Match: hmgcl (3-hydroxy-3-methylglutaryl-CoA lyase [Source:Xenbase;Acc:XB-GENE-1002069])

HSP 1 Score: 150.599 bits (379), Expect = 1.333e-43
Identity = 77/181 (42.54%), Postives = 114/181 (62.98%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSD-YKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V  +DV+ R GI V IAG+ G   V  +   V+ PD SLE+ +T   YD V++PGG  G + LS +  VKE+L   +    +I +ICAGP  L+  G+  G T+T++P  KD+++++D YKY EERVV D N ITSRGPGT+ EF L +V  L  ++    +   +L+K
Sbjct:    8 LILAKGAEEMETVIPADVMRRAGIKVTIAGLSGKDPVLCSRDVVLCPDTSLEEARTQGPYDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKNGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNADHYKYSEERVVKDGNFITSRGPGTSFEFALMIVSTLVGKEVADQVKSPLLLK 188          
BLAST of DJ-1 vs. Ensembl Mouse
Match: Park7 (Parkinson disease (autosomal recessive, early onset) 7 [Source:MGI Symbol;Acc:MGI:2135637])

HSP 1 Score: 138.272 bits (347), Expect = 4.417e-39
Identity = 73/181 (40.33%), Postives = 109/181 (60.22%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   +I PD SLED KT   YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    +  G  +T++P  KD++++ S Y Y E RV  D  ++TSRGPGT+ EF L +VE L  +D    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Mouse
Match: Park7 (Parkinson disease (autosomal recessive, early onset) 7 [Source:MGI Symbol;Acc:MGI:2135637])

HSP 1 Score: 138.272 bits (347), Expect = 4.417e-39
Identity = 73/181 (40.33%), Postives = 109/181 (60.22%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   +I PD SLED KT   YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    +  G  +T++P  KD++++ S Y Y E RV  D  ++TSRGPGT+ EF L +VE L  +D    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Mouse
Match: Park7 (Parkinson disease (autosomal recessive, early onset) 7 [Source:MGI Symbol;Acc:MGI:2135637])

HSP 1 Score: 138.272 bits (347), Expect = 4.417e-39
Identity = 73/181 (40.33%), Postives = 109/181 (60.22%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   +I PD SLED KT   YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    +  G  +T++P  KD++++ S Y Y E RV  D  ++TSRGPGT+ EF L +VE L  +D    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Mouse
Match: Park7 (Parkinson disease (autosomal recessive, early onset) 7 [Source:MGI Symbol;Acc:MGI:2135637])

HSP 1 Score: 138.272 bits (347), Expect = 4.417e-39
Identity = 73/181 (40.33%), Postives = 109/181 (60.22%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   +I PD SLED KT   YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    +  G  +T++P  KD++++ S Y Y E RV  D  ++TSRGPGT+ EF L +VE L  +D    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQVKAPLVLK 188          
BLAST of DJ-1 vs. Ensembl Mouse
Match: Park7 (Parkinson disease (autosomal recessive, early onset) 7 [Source:MGI Symbol;Acc:MGI:2135637])

HSP 1 Score: 133.265 bits (334), Expect = 3.183e-37
Identity = 69/163 (42.33%), Postives = 101/163 (61.96%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVE 633
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   +I PD SLED KT   YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L    +  G  +T++P  KD++++ S Y Y E RV  D  ++TSRGPGT+ EF L +V+
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVD 170          
BLAST of DJ-1 vs. UniProt/SwissProt
Match: sp|P90994|DJ11_CAEEL (Glutathione-independent glyoxalase DJR-1.1 OS=Caenorhabditis elegans OX=6239 GN=djr-1.1 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.899e-47
Identity = 86/180 (47.78%), Postives = 122/180 (67.78%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 690
            I+ A G+E++EV+ T DVL+RG I VV AG++G+  VK A    IVPD  LEDV+T  +D VI+PGG  G   L+ +  V+++L +  ++  +IG+ICA P+ L + G+ A   +TS+PSVK++L    YKY E+RVVV   +ITSRGPGTA EF LK+VE+L+ +D    L   ML+KL
Sbjct:    9 ILAAEGAEEMEVIITGDVLARGEIRVVYAGLDGAEPVKCARGAHIVPDVKLEDVETEKFDIVILPGGQPGSNTLAESLLVRDVLKSQVESGGLIGAICAAPIALLSHGVKA-ELVTSHPSVKEKLEKGGYKYSEDRVVVSGKIITSRGPGTAFEFALKIVELLEGKDKATSLIAPMLLKL 187          
BLAST of DJ-1 vs. UniProt/SwissProt
Match: sp|Q9VA37|DJ1B_DROME (Protein dj-1beta OS=Drosophila melanogaster OX=7227 GN=dj-1beta PE=1 SV=3)

HSP 1 Score: 152.525 bits (384), Expect = 1.274e-43
Identity = 78/182 (42.86%), Postives = 121/182 (66.48%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVV-DRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLV 684
            +  +I+A G+E++E +  +DVL R GI V +AG+ G   VK +    I+PD SL  V +  +D V++PGG+GG  A+  +  V ++L + +    +I +ICA P VL+  G+A+G +LTSYPS+K QL++ +Y Y +++ VV D NLITSRGPGTA EF LK+ E L  ++ V+ +A+ +LV
Sbjct:    4 SALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVN-NYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184          
BLAST of DJ-1 vs. UniProt/SwissProt
Match: sp|Q5XJ36|PARK7_DANRE (Parkinson disease protein 7 homolog OS=Danio rerio OX=7955 GN=park7 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.823e-43
Identity = 79/181 (43.65%), Postives = 116/181 (64.09%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDV-KTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSD-YKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ + + +I PD SLED  K   YD V++PGG+ G + LS +  VKE+L + +  K +I +ICAGP  L   GIA GST+T++P  KD++++ D YKY E RV  D N+ITSRGPGT+ EF L +VE L   +    +   +++K
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIAVTVAGLAGKEPVQCSREVMICPDSSLEDAHKQGPYDVVLLPGGLLGAQNLSESPAVKEVLKDQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKMMAGDHYKYSEARVQKDGNVITSRGPGTSFEFALTIVEELMGAEVAAQVKAPLILK 188          
BLAST of DJ-1 vs. UniProt/SwissProt
Match: sp|Q5E946|PARK7_BOVIN (Parkinson disease protein 7 homolog OS=Bos taurus OX=9913 GN=PARK7 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.449e-40
Identity = 76/165 (46.06%), Postives = 105/165 (63.64%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTM-LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVL 639
            +I+A G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLED K    YD V++PGG  G + LS +  VKE+L   +K K +I +ICAGP  L    I  GS +T++P  KD++++ S Y Y E RV  D  ++TSRGPGT+ EF LK+VEVL
Sbjct:    8 VILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALKIVEVL 172          
BLAST of DJ-1 vs. UniProt/SwissProt
Match: sp|Q8UW59|PARK7_CHICK (Protein/nucleic acid deglycase DJ-1 OS=Gallus gallus OX=9031 GN=PARK7 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.652e-39
Identity = 72/181 (39.78%), Postives = 114/181 (62.98%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDV-KTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I+A G+E++E V  +DV+ R GI V +AG+ G   V+ +   +I PD SLED  K   YD +++PGG  G + LS +  VK++L + +  K +I +ICAGP  L   GI  GS + ++P  KD++++ + Y Y E RV  D N++TSRGPGT+ EFGL +VE L  ++  + +   +++K
Sbjct:    8 VILAKGAEEMETVIPTDVMRRAGIKVTVAGLTGKEPVQCSRDVLICPDASLEDARKEGPYDVIVLPGGNLGAQNLSESAAVKDILKDQESRKGLIAAICAGPTALLAHGIGFGSKVITHPLAKDKMMNGAHYCYSESRVEKDGNILTSRGPGTSFEFGLAIVEALMGKEVAEQVKAPLILK 188          
BLAST of DJ-1 vs. TrEMBL
Match: L0MXG7 (DJ-1 OS=Dugesia japonica OX=6161 GN=DJ-1 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 4.188e-114
Identity = 167/185 (90.27%), Postives = 176/185 (95.14%), Query Frame = 1
Query:  136 MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 690
            MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVI GMEGSGNVKLAHKTVIV +KSL DVKT LYDA+IIPGGMGGVKA+S NENVKEMLYNHQKNKKVIG+ICAGPLVLS FG+AAGSTLTSYPSVKDQL S+DYKYKEERVVVDRNL+TSRGPGTA+EFGLKLVEVLK  +AVKGLAEQMLVKL
Sbjct:    1 MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIVGMEGSGNVKLAHKTVIVVEKSLADVKTTLYDALIIPGGMGGVKAMSANENVKEMLYNHQKNKKVIGAICAGPLVLSAFGVAAGSTLTSYPSVKDQLTSADYKYKEERVVVDRNLVTSRGPGTAVEFGLKLVEVLKGAEAVKGLAEQMLVKL 185          
BLAST of DJ-1 vs. TrEMBL
Match: A0A0K8RKN1 (Putative transcriptional regulator dj-1 OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.659e-51
Identity = 87/184 (47.28%), Postives = 127/184 (69.02%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSL-EDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 690
            T  +I+A G+E++E + ++DVL R GIDV IAG+ G+  VK +   V+VPDKSL E VK   YD V++PGG+ G ++L+ +  V ++L + +K+ +++ +ICA P+ L + G+  G  +TS+PS KD++ + DYKY E RVVVD  LITSRGPGTA EF L +VE L+N+ A   L   MLVK+
Sbjct:   45 TALLILAEGAEEMEAIISADVLRRAGIDVTIAGLTGTSPVKCSRDVVVVPDKSLDEAVKQSPYDVVVLPGGLKGSESLAASATVGKILKDQEKSGRLVAAICAAPIALKSHGVGCGKQVTSHPSKKDEVAAGDYKYSESRVVVDGQLITSRGPGTAFEFALAIVEKLENKQAADKLISPMLVKV 228          
BLAST of DJ-1 vs. TrEMBL
Match: T1PFP0 (DJ-1_PfpI domain-containing protein OS=Musca domestica OX=7370 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.488e-50
Identity = 90/182 (49.45%), Postives = 121/182 (66.48%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKY-KEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLV 684
            T  +I+ANG+E++E V  +D L R GI V +AG+ GS  VK +   VIVPD SLE VK   +D VI+PGG+GG KAL+ +  V E+L   +K  +++ +ICA P  L+ F I  G +LTSYPS K QL  S YKY  +++VV D NLITSRGPGTA +FGLK+ EVL   +    +A+ ML+
Sbjct:    4 TALVILANGAEEMEFVIAADTLRRAGIAVTVAGLAGSEPVKCSRDVVIVPDTSLESVKATKFDVVILPGGLGGSKALAASAMVGEILKQQEKENRIVAAICAAPTALAAFDIGKGKSLTSYPSFKSQL-ESHYKYIDDQKVVQDGNLITSRGPGTAFDFGLKIAEVLAGPEKAAEVAKGMLL 184          
BLAST of DJ-1 vs. TrEMBL
Match: A0A0N4WCT8 (DJ-1_PfpI domain-containing protein OS=Haemonchus placei OX=6290 GN=HPLM_LOCUS8349 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.492e-50
Identity = 88/183 (48.09%), Postives = 125/183 (68.31%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 690
            T  +I+A+G+E++E V T+DVL RGGI+V +AG+ G G V  A KTVI+PD+ L+DV++  +D VI+PGG  G   L+ +  V ++L  H K  K + +ICA P+ L + GI A + +TS+PSV+ QL    +KY E+RVVV   ++TSRGPGTA EFGLKLVE+L   +  K L   ML+K+
Sbjct:    4 TALLILADGAEEMEAVITADVLRRGGIEVTLAGLNGPGKVTCARKTVIIPDRDLKDVQSTTFDVVILPGGQPGSNTLAASPVVGQILKAHHKAGKYVAAICAAPISLKSHGIPA-ALVTSHPSVRSQLEEGGFKYSEDRVVVSDLVVTSRGPGTAFEFGLKLVELLVGAEKSKSLISPMLLKV 185          
BLAST of DJ-1 vs. TrEMBL
Match: A0A1I8NIM1 (DJ-1_PfpI domain-containing protein OS=Musca domestica OX=7370 GN=101899019 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.338e-50
Identity = 90/182 (49.45%), Postives = 121/182 (66.48%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKY-KEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLV 684
            T  +I+ANG+E++E V  +D L R GI V +AG+ GS  VK +   VIVPD SLE VK   +D VI+PGG+GG KAL+ +  V E+L   +K  +++ +ICA P  L+ F I  G +LTSYPS K QL  S YKY  +++VV D NLITSRGPGTA +FGLK+ EVL   +    +A+ ML+
Sbjct:   28 TALVILANGAEEMEFVIAADTLRRAGIAVTVAGLAGSEPVKCSRDVVIVPDTSLESVKATKFDVVILPGGLGGSKALAASAMVGEILKQQEKENRIVAAICAAPTALAAFDIGKGKSLTSYPSFKSQL-ESHYKYIDDQKVVQDGNLITSRGPGTAFDFGLKIAEVLAGPEKAAEVAKGMLL 208          
BLAST of DJ-1 vs. Ensembl Cavefish
Match: park7 (Parkinsonism associated deglycase [Source:NCBI gene;Acc:103030353])

HSP 1 Score: 148.673 bits (374), Expect = 4.906e-43
Identity = 78/181 (43.09%), Postives = 113/181 (62.43%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDV-KTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSD-YKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I++ G+E++E V   DV+ R GI V +AG+ G   V+ +   +I PD SLE+  K   YD V++PGG  G + LS +  VKE+L   +  K +I +ICAGP  L   GIA GST+T++P  KD++++ D YKY E RV  D NLITSRGPGT+ EF L +VE L   +    +   +++K
Sbjct:    8 VILSKGAEEMETVIPVDVMRRAGIAVTVAGLTGKEPVQCSRDVLICPDSSLEEASKQGPYDVVLLPGGALGAQNLSESPAVKEVLKEQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKMMTGDHYKYSEARVQKDGNLITSRGPGTSFEFALTIVEELMGAEVAAQVKAPLILK 188          
BLAST of DJ-1 vs. Ensembl Sea Lamprey
Match: park7 (parkinson protein 7 [Source:NCBI gene;Acc:449674])

HSP 1 Score: 133.65 bits (335), Expect = 5.576e-38
Identity = 74/165 (44.85%), Postives = 101/165 (61.21%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTML---YDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLIS-SDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVE 633
            +I+A G+E++E V  +DVL R GI V +AG+ G   V+ +   VI PD SLE  K M    YD V++PGG  G + L+ +  VK +L      K +I +ICAGP  L   GIA GS +T++P  KD+++    Y Y E RV  D N+ITSRGPGT+ EF L +VE
Sbjct:    8 VILAKGAEEMETVIPTDVLRRAGIKVTLAGLAGPEPVQCSRDVVICPDTSLE--KAMAEGPYDVVVLPGGNLGAQNLAESAAVKLVLQAQMDRKGLIAAICAGPTALKAHGIAFGSKVTTHPLAKDKMMEGGHYVYSEARVERDGNVITSRGPGTSFEFALFIVE 170          
BLAST of DJ-1 vs. Ensembl Nematostella
Match: EDO36318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ12])

HSP 1 Score: 162.155 bits (409), Expect = 1.077e-48
Identity = 82/185 (44.32%), Postives = 121/185 (65.41%), Query Frame = 1
Query:  142 TVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLED-VKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISS-DYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQD-AVKGLAEQMLVK 687
            +  +I+A G+E++E V T+DVL RG ++ V+AG+ G   V  + +  + PD  LED +K + YDAVI+PGG+ G + L+ ++ V ++L    +  +++ +ICAGP  L   G+  G  +TSYPS KD++     Y Y E+RVV D NLITSRGPGTA EFG++LV  ++  D A  GLA QML+K
Sbjct:    8 SALVILAEGAEEMEAVITADVLRRGKVNTVVAGLTGPDPVVCSRQVQVKPDMGLEDALKKVPYDAVILPGGLTGAQNLAKSDQVGQILREQYEAGRIVAAICAGPTALLAHGVGGGKRVTSYPSFKDKMTGKYGYTYSEDRVVRDGNLITSRGPGTAFEFGIELVRAIRGDDGAADGLASQMLLK 192          
BLAST of DJ-1 vs. Ensembl Nematostella
Match: EDO26997 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAH4])

HSP 1 Score: 62.7734 bits (151), Expect = 4.476e-13
Identity = 32/51 (62.75%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  538 YKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQD-AVKGLAEQMLVK 687
            Y Y E+RVV D NLITSRGPGTA EFG++LV  ++  D A  GLA QML+K
Sbjct:    1 YTYSEDRVVRDGNLITSRGPGTAFEFGIELVRAIRGDDGAADGLASQMLLK 51          
BLAST of DJ-1 vs. Ensembl Medaka
Match: park7 (Parkinsonism associated deglycase [Source:NCBI gene;Acc:100049299])

HSP 1 Score: 146.747 bits (369), Expect = 2.383e-42
Identity = 76/181 (41.99%), Postives = 114/181 (62.98%), Query Frame = 1
Query:  151 IIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDV-KTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSD-YKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK 687
            +I++ G+E++E V   DV+ R GI V +AG+ G   V+ +   VI PD SLE+  K   YD V++PGGM G + L+ +  VKE+L +    K +I +ICAGP  L   GI  GST+T++P++K+++++ D YKY E RV  D + ITSRGPGT+ EF L +VE L   D    +   +++K
Sbjct:    8 VILSKGAEEMETVIPVDVMRRAGIAVTVAGLTGKEPVQCSRNVVICPDTSLEEASKQGPYDVVLLPGGMPGAQNLAESPAVKEVLKDQDGRKGLIAAICAGPTALLAHGIGFGSTVTTHPAMKEKMMAGDHYKYSEARVQKDGHYITSRGPGTSFEFALTIVEELMGADVATQVKAPLILK 188          
BLAST of DJ-1 vs. Planmine SMEST
Match: SMESG000003454.1 (SMESG000003454.1)

HSP 1 Score: 367.081 bits (941), Expect = 8.621e-129
Identity = 184/185 (99.46%), Postives = 184/185 (99.46%), Query Frame = 1
Query:  136 MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 690
            MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKT LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL
Sbjct:    1 MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTTLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL 185          
BLAST of DJ-1 vs. Planmine SMEST
Match: SMESG000003454.1 (SMESG000003454.1)

HSP 1 Score: 367.081 bits (941), Expect = 1.308e-128
Identity = 188/206 (91.26%), Postives = 192/206 (93.20%), Query Frame = 1
Query:  136 MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL*FRHFSYIIRLFVY*HHRCFY 753
            MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKT LYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK       +II +F++   R  Y
Sbjct:    1 MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVIVPDKSLEDVKTTLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIGSICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLITSRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVK-------FIIGVFMFDLLRIIY 199          
The following BLAST results are available for this feature:
BLAST of DJ-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PARK75.890e-3840.33Parkinsonism associated deglycase [Source:HGNC Sym... [more]
PARK75.890e-3840.33Parkinsonism associated deglycase [Source:HGNC Sym... [more]
PARK75.890e-3840.33Parkinsonism associated deglycase [Source:HGNC Sym... [more]
PARK75.890e-3840.33Parkinsonism associated deglycase [Source:HGNC Sym... [more]
PARK75.890e-3840.33Parkinsonism associated deglycase [Source:HGNC Sym... [more]
back to top
BLAST of DJ-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
djr-1.16.210e-4847.78Glutathione-independent glyoxalase DJR-1.1 [Sourc... [more]
djr-1.22.395e-3543.02Glutathione-independent glyoxalase DJR-1.2 [Sourc... [more]
back to top
BLAST of DJ-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dj-1beta1.271e-4442.86gene:FBgn0039802 transcript:FBtr0445215[more]
DJ-1alpha4.495e-3742.46gene:FBgn0033885 transcript:FBtr0087615[more]
back to top
BLAST of DJ-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
park72.415e-4443.65parkinson protein 7 [Source:NCBI gene;Acc:449674][more]
back to top
BLAST of DJ-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hmgcl1.333e-4342.543-hydroxy-3-methylglutaryl-CoA lyase [Source:Xenba... [more]
back to top
BLAST of DJ-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Park74.417e-3940.33Parkinson disease (autosomal recessive, early onse... [more]
Park74.417e-3940.33Parkinson disease (autosomal recessive, early onse... [more]
Park74.417e-3940.33Parkinson disease (autosomal recessive, early onse... [more]
Park74.417e-3940.33Parkinson disease (autosomal recessive, early onse... [more]
Park73.183e-3742.33Parkinson disease (autosomal recessive, early onse... [more]
back to top
BLAST of DJ-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90994|DJ11_CAEEL7.899e-4747.78Glutathione-independent glyoxalase DJR-1.1 OS=Caen... [more]
sp|Q9VA37|DJ1B_DROME1.274e-4342.86Protein dj-1beta OS=Drosophila melanogaster OX=722... [more]
sp|Q5XJ36|PARK7_DANRE1.823e-4343.65Parkinson disease protein 7 homolog OS=Danio rerio... [more]
sp|Q5E946|PARK7_BOVIN7.449e-4046.06Parkinson disease protein 7 homolog OS=Bos taurus ... [more]
sp|Q8UW59|PARK7_CHICK1.652e-3939.78Protein/nucleic acid deglycase DJ-1 OS=Gallus gall... [more]
back to top
BLAST of DJ-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L0MXG74.188e-11490.27DJ-1 OS=Dugesia japonica OX=6161 GN=DJ-1 PE=2 SV=1[more]
A0A0K8RKN14.659e-5147.28Putative transcriptional regulator dj-1 OS=Ixodes ... [more]
T1PFP01.488e-5049.45DJ-1_PfpI domain-containing protein OS=Musca domes... [more]
A0A0N4WCT82.492e-5048.09DJ-1_PfpI domain-containing protein OS=Haemonchus ... [more]
A0A1I8NIM13.338e-5049.45DJ-1_PfpI domain-containing protein OS=Musca domes... [more]
back to top
BLAST of DJ-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
park74.906e-4343.09Parkinsonism associated deglycase [Source:NCBI gen... [more]
back to top
BLAST of DJ-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
park75.576e-3844.85parkinson protein 7 [Source:NCBI gene;Acc:449674][more]
back to top
BLAST of DJ-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DJ-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO363181.077e-4844.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269974.476e-1362.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DJ-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
park72.383e-4241.99Parkinsonism associated deglycase [Source:NCBI gen... [more]
back to top
BLAST of DJ-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000003454.18.621e-12999.46SMESG000003454.1[more]
SMESG000003454.11.308e-12891.26SMESG000003454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017379 ID=SMED30017379|Name=DJ-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1078bp
ATTTATATGGAAAATGGTTTTGGTATCTTCTAGACATTCTATTATTTGTT
TAAAAATAAACTTTTAACTAAATTCAATCTACTTTATTTTTTGTCTAGTC
TAGGATTTTCTAAAATTCTAACATTTTAATAATCAATGGTTACTGTTTGT
ATTATCGTAGCAAATGGATCAGAAGATATAGAAGTAGTTGCAACATCTGA
TGTTCTCAGTCGAGGAGGTATTGATGTTGTCATCGCTGGAATGGAAGGTT
CAGGCAATGTCAAATTAGCTCATAAAACAGTGATAGTACCTGACAAAAGC
TTGGAGGATGTTAAAACTATGTTATATGATGCGGTAATAATCCCTGGTGG
TATGGGGGGCGTTAAAGCATTGAGCACTAACGAGAATGTTAAAGAAATGC
TTTATAATCACCAGAAAAACAAAAAAGTTATTGGATCTATTTGTGCTGGT
CCATTAGTTTTGAGTACATTTGGTATTGCAGCTGGTTCGACTTTGACATC
TTATCCATCTGTAAAAGACCAACTAATAAGCTCAGATTACAAATATAAAG
AAGAGCGAGTTGTTGTTGATCGCAATCTCATCACAAGCCGAGGTCCAGGA
ACTGCAATAGAATTCGGGCTGAAATTGGTTGAAGTTTTGAAAAATCAAGA
CGCTGTCAAGGGTCTAGCGGAACAAATGCTTGTGAAATTGTAATTTCGAC
ATTTTAGTTATATAATTAGATTGTTTGTCTATTAGCATCATCGGTGTTTT
TATGTTTGATCTTTTGAGAATTATTTATTACGTTGGTTAGTTTCGGTGAA
GGATTTTTTATCGATTTAGCTGTAAAGTTAAGACTTAAATTAATATTGTT
TACGCAATTGAGTTATACAGTATTTTGAATAAAATCGATAATGAAAGTCG
GAAATTCTTTGAATGTTCTGAGTTTAAACTAATTCGAAAATGGAGGTATG
TTGGTTGGATAATGGAATGCAAAATCGTAACTTGTTTTAATTAACAATTT
CTCGACCAATTCTGTGTACTTTATTACAACTTTGACATTACCTGCAATTT
ATTGTGTTATTATTAAACAAATCGGTAC
back to top

protein sequence of SMED30017379-orf-1

>SMED30017379-orf-1 ID=SMED30017379-orf-1|Name=SMED30017379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MVTVCIIVANGSEDIEVVATSDVLSRGGIDVVIAGMEGSGNVKLAHKTVI
VPDKSLEDVKTMLYDAVIIPGGMGGVKALSTNENVKEMLYNHQKNKKVIG
SICAGPLVLSTFGIAAGSTLTSYPSVKDQLISSDYKYKEERVVVDRNLIT
SRGPGTAIEFGLKLVEVLKNQDAVKGLAEQMLVKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0000785chromatin
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005747mitochondrial respiratory chain complex I
GO:0005758mitochondrial intermembrane space
GO:0005759mitochondrial matrix
GO:0005783endoplasmic reticulum
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005913cell-cell adherens junction
GO:0016020membrane
GO:0016605PML body
GO:0043005neuron projection
GO:0044297cell body
GO:0045121membrane raft
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome
GO:0098793presynapse
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR006287DJ-1
IPR002818DJ-1/PfpI
IPR029062Class_I_gatase-like
Vocabulary: biological process
TermDefinition
GO:0001933negative regulation of protein phosphorylation
GO:0001963synaptic transmission, dopaminergic
GO:0002866positive regulation of acute inflammatory response to antigenic stimulus
GO:0006469negative regulation of protein kinase activity
GO:0006508proteolysis
GO:0006517protein deglycosylation
GO:0006914autophagy
GO:0006954inflammatory response
GO:0007005mitochondrion organization
GO:0007338single fertilization
GO:0008344adult locomotory behavior
GO:0010273detoxification of copper ion
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0018323enzyme active site formation via L-cysteine sulfinic acid
GO:0019249lactate biosynthetic process
GO:0031397negative regulation of protein ubiquitination
GO:0032091negative regulation of protein binding
GO:0032435negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032757positive regulation of interleukin-8 production
GO:0033138positive regulation of peptidyl-serine phosphorylation
GO:0033234negative regulation of protein sumoylation
GO:0033864positive regulation of NAD(P)H oxidase activity
GO:0034599cellular response to oxidative stress
GO:0034614cellular response to reactive oxygen species
GO:0036471cellular response to glyoxal
GO:0036525protein deglycation
GO:0036526peptidyl-cysteine deglycation
GO:0036527peptidyl-arginine deglycation
GO:0036528peptidyl-lysine deglycation
GO:0036529protein deglycation, glyoxal removal
GO:0036531glutathione deglycation
GO:0042177negative regulation of protein catabolic process
GO:0042542response to hydrogen peroxide
GO:0042743hydrogen peroxide metabolic process
GO:0043066negative regulation of apoptotic process
GO:0043523regulation of neuron apoptotic process
GO:0043524negative regulation of neuron apoptotic process
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0046295glycolate biosynthetic process
GO:0046826negative regulation of protein export from nucleus
GO:0050727regulation of inflammatory response
GO:0050787detoxification of mercury ion
GO:0050821protein stabilization
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051444negative regulation of ubiquitin-protein transferase activity
GO:0051583dopamine uptake involved in synaptic transmission
GO:0051881regulation of mitochondrial membrane potential
GO:0051899membrane depolarization
GO:0060081membrane hyperpolarization
GO:0060548negative regulation of cell death
GO:0060765regulation of androgen receptor signaling pathway
GO:0070301cellular response to hydrogen peroxide
GO:0090073positive regulation of protein homodimerization activity
GO:0098869cellular oxidant detoxification
GO:1900182positive regulation of protein localization to nucleus
GO:1901215negative regulation of neuron death
GO:1901671positive regulation of superoxide dismutase activity
GO:1901984negative regulation of protein acetylation
GO:1902177positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1902236negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1902958positive regulation of mitochondrial electron transport, NADH to ubiquinone
GO:1903094negative regulation of protein K48-linked deubiquitination
GO:1903122negative regulation of TRAIL-activated apoptotic signaling pathway
GO:1903168positive regulation of pyrroline-5-carboxylate reductase activity
GO:1903178positive regulation of tyrosine 3-monooxygenase activity
GO:1903181positive regulation of dopamine biosynthetic process
GO:1903189glyoxal metabolic process
GO:1903197positive regulation of L-dopa biosynthetic process
GO:1903200positive regulation of L-dopa decarboxylase activity
GO:1903202negative regulation of oxidative stress-induced cell death
GO:1903204negative regulation of oxidative stress-induced neuron death
GO:1903206negative regulation of hydrogen peroxide-induced cell death
GO:1903208negative regulation of hydrogen peroxide-induced neuron death
GO:1903377negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
GO:1903384negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway
GO:1903428positive regulation of reactive oxygen species biosynthetic process
GO:1905259negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway
GO:2000157negative regulation of ubiquitin-specific protease activity
GO:2000277positive regulation of oxidative phosphorylation uncoupler activity
GO:2000679positive regulation of transcription regulatory region DNA binding
GO:2000825positive regulation of androgen receptor activity
GO:2001237negative regulation of extrinsic apoptotic signaling pathway
GO:2001268negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0003713transcription coactivator activity
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0005102signaling receptor binding
GO:0005507copper ion binding
GO:0008134transcription factor binding
GO:0008233peptidase activity
GO:0016532superoxide dismutase copper chaperone activity
GO:0016684oxidoreductase activity, acting on peroxide as acceptor
GO:0016787hydrolase activity
GO:0019899enzyme binding
GO:0019900kinase binding
GO:0019955cytokine binding
GO:0036470tyrosine 3-monooxygenase activator activity
GO:0036478L-dopa decarboxylase activator activity
GO:0036524protein deglycase activity
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0044388small protein activating enzyme binding
GO:0044390ubiquitin-like protein conjugating enzyme binding
GO:0045296cadherin binding
GO:0045340mercury ion binding
GO:0050681androgen receptor binding
GO:0051920peroxiredoxin activity
GO:0070491repressing transcription factor binding
GO:0097110scaffold protein binding
GO:1903135cupric ion binding
GO:1903136cuprous ion binding
GO:1990381ubiquitin-specific protease binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002818DJ-1/PfpIPFAMPF01965DJ-1_PfpIcoord: 3..166
e-value: 8.8E-47
score: 159.0
IPR006287Protein/nucleic acid deglycase DJ-1TIGRFAMTIGR01383TIGR01383coord: 4..178
e-value: 5.3E-55
score: 183.9
IPR029062Class I glutamine amidotransferase-likeGENE3DG3DSA:3.40.50.880coord: 2..185
e-value: 1.0E-53
score: 183.9
IPR029062Class I glutamine amidotransferase-likeSUPERFAMILYSSF52317Class I glutamine amidotransferase-likecoord: 1..183
NoneNo IPR availablePANTHERPTHR43444:SF2PROTEIN/NUCLEIC ACID DEGLYCASE DJ-1coord: 3..183
NoneNo IPR availablePANTHERPTHR43444FAMILY NOT NAMEDcoord: 3..183
NoneNo IPR availableCDDcd03135GATase1_DJ-1coord: 4..168
e-value: 1.22257E-64
score: 194.309
NoneNo IPR availableTMHMMTMhelixcoord: 98..120