Aldose 1-epimerase

Overview
NameAldose 1-epimerase
Smed IDSMED30017378
Length (bp)1392
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aldose 1-epimerase (SMED30017378) t-SNE clustered cells

Violin plots show distribution of expression levels for Aldose 1-epimerase (SMED30017378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aldose 1-epimerase (SMED30017378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aldose 1-epimerase (SMED30017378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017378

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017378h1SMcG0013457 Contig5790GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017378h1SMcG0018656 Contig5790GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30017378h1SMcG0013457 dd_Smed_v4_1947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017378h1SMcG0013457 dd_Smed_v4_1947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017378h1SMcG0013457 dd_Smed_v4_1947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017378h1SMcG0013457 dd_Smed_v4_1947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30017378h1SMcG0013457 dd_Smed_v6_1947_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aldose 1-epimerase vs. Ensembl Human
Match: GALM (galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:24063])

HSP 1 Score: 166.007 bits (419), Expect = 1.403e-46
Identity = 109/321 (33.96%), Postives = 174/321 (54.21%), Query Frame = 2
Query:  305 KVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            +V+I+S G  + ++ +    KD+   + +VVLGF+ +E Y   + Y G V+GRVA R++ G F ++GK + +  N   N LHGG  G  +  W  +  +N  +     + D E+G+PG++ + V YT+     L+++Y A   + A P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G++ P+           +L   L     N  GFD+ +       +H  A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++   CLE QN+PDA+N   FP +LL+PGE+Y   T +KF
Sbjct:   30 RVDIISWGCTITALEV----KDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSN-GVQFSRISPDGEEGYPGELKVWVTYTLD-GGELIVNYRAQASQ-ATPVNLTNHSYFNLAGQASPN--INDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN--GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKF 339          
BLAST of Aldose 1-epimerase vs. Ensembl Human
Match: GALM (galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:24063])

HSP 1 Score: 106.301 bits (264), Expect = 3.561e-26
Identity = 68/192 (35.42%), Postives = 110/192 (57.29%), Query Frame = 2
Query:  305 KVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNG 880
            +V+I+S G  + ++ +    KD+   + +VVLGF+ +E Y   + Y G V+GRVA R++ G F ++GK + +  N   N LHGG  G  +  W  +  +N  +     + D E+G+PG++ + V YT+     L+++Y A   + A P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G
Sbjct:    3 RVDIISWGCTITALEV----KDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSN-GVQFSRISPDGEEGYPGELKVWVTYTLD-GGELIVNYRAQASQ-ATPVNLTNHSYFNLAGQASPN--INDHEVTIEADTYLPVDETLIPTG 185          
BLAST of Aldose 1-epimerase vs. Ensembl Human
Match: GALM (galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:24063])

HSP 1 Score: 100.908 bits (250), Expect = 5.848e-24
Identity = 65/194 (33.51%), Postives = 102/194 (52.58%), Query Frame = 2
Query:  629 TADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEF 1201
            + D E+G+PG++ + V YT+     L+++Y A   + A P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G++ P+           +L   L     N  GFD+ +       +H  A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++   CLE QN+PDA+N   F
Sbjct:   13 SPDGEEGYPGELKVWVTYTLD-GGELIVNYRAQASQ-ATPVNLTNHSYFNLAGQASPN--INDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN--GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQFPF 200          
BLAST of Aldose 1-epimerase vs. Ensembl Human
Match: GALM (galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:24063])

HSP 1 Score: 71.2478 bits (173), Expect = 8.653e-14
Identity = 37/99 (37.37%), Postives = 56/99 (56.57%), Query Frame = 2
Query:  971 GFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            GFD+ +       +H  A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++   CLE QN+PDA+N   FP +LL+PGE+Y   T +KF
Sbjct:   93 GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKF 191          
BLAST of Aldose 1-epimerase vs. Ensembl Celegans
Match: Y19D10A.16 (Aldose 1-epimerase [Source:UniProtKB/TrEMBL;Acc:G5ECR6])

HSP 1 Score: 130.568 bits (327), Expect = 5.170e-34
Identity = 92/339 (27.14%), Postives = 165/339 (48.67%), Query Frame = 2
Query:  281 EISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHC-------CEGIVHQQY---GALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            EI+NK      +L  GA +  +  P    DK+  + ++VLGF T++E+E +   +G  VGRVA R+     + +GK + +  NNG + LHGG  GL  + W++  H  +S++      + +DG PGD  I+V YT++  N L+I++ A  +     + LTNH+Y+NL G+  V     +H + + A + +E+     P G I  ++       +         ++ ++ K  +     D   +   +   S   T L  +++++G++L  +  +  +H        C+G   + Y    AL +E Q    A N   FP + L+PG+ Y Q+ +Y F  +
Sbjct:    7 EIANKQGLTATLLPFGATLAKLTFP----DKNGKNQDLVLGFDTIDEFEKDAASIGKTVGRVANRIKNSTLHFDGKQYTMTPNNGPHYLHGGPNGLGYRKWEVVRHAPESVSFSVRANEQDDGLPGDAKIDVTYTVNDRNQLIIEHHATCDTPGL-LALTNHAYWNLDGSDTV----AEHFLEMEADEFVEVDDTFCPTGAIRSVT-------DTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPPSTPSTYLRFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSAAPNFDHFPDVSLRPGDHYCQEIVYTFSHV 329          
BLAST of Aldose 1-epimerase vs. Ensembl Celegans
Match: C01B4.6 (Aldose 1-epimerase [Source:UniProtKB/TrEMBL;Acc:G5ECR6])

HSP 1 Score: 130.568 bits (327), Expect = 5.170e-34
Identity = 92/339 (27.14%), Postives = 165/339 (48.67%), Query Frame = 2
Query:  281 EISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHC-------CEGIVHQQY---GALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            EI+NK      +L  GA +  +  P    DK+  + ++VLGF T++E+E +   +G  VGRVA R+     + +GK + +  NNG + LHGG  GL  + W++  H  +S++      + +DG PGD  I+V YT++  N L+I++ A  +     + LTNH+Y+NL G+  V     +H + + A + +E+     P G I  ++       +         ++ ++ K  +     D   +   +   S   T L  +++++G++L  +  +  +H        C+G   + Y    AL +E Q    A N   FP + L+PG+ Y Q+ +Y F  +
Sbjct:    7 EIANKQGLTATLLPFGATLAKLTFP----DKNGKNQDLVLGFDTIDEFEKDAASIGKTVGRVANRIKNSTLHFDGKQYTMTPNNGPHYLHGGPNGLGYRKWEVVRHAPESVSFSVRANEQDDGLPGDAKIDVTYTVNDRNQLIIEHHATCDTPGL-LALTNHAYWNLDGSDTV----AEHFLEMEADEFVEVDDTFCPTGAIRSVT-------DTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPPSTPSTYLRFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSAAPNFDHFPDVSLRPGDHYCQEIVYTFSHV 329          
BLAST of Aldose 1-epimerase vs. Ensembl Fly
Match: CG10467 (gene:FBgn0035679 transcript:FBtr0077063)

HSP 1 Score: 163.696 bits (413), Expect = 7.936e-46
Identity = 112/346 (32.37%), Postives = 171/346 (49.42%), Query Frame = 2
Query:  263 EEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINE-CYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNC-LHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGI-----TRLTLFTDQNGLQLYTSNFFNNVHCCE-------GIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            + I  + ++N +   V +++ GA + SI  P    D S    +V LGF  +  Y+     Y G  +GRV  R++ G F ++GK   V KN      LHGG  G  + +W++ E   D +TL     D  +G+PG +     +T+S DN L +   A  +K   P+NLTNHSYFNL+G+     G+ +H + INA    E  +  +P G+I P+            L   L  +    +G+D+ +   T       A+V+          L + ++Q G+Q YTSNF  +V   E       G  + ++ A CLE Q FPD++NH  FPS +L+PGE Y  + IYKF
Sbjct:   22 DTIKRFTLTNGAGMSVQLITRGATITSIKTP----DASGQIDDVTLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGKLVQVSKNRDNKFQLHGGFVGFDKAHWEVVEVRVDGVTLSHTNPDGHEGYPGKVTATASFTLSEDNCLHVQMSALADK-TTPVNLTNHSYFNLAGHKSGANGLYEHTIEINAYGITETDQSSIPTGRITPVEGTGFDLRVSSNLGERLKAL-QPARGYDDNFCV-TFSPPQPLAKVARATHPPSGRWLEVVSNQPGVQFYTSNFMPDVERGESPIPGKDGAAYAKHCAFCLETQKFPDSVNHSNFPSTILRPGESYQHEVIYKF 360          
BLAST of Aldose 1-epimerase vs. Ensembl Fly
Match: CG4988 (gene:FBgn0032372 transcript:FBtr0080254)

HSP 1 Score: 152.14 bits (383), Expect = 1.613e-41
Identity = 100/335 (29.85%), Postives = 175/335 (52.24%), Query Frame = 2
Query:  278 YEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINEC-YLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNC-LHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNP-KGFDNYYIFDTVGIEHCQAQVSDGI-----TRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            Y + N     V ++ LGA +QSIN P    D S+   +V LGF  +  Y  N+  Y+G  +GRVA R++ G F ++  + ++ +N  G   LHGG  G     W++ + T   +     +    +G+PG +   + Y +  ++ L I ++A  ++    +NL+NH+YFNL+G+    +G+ +H V I +S+ +E     +P G++  +        +   L + L +  + P +GFDN Y+ +   +     +V+  +       L ++T+Q G+Q YT+N    +   +G+ + ++GALC++   FPDAINH  FPSI L P E Y  + +Y F
Sbjct:   27 YTLKNTKGMSVTVIQLGATIQSINFP----DGSKKVEDVCLGFDDIAGYVTNKAAYMGGTLGRVANRVASGGFTLDETTVNLTRNVEGQFHLHGGFLGFDSVIWEVVQKTPQGVVFRHESQHGHEGYPGILTCLITYRLDNEDRLSISFEATTDRQTI-VNLSNHAYFNLAGHNAGPKGLAEHTVEIASSEIVETDDRQIPTGELTLVDNTAYDLRSPVVLGDRLKQFENCPIQGFDNCYVVNGGQLLRSTVKVAKIVHPPSGRALEVWTNQPGIQFYTANNITKITGKKGLFYVKHGALCVQTVKFPDAINHQNFPSINLNPNETYRHEVVYWF 356          
BLAST of Aldose 1-epimerase vs. Ensembl Fly
Match: CG32444 (gene:FBgn0043783 transcript:FBtr0078424)

HSP 1 Score: 145.591 bits (366), Expect = 4.797e-39
Identity = 96/340 (28.24%), Postives = 178/340 (52.35%), Query Frame = 2
Query:  263 EEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINE-CYLXXXXXXXXXXLSFGKFNIEGKSFDVMKN-NGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNP-KGFDNYYIFDTVGIEHCQAQVSDGI-----TRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            E +  Y + N     V+++ LGA +QS+ LP    D  +   +V LGF  +  Y  N+  Y+G  +GRVA R++ G++        V KN      LHGG  G     W++ + + + +     +    +G+PG +   + Y +  +N L + Y+A  ++    +NL++H+YFNL+G+    +G+ +H V I + + ++  +  +P GK+V +   +        + + L++  +   KG+DN ++ +   ++   A+V+  +       L ++TDQ G+Q YT+N   ++       ++++G+ C+E + FPDA+NH EFPSI L+P EKY    +Y F
Sbjct:   22 EMVRRYTLKNSKGMTVSVIQLGAIIQSVCLP----DAYKKVDDVCLGFDDIASYLANKGAYIGGTLGRVANRVANGEYTFNDTKVSVTKNIQDKFQLHGGFIGFDSVIWEVVQKSAEGVIFRHVSPHGHEGYPGKLTCLITYQLDNENRLWVRYEATTDRSTM-VNLSSHAYFNLAGHGSGAKGLSEHTVEIASDQIVDTDELQIPTGKLVDVKDTVFDLRLPVLMRDRLMQFENRQIKGYDNCFVVNGGRVQKSVAKVAKIVHPPSCRVLEVWTDQPGMQFYTANNLTSIVGKNCTKYEKHGSFCVETEKFPDAMNHPEFPSISLEPNEKYRHDVLYWF 356          
BLAST of Aldose 1-epimerase vs. Ensembl Fly
Match: CG32445 (gene:FBgn0052445 transcript:FBtr0078425)

HSP 1 Score: 131.724 bits (330), Expect = 4.521e-34
Identity = 98/349 (28.08%), Postives = 179/349 (51.29%), Query Frame = 2
Query:  263 EEIFLYEISNKSNTKVNILSLGAAVQSINLP-WQGKDKSQPSVNVVLGFSTVEEYEINECYL-XXXXXXXXXXLSFGKFNIEGKSFDVMKN-NGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNP-KGFDNYYIFDTVGIEHCQAQVSDGITR------LTLFTDQNGLQLYTSNFFNN-------VHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            + +  + +  +    V+IL++GA +QS+ +P + GK +     +V LG+  V  Y  N+ Y  G  +GRVA R + G+F + GK   V +N    +  +GG  G     W +     D +TL   + D  +G+PG++  N+ ++++      +  +A   K    +N++NHS+FNL+G+      +  H++ I A K +++ ++LLP GK++ +       ++   L   L +V   P  GFDN++  D   I   + Q+   +        + + T+Q GLQ  T+N   +       +   +G+ + + GA  LE Q +PDA+NH +FPS++L PG+ Y  + +Y+F
Sbjct:   21 DRVRRFTLVTERGMSVSILTMGAIIQSLKVPDFNGKLE-----DVCLGYDDVAGYYRNQQYFFGATIGRVANRTAHGRFKLCGKEVSVSRNLRDRHHQNGGFVGFDSVIWDVVGVHKDGVTLQHISPDGHEGYPGELTTNINFSLNETGCFGMRIEART-KATTAVNISNHSFFNLAGHGAGRDTLYQHMLMIKAQKIVDVDQELLPTGKLMRVRTTPYDFSSLVSLGKRLNQVSTCPLGGFDNHFCVD---IPPNRVQLVARVVHPCSGRFMEVHTNQPGLQFSTANHLPSEDGSDIPIAGKDGVNYVRQGAFTLETQKYPDAMNHCDFPSVVLNPGQLYDHQVVYRF 360          
BLAST of Aldose 1-epimerase vs. Ensembl Fly
Match: CG10996 (gene:FBgn0030525 transcript:FBtr0073836)

HSP 1 Score: 125.176 bits (313), Expect = 1.815e-31
Identity = 101/346 (29.19%), Postives = 168/346 (48.55%), Query Frame = 2
Query:  269 IFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECY-LXXXXXXXXXXLSFGKFNIEGKSFDVMKNNG-GNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSK-DLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNP-KGFDNYYI----FDTVGIEHCQAQVSDGITR-LTLFTDQNGLQLYTSNFFNNVHCCEGIV-------HQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            I  Y ++N +   V I+ LGA +QSI +P    D      +VVLGF  V  Y     Y  G  +GRV+  +  G+F ++ +   V KN G  +  +GG  G  +  W L+    D +TL   + D  +G+PG + + + +TI+ DN   I  +A       P+N++NH  FNL+G +   +GI DH ++I A +T+E S  D LP G+   ++ ++        + + + +    P KG+D  +     FD +   +    +     R + +F++Q  ++  T N F      E  +       + Q+    L+  N+PDA+N  +FP I + PGE Y  +TIY F
Sbjct:   23 IRRYTMTNTNRLSVAIIQLGATIQSIQVP----DAYHQLSDVVLGFDDVAGYTKYRNYHFGCTIGRVSDVVGNGEFIMDERRVVVSKNLGQKHQTNGGFVGFDQVIWDLEMKRPDGVTLRHISPDGHEGYPGTLKVLLHFTINDDNRFFIQIEA-TTNQTTPVNISNHIIFNLAGQSTGIKGIFDHQINIEAIETMETSNGDGLPTGRFKNVNDSVYDIRLPVFMGDRVRQFEKKPVKGYDVCFALDKEFDAIRTRYVGRFLHPDSGRFMEIFSNQPCVKFTTGNCFPQEPLGEPPILGKKCTRYWQHCGFSLQLLNYPDAVNQPDFPRIFINPGEHYFHETIYHF 363          
BLAST of Aldose 1-epimerase vs. Ensembl Zebrafish
Match: galm (galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040718-66])

HSP 1 Score: 174.481 bits (441), Expect = 5.203e-50
Identity = 123/334 (36.83%), Postives = 183/334 (54.79%), Query Frame = 2
Query:  284 ISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDN---YYIFDTVGIEH-CQAQVSDGITR-LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            I   ++  V I+SLG  ++SI    +  D+S  S ++VLGF  +E Y  N  Y G VVGRVA R+S G+F I+ K + +  NNG N LHGG  G  +  W   E  ++ + L   + D ++G+PG++ ++V YT+   ++L + Y A  + H  PINLTNHSYFNL+G   +D  I DH V+I+A   L +   ++P G++ P+ K          L + L ++     GFD+    Y+     +E  C   V  G  R L + T Q G+Q YTSNF + +V    G  + ++ A CLE QN+PDA+N   FP  LL+PGE Y   T + F  +
Sbjct:   20 ILRSASVSVEIISLGCVIKSI----KTADRSGQSADIVLGFDDIEGYFSNPRYFGAVVGRVANRISKGRFVIDEKEYKLAINNGPNALHGGLKGFDKAVWS-TEAVDNGVKLSHSSPDGDEGYPGNLKVSVTYTLE-KSTLSVLYHAQTD-HTTPINLTNHSYFNLAGEGTLD--IYDHEVTISAESYLPVDDTVIPTGEVKPVKKTPFDLRKPVILGSRLKELSG--PGFDHNFCLYLPGEPPLERKCARVVHPGTGRVLEVSTTQPGVQFYTSNFLDGSVKGKGGAAYSKHSAFCLETQNWPDAVNQPHFPDALLRPGETYSYTTRFTFSVV 342          
BLAST of Aldose 1-epimerase vs. Ensembl Zebrafish
Match: galm (galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040718-66])

HSP 1 Score: 174.481 bits (441), Expect = 5.203e-50
Identity = 123/334 (36.83%), Postives = 183/334 (54.79%), Query Frame = 2
Query:  284 ISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDN---YYIFDTVGIEH-CQAQVSDGITR-LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            I   ++  V I+SLG  ++SI    +  D+S  S ++VLGF  +E Y  N  Y G VVGRVA R+S G+F I+ K + +  NNG N LHGG  G  +  W   E  ++ + L   + D ++G+PG++ ++V YT+   ++L + Y A  + H  PINLTNHSYFNL+G   +D  I DH V+I+A   L +   ++P G++ P+ K          L + L ++     GFD+    Y+     +E  C   V  G  R L + T Q G+Q YTSNF + +V    G  + ++ A CLE QN+PDA+N   FP  LL+PGE Y   T + F  +
Sbjct:   20 ILRSASVSVEIISLGCVIKSI----KTADRSGQSADIVLGFDDIEGYFSNPRYFGAVVGRVANRISKGRFVIDEKEYKLAINNGPNALHGGLKGFDKAVWS-TEAVDNGVKLSHSSPDGDEGYPGNLKVSVTYTLE-KSTLSVLYHAQTD-HTTPINLTNHSYFNLAGEGTLD--IYDHEVTISAESYLPVDDTVIPTGEVKPVKKTPFDLRKPVILGSRLKELSG--PGFDHNFCLYLPGEPPLERKCARVVHPGTGRVLEVSTTQPGVQFYTSNFLDGSVKGKGGAAYSKHSAFCLETQNWPDAVNQPHFPDALLRPGETYSYTTRFTFSVV 342          
BLAST of Aldose 1-epimerase vs. Ensembl Zebrafish
Match: galm (galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040718-66])

HSP 1 Score: 173.711 bits (439), Expect = 1.060e-49
Identity = 123/334 (36.83%), Postives = 182/334 (54.49%), Query Frame = 2
Query:  284 ISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDN---YYIFDTVGIEH-CQAQVSDGITR-LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            I   ++  V I+SLG  ++SI    +  D+S  S ++VLGF  +E Y  N  Y G VVGRVA R+S G+F I+ K + +  NNG N LHGG  G  +  W   E  ++ + L   + D ++G+PG++ ++V YT+   ++L + Y A  + H  PINLTNHSYFNL+G    D  I DH V+I+A   L +   ++P G++ P+ K          L + L ++     GFD+    Y+     +E  C   V  G  R L + T Q G+Q YTSNF + +V    G  + ++ A CLE QN+PDA+N   FP  LL+PGE Y   T + F  +
Sbjct:   20 ILRSASVSVEIISLGCVIKSI----KTADRSGQSADIVLGFDDIEGYFSNPRYFGAVVGRVANRISKGRFVIDEKEYKLAINNGPNALHGGLKGFDKAVWS-TEAVDNGVKLSHSSPDGDEGYPGNLKVSVTYTLE-KSTLSVLYHAQTD-HTTPINLTNHSYFNLAGEGTPD--IYDHEVTISAESYLPVDDTVIPTGEVKPVEKTPFDLRKPVILGSRLKELSG--PGFDHNFCLYLPGEPPLERKCARVVHPGTGRVLEVSTTQPGVQFYTSNFLDGSVKGKGGAAYSKHSAFCLETQNWPDAVNQPHFPDALLRPGETYSYTTRFTFSVV 342          
BLAST of Aldose 1-epimerase vs. Ensembl Xenopus
Match: thrb (thyroid hormone receptor, beta [Source:Xenbase;Acc:XB-GENE-6070709])

HSP 1 Score: 154.066 bits (388), Expect = 3.147e-42
Identity = 112/326 (34.36%), Postives = 172/326 (52.76%), Query Frame = 2
Query:  290 NKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            +    +  ++S G  +  +    + +D++    ++VLGF  +E Y     Y G VVGRVA R++ GKF +EGK + +  NNG N LHGG  G  +  W  K   N  +     + D E+G+PG++N+ V YT+    +L ++Y A   K   PINLTNHSYFNL+G    +  I DHVVSI A   L +   ++P G++ P+           +L + +        GFD+ +       +   A+VS  ++   LT+ T Q G+Q YT+NF + ++    G V+ ++ A CLE Q +PDA+N   FPS LL P E+Y   T + F
Sbjct:   25 DSKQVRAEVISFGCIITRL----ETQDRTGTFSDIVLGFDDIEGYTNKHPYFGAVVGRVANRIANGKFTVEGKDYHLAINNGPNSLHGGLKGFDKVLWAPKLIEN-GVQFSYQSKDGEEGYPGELNLWVTYTLV-GGTLTVNYRAQSNK-TTPINLTNHSYFNLAGQGSSN--IYDHVVSIEADHYLPVDDTMIPTGEVAPVLGTCFDLRKPVELGSHMNSF--YLDGFDHNFCLGVTQEQKQCARVSHPLSGRVLTVSTTQPGVQFYTANFLDGSLKGKGGAVYPKHSAFCLETQGWPDAVNKPHFPSSLLNPEEEYNHTTSFGF 339          
BLAST of Aldose 1-epimerase vs. Ensembl Xenopus
Match: thrb (thyroid hormone receptor, beta [Source:Xenbase;Acc:XB-GENE-6070709])

HSP 1 Score: 62.7734 bits (151), Expect = 6.472e-11
Identity = 37/99 (37.37%), Postives = 56/99 (56.57%), Query Frame = 2
Query:  971 GFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            GFD+ +       +   A+VS  ++   LT+ T Q G+Q YT+NF + ++    G V+ ++ A CLE Q +PDA+N   FPS LL P E+Y   T + F
Sbjct:   93 GFDHNFCLGVTQEQKQCARVSHPLSGRVLTVSTTQPGVQFYTANFLDGSLKGKGGAVYPKHSAFCLETQGWPDAVNKPHFPSSLLNPEEEYNHTTSFGF 191          
BLAST of Aldose 1-epimerase vs. Ensembl Mouse
Match: Galm (galactose mutarotase [Source:MGI Symbol;Acc:MGI:2442420])

HSP 1 Score: 160.999 bits (406), Expect = 5.925e-45
Identity = 114/320 (35.62%), Postives = 172/320 (53.75%), Query Frame = 2
Query:  308 VNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            V+I+S G  + ++    Q KD+   + +VVLGF+ +E Y   + Y G VVGRVA R++ G+F I GK + +  N   N LHGG TG  +  W  +  TN  +     + D E+G+PG++ + V YT+     LVI+Y A   +   P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G I P+           +L   L     +  GFD+ +       +   A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++  LCLE QN+PD++N  +FP  LL+PGE+Y   T +KF
Sbjct:   31 VDIISWGCTITAL----QVKDRQGKASDVVLGFAELEGYLQKQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPNSLHGGFTGFDKVLWTPQVLTN-GVQFFRVSPDGEEGYPGELKVWVTYTLD-GGELVINYRAQASQ-TTPVNLTNHSYFNLAGQGSPN--IYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDY--HIHGFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKF 339          
BLAST of Aldose 1-epimerase vs. Ensembl Mouse
Match: Galm (galactose mutarotase [Source:MGI Symbol;Acc:MGI:2442420])

HSP 1 Score: 66.2402 bits (160), Expect = 3.082e-12
Identity = 53/175 (30.29%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  758 TNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEK---YVQKTIYKFDK 1264
            TNHSYFNL+G    +  I DH V+I A   L + + L+P G I P+           +L   L     +  GFD+ +       +   A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++  LCLE QN+PD++N        +KP  +   + + T+ K D+
Sbjct:    2 TNHSYFNLAGQGSPN--IYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDY--HIHGFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGLCLETQNWPDSVNQ-------VKPQARLSEWRRSTVMKPDR 165          
BLAST of Aldose 1-epimerase vs. UniProt/SwissProt
Match: sp|Q96C23|GALM_HUMAN (Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 6.740e-46
Identity = 109/321 (33.96%), Postives = 174/321 (54.21%), Query Frame = 2
Query:  305 KVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            +V+I+S G  + ++ +    KD+   + +VVLGF+ +E Y   + Y G V+GRVA R++ G F ++GK + +  N   N LHGG  G  +  W  +  +N  +     + D E+G+PG++ + V YT+     L+++Y A   + A P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G++ P+           +L   L     N  GFD+ +       +H  A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++   CLE QN+PDA+N   FP +LL+PGE+Y   T +KF
Sbjct:   30 RVDIISWGCTITALEV----KDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSN-GVQFSRISPDGEEGYPGELKVWVTYTLD-GGELIVNYRAQASQ-ATPVNLTNHSYFNLAGQASPN--INDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN--GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKF 339          
BLAST of Aldose 1-epimerase vs. UniProt/SwissProt
Match: sp|Q5R8U1|GALM_PONAB (Aldose 1-epimerase OS=Pongo abelii OX=9601 GN=GALM PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.088e-45
Identity = 111/321 (34.58%), Postives = 173/321 (53.89%), Query Frame = 2
Query:  305 KVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            +V+I+S G  + ++ +    KD+   S +VVLGF+ +E Y   + Y G V+GRVA R++ G F ++GK + +  N   N LHGG  G  +  W  +  +N  I     + D E+G+PG++ + V YT+     LV++Y A   + A P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G++ P+           +L   L     N  GFD+ +       +H  A+V    +   L ++T Q G+Q Y  NF +  +    G V+ ++   CLE QN+PDA+N   FP +LL+PGE+Y   T +KF
Sbjct:   30 RVDIISWGCTITALEV----KDRQGRSSDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSN-GIQFSRISPDGEEGYPGELKVWVTYTLD-GGELVVNYRAQASQ-ATPVNLTNHSYFNLAGQGSPN--IYDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN--GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYMGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKF 339          
BLAST of Aldose 1-epimerase vs. UniProt/SwissProt
Match: sp|Q9GKX6|GALM_PIG (Aldose 1-epimerase OS=Sus scrofa OX=9823 GN=GALM PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.640e-45
Identity = 114/321 (35.51%), Postives = 175/321 (54.52%), Query Frame = 2
Query:  305 KVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFD-NYYIFDTVGIEHCQAQVSDGITR-LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            +V+I+S G  + ++ +    KD+   + +VVLGF+ ++EY     Y G VVGRVA R++ G F ++GK + +  NNG N LHGG  G  +  W  +  +N  I     + D E+G+PG++ + V YT+     LV++Y A   +   P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G+I P+           +L   L +   N  GFD N+ +  +   + C      G  R L ++T Q G+Q YT NF +  +    G V+ ++   CLE QN+P+A+N   FP +LLKPGE+Y   T + F
Sbjct:   30 RVDIISWGCTITALEV----KDRQGRASDVVLGFAELKEYLQKHPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGVRGFDKVLWTPRVLSN-GIEFSRVSPDGEEGYPGELKVWVTYTLD-GGELVVNYRAQASQ-TTPVNLTNHSYFNLAGQGSPN--IYDHEVTIEADAFLPVDETLIPTGEIAPVQGTAFDLRKPVELGKHLQEFHIN--GFDHNFCLKRSKEKQFCARVHHAGSGRVLEVYTTQPGIQFYTGNFLDGTLKGKTGAVYPKHSGFCLETQNWPNAVNQPHFPPVLLKPGEEYNHTTWFVF 339          
BLAST of Aldose 1-epimerase vs. UniProt/SwissProt
Match: sp|Q66HG4|GALM_RAT (Aldose 1-epimerase OS=Rattus norvegicus OX=10116 GN=Galm PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.659e-44
Identity = 112/320 (35.00%), Postives = 172/320 (53.75%), Query Frame = 2
Query:  308 VNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            V+I+S G  + ++    Q KD+   + +VVLGF+ +E Y   + Y G VVGRVA R++ G+F ++GK + +  N   N LHGG  G  +  W  +  +N  +     + D E+G+PG++ + V YT+     LV++Y A   +   P+NLTNHSYFNL+G    D  I DH V+I A   L + + L+P G I P+           +L   L     +  GFD+ +       +   A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++   CLE QN+PDA+N  +FP ILL+PGE+Y   T +KF
Sbjct:   31 VDIISWGCTITAL----QVKDRQGKASDVVLGFAELEGYLQKQPYFGAVVGRVANRIAKGRFTVDGKEYHLPINREPNSLHGGFRGFDKVLWTPQVLSN-GVQFSRVSPDGEEGYPGELKVWVTYTLD-GGELVVNYRAQASQ-TTPVNLTNHSYFNLAGQGSPD--IYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGKHLQSY--HIHGFDHNFCLKESKEKKFCARVHHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKSGEVYPKHSGFCLETQNWPDAVNQPQFPPILLRPGEEYNHTTWFKF 339          
BLAST of Aldose 1-epimerase vs. UniProt/SwissProt
Match: sp|Q8K157|GALM_MOUSE (Aldose 1-epimerase OS=Mus musculus OX=10090 GN=Galm PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.145e-44
Identity = 114/320 (35.62%), Postives = 172/320 (53.75%), Query Frame = 2
Query:  308 VNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            V+I+S G  + ++    Q KD+   + +VVLGF+ +E Y   + Y G VVGRVA R++ G+F I GK + +  N   N LHGG TG  +  W  +  TN  +     + D E+G+PG++ + V YT+     LVI+Y A   +   P+NLTNHSYFNL+G    +  I DH V+I A   L + + L+P G I P+           +L   L     +  GFD+ +       +   A+V    +   L ++T Q G+Q YT NF +  +    G V+ ++  LCLE QN+PD++N  +FP  LL+PGE+Y   T +KF
Sbjct:   31 VDIISWGCTITAL----QVKDRQGKASDVVLGFAELEGYLQKQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPNSLHGGFTGFDKVLWTPQVLTN-GVQFFRVSPDGEEGYPGELKVWVTYTLD-GGELVINYRAQASQ-TTPVNLTNHSYFNLAGQGSPN--IYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDY--HIHGFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKF 339          
BLAST of Aldose 1-epimerase vs. TrEMBL
Match: A0A2G4FLL9 (Aldose 1-epimerase OS=Planctomycetaceae bacterium OX=2026779 GN=CK551_10365 PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.341e-59
Identity = 118/343 (34.40%), Postives = 194/343 (56.56%), Query Frame = 2
Query:  263 EEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKE--HTND-SITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR-------LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            E + ++ + N    KV +++ GA +QSI +P    D      +V++GF T+E +     Y G  +GRV  R+   KF+++GK + +  NNG + LHGG+ G  RKNW  +   +TND  +     + D E+G+PG++ + V +T++ DN+L I+YDA  +K + PINLTNH+YFNL+G+   +  I DH + INA++     + L+P GK+ P++          K+ + + ++   P G+D+ Y+ +         +    I R       + ++T + GLQ YT NF +  +   +G  + QY   CLE+Q++PD++N  EFPS +LKPGEK+   T YKF
Sbjct:   24 EAVDIFTLQNSKGMKVRLITFGATIQSIEVP----DNKGKMADVIVGFDTLEGFLTEHPYFGGTIGRVCNRIGNAKFSLDGKEYALAANNGPHSLHGGKKGFDRKNWTAESFINTNDRGVRFTRTSPDGEEGYPGNVRLGVTFTLTNDNALRIEYDAITDK-STPINLTNHAYFNLAGSG--NGSILDHQIMINATQQTATDETLIPTGKLAPVAGTPIDFTKSMKIGDRIKEIKATPVGYDHNYVLEA---SSKDLKAPAAIVREPNSGRVMEVYTSEPGLQFYTGNFLDGTIKGKKGATYNQYNGFCLESQHYPDSVNKKEFPSTILKPGEKFSSTTTYKF 356          
BLAST of Aldose 1-epimerase vs. TrEMBL
Match: A0A1I8GBH5 (Aldose 1-epimerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013452g1 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.116e-58
Identity = 122/330 (36.97%), Postives = 192/330 (58.18%), Query Frame = 2
Query:  305 KVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEG--KSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHC------QAQVSDGIT---RLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFD 1261
            + ++L+ GAA+QS+  P   ++   P  +VVLG+ TV+ YE   CY G VVGR  GR+   +F++ G  +   V +N+G + LHGG  GL+R  W +     DS+TL   + D EDG+PG++ + V YT+S DNSL ++Y A  ++  CP++LTNH+YFNLSG++  D  + +H V + +S+ +EL  +LLP G+++P+           +  +     G N   FD+ Y+ D+   +         A V++ ++   RL+  TDQ  L  YT  + ++V    G  + ++  LC E Q +PD++NH EFPS LL PG KY Q T++KFD
Sbjct:   29 EAHVLTYGAALQSLYCP--SRNPCDPPTDVVLGYDTVQGYESCPCYFGFVVGRQPGRVKDAQFSLPGGDQPVSVTRNHGRHSLHGGERGLTRAVWNIDNLGEDSVTLSLLSKDGEDGYPGNLRVTVTYTVSNDNSLRLNYSAECDR-PCPVSLTNHAYFNLSGHSSGD--VSNHRVQLASSRLIELDAELLPTGRVLPVDGTPSDLRGAGRKLSD----GIN---FDHIYVLDSASGQSVDDESAPAAGVAEELSSGRRLSCRTDQPVLVFYTGYYIDSVPGKGGCQYSRHAGLCFETQLYPDSLNHPEFPSSLLTPGSKYSQATVFKFD 346          
BLAST of Aldose 1-epimerase vs. TrEMBL
Match: A0A2E8H9K4 (Aldose 1-epimerase OS=Gemmatimonadaceae bacterium OX=2026741 GN=CME04_19325 PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.189e-57
Identity = 121/359 (33.70%), Postives = 205/359 (57.10%), Query Frame = 2
Query:  215 FSIMNKRLFGFSKLINEEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHT---NDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRG-IRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQ--AQVSDGIT--RLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
             S + + +FG S    EE+ ++ +SN   T V +L +GA +  + +P    D+     +VVLGF T++EY++N  Y G  VGRVA R++ G+F ++G++  +  N   N +HGG  G  R  W+ +  T     ++     +AD EDG+PG+++  + YT++  N L +DY A  ++ A PINLTNHSYFNL+ +   D G + DHV+ I A +  E   + +P G I+P+            + + + ++ D+  G+D+ ++ D    + C+  A+V + +   R+ + T Q G+Q YT NF + +    G V+ ++  +CLE Q+FPD++NH +FPS +L+PGE + Q T Y+F  +
Sbjct:    1 MSTITRGVFG-STSRGEEVAVFTLSNDDGTVVRLLEIGATIAEVRVP----DRRGELADVVLGFDTLDEYDVNPAYFGCAVGRVANRIAGGRFELDGETLQLAINAPPNHIHGGEGGFHRALWRGEPETVPEGVAVRFRYTSADGEDGYPGELSCEILYTLTRANGLRLDYLASTDR-ATPINLTNHSYFNLTSH---DAGSVLDHVIRIKALRYTERDGNGIPTGNILPVDDTPLDLRESRVVGDRIGELKDS-GGYDHNFVVDRWDGQTCRMIAEVLEPLRGRRMEVHTTQPGVQFYTGNFLSGLEGKAGAVYNRHSGVCLETQHFPDSVNHPDFPSTILRPGETWRQTTEYRFSTL 349          
BLAST of Aldose 1-epimerase vs. TrEMBL
Match: A0A2C9JK14 (Aldose 1-epimerase OS=Biomphalaria glabrata OX=6526 GN=106057218 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.537e-57
Identity = 127/341 (37.24%), Postives = 203/341 (59.53%), Query Frame = 2
Query:  263 EEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITR---------LTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            +++  Y ++N S   V IL LG  V  IN+P    DK     +V LGF  V++YE    Y+G ++GRVA R++ G+F ++G+++++  NNG N LHGG+ G ++K W + E  N S+ L   + D E+ +PG++++ V Y+ S DN L I+Y A  +K A P+NLTNH+YFNL+G+      I+DHVV+++A   L L ++++P G+I P++       +  +L +LL KV  +  GFDN +  D         +  D +TR         L + TD+ G+Q YT+ +  ++    G  + ++ A CLEAQ++PD++N  EFPS +L+PG+ Y Q T YKF
Sbjct:   19 KKVTRYTLTNSSGANVKILDLGGIVNEINVP----DKDGKLGDVTLGFDQVKDYEEKPGYIGALIGRVANRIAGGQFTLDGQTYNLFINNGKNSLHGGKIGFNKKIWDVIEQ-NGSLVLRYVSPDGEENYPGELSVTVTYSFSEDNKLTIEYSASTDK-ATPVNLTNHAYFNLAGHGTGH--IKDHVVTLHAKHYLPLDENMIPTGEIRPVAGTEYDLTSPVRLGDLLDKV-PSGMGFDNNFCLD-------NNEKLDMVTRVDHLPSGRYLEVCTDEPGMQFYTAYWLADMTGKGGAGYGRFCAFCLEAQHYPDSVNKPEFPSTILRPGQLYTQTTSYKF 343          
BLAST of Aldose 1-epimerase vs. TrEMBL
Match: A0A136LUH8 (Aldose 1-epimerase OS=Chloroflexi bacterium OLB15 OX=1617416 GN=UZ15_CFX003000051 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.764e-57
Identity = 123/343 (35.86%), Postives = 192/343 (55.98%), Query Frame = 2
Query:  278 YEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNW---KLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNP-----KGFDNYYIFDT--VGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFNNVHC-CEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            Y ++N    +V +++ G  + SI +P    D++    NV LGFS +E+YE++  Y G +VGRVA R+   +F + GK + +  NNG N LHGG  G   K W   KL+    DS+ L   + D E+G+PG + + V YT++ DN+L+IDY A  +     +NLTNH+YFNLSG       I DHV+++NA +   +   L+P G++ P+            +   +    ++P     +G+D+ ++ +          A+V++ I+   L +FT + G+QLYT NF +      EG  ++Q  ALCLE Q+FPDA N  +FPSI L+PGE++   TIYKF  +
Sbjct:   16 YTLTNMHGVEVKMITFGGTITSIRVP----DRNGVFANVNLGFSRLEDYELDSPYFGSLVGRVANRIGGARFTLAGKVYPLAANNGQNALHGGVKGFDSKVWAAEKLQSERGDSLALTYVSPDGEEGYPGTLTVRVVYTLTGDNALIIDYSATTDALTI-VNLTNHAYFNLSG--AGSGTIEDHVITVNADRYTPVDSGLIPTGELAPVEGTPFDLRQPTPISANIRS--NHPQIVLGRGYDHNFVLNQSDTRTPTFAARVAEPISGRVLEVFTTEPGMQLYTGNFLDGTLVGAEGRTYRQGDALCLETQHFPDAPNQPQFPSIELQPGERFQSTTIYKFSVV 349          
BLAST of Aldose 1-epimerase vs. Ensembl Cavefish
Match: galm (galactose mutarotase [Source:NCBI gene;Acc:103030950])

HSP 1 Score: 179.489 bits (454), Expect = 5.674e-52
Identity = 124/326 (38.04%), Postives = 186/326 (57.06%), Query Frame = 2
Query:  308 VNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGI----EHCQAQVSDGITR-LTLFTDQNGLQLYTSNFFNNVHCCE-GIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            V ILS+GA + SIN P    D+S  S ++VLGF+ +E Y  N  Y G VVGRVA R++ G+F IEGK + +  NNG N LHGG  G  +  W   E  ++ + L   + D ++G+PG++ ++V YT++ +N+L + Y A  +K   P+NLTNHSYFNL+G    D  I DH V+I+A   L +   ++P G+I P+  +L        L + L ++     GFD+ +     G     + C   V  G  R L + T Q G+Q YTSNF +     + G  + ++ A CLE QN+P+A+N  +FP +LL+PGE+Y   T + F  +
Sbjct:   30 VEILSIGAVITSINTP----DRSGHSADIVLGFAELESYLTNPRYFGAVVGRVANRIAKGQFEIEGKVYKLAINNGPNALHGGLRGFDKAVWTC-EAVDNGVKLSHSSPDGDEGYPGNLKVSVTYTLN-ENTLSVLYCAQTDK-TTPVNLTNHSYFNLAGQGTPD--IYDHEVTISAEAYLPVDDTMIPTGEIKPVENSLFDLCKPVLLGSRLKELPG--PGFDHNFCLWFPGQPKQEKKCARVVHPGTGRVLEVSTTQPGVQFYTSNFLDGSFKGKGGASYPKHSAFCLETQNWPNAVNQPQFPDVLLRPGEEYNHTTHFTFSVV 344          
BLAST of Aldose 1-epimerase vs. Ensembl Sea Lamprey
Match: galm (galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040718-66])

HSP 1 Score: 164.081 bits (414), Expect = 7.977e-47
Identity = 114/322 (35.40%), Postives = 175/322 (54.35%), Query Frame = 2
Query:  308 VNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPN-GKIVPLSXXXXXXXXXXXXXXXXXXV-GDNPKGFDNYYIFDTVGIEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
              +LSLG  +Q++  P     K+ P V+VVLGF ++  Y     Y G VVGRVA R++ G+F ++GK + +  NNG N LHGG  G  +  W L E   D + L   + D ++G+PG ++  V Y +  DN L I+Y A   +   P+NLTNH+YFNL+G    D  I DH V+I A + L +   ++P  G++  +        +   L + L ++ GD   GFD+ +     G     A+         +T+ T Q G+Q YT+NF + ++   +G  + ++ A CLE QN+PDA+N   FP+ LL+PGE+Y   T + F
Sbjct:   34 AKVLSLGGILQALEAP----GKAGPPVDVVLGFPSIHGYLEKHPYFGAVVGRVANRIAGGRFAVDGKDYTLAINNGPNSLHGGIVGFDKAVW-LAEQLEDGVRLTHTSPDGDEGYPGALSATVTYRLV-DNKLSINYRATTTR-TTPVNLTNHAYFNLAGQGSPD--IYDHEVTIMAEEYLPVDDTVIPTEGEVAAVKDTPFDLRSPVILRDRLPQLPGD---GFDHNFCLSQSGERQTCARACHAGRGCVMTVETTQPGVQFYTANFLDGSLQGKDGCTYPRHSAFCLETQNWPDAVNKPNFPNALLRPGEEYNHTTWFTF 343          
BLAST of Aldose 1-epimerase vs. Ensembl Yeast
Match: YNR071C_mRNA (Putative aldose 1-epimerase [Source:SGD;Acc:S000005354])

HSP 1 Score: 89.7373 bits (221), Expect = 3.101e-20
Identity = 100/351 (28.49%), Postives = 162/351 (46.15%), Query Frame = 2
Query:  284 ISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCF--------TADNEDGFPGDMNINVKYTIS-PDNSLVIDYDA-FVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKD-LLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFD---------TVGIEHC----QAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPS-ILLKPGEKYVQKTIYKFD 1261
            I ++   +  I  LGA +  + +  Q         +VV G+S V++Y  +   +G  VGR A R++ G F+++     +  NN GN  H   + L+ K +K     N S  ++          T  N + FPGD+ + VKYT++  + +L ++Y A  V   A PIN+TNHSYFNL+     ++ IR   V + ++K+LE+++  LLP GKI+  +           L        D P  FD  +I D         +V +       +A   +   +  + T +  + LYT +     + C   V +      ++   + DAIN  E+   +LLK GE Y  KT YKFD
Sbjct:   15 IGDEKKFQATIAPLGATLVDLKVNGQ---------SVVQGYSNVQDYLTDGNMMGATVGRYANRIAKGVFSLDDGPHKLTVNNCGNTNHSSISSLNLKQYKASPVENPSKGVYVVEFKLLDDHTQPNPNEFPGDLEVTVKYTLNVAEMTLDMEYQAQLVRGDATPINMTNHSYFNLN-KVKSEKSIRGTEVKVCSNKSLEVTEGALLPTGKIIERNIATFDSTKPTVLHE------DTPV-FDCTFIIDANKDLKTTDSVSVNKLVPVFKAYHPESHIKFEVSTTEPTVHLYTGD-----NLCGKFVPRS--GFAVQQGRYVDAINRDEWRGCVLLKRGEVYTSKTQYKFD 341          
BLAST of Aldose 1-epimerase vs. Ensembl Yeast
Match: YHR210C_mRNA (Putative aldose 1-epimerase superfamily protein; non-essential gene; highly expressed under anaeorbic conditions [Source:SGD;Acc:S000001253])

HSP 1 Score: 79.7221 bits (195), Expect = 7.387e-17
Identity = 89/314 (28.34%), Postives = 151/314 (48.09%), Query Frame = 2
Query:  389 NVVLGFSTVEEYEINECY--LXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTN--DSITLHCFTADNE----DGFPGDMNINVKYTIS-PDNSLVIDYDA-FVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSK-DLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGIT------RLTLFTDQNGLQLYTSN------FFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPS-ILLKPGEKYVQKTIYKF 1258
            ++VLG+  +  Y I++ Y  +G  VGR A R+  G F++E     +  NN GN  H   +    K +K  +  N  D + +  FT  ++    + FPGD+ +N+KYT++  D +L ++Y+A  V   A PIN+TNH+YFNL+  T+  + I    V + + K+LE+S+  L+P GKIV        +       +    + D+   +D  +I D    E+   + +D ++          +   + L L  S       F+   + C+G   +      +E   + DAIN   +   +LL+ GE Y  KT Y+F
Sbjct:   41 SIVLGYPDIHGY-ISDGYNYIGATVGRYANRIYKGMFSMEDGPHQLTVNNCGNTNHSSISSFHLKKYKASKVQNPLDDLYIVEFTLLDDRTLPNEFPGDLAVNLKYTLNVADMTLDLEYEAKLVSGEATPINMTNHTYFNLN-KTMDKKSISGTEVRLCSDKSLEVSEGALIPTGKIV-------QRKIATFDSSKPTILQDDGPIYDYAFIVD----ENKNLKTTDSVSVNKLVPAFKAYHPASRLSLEVSTTEPTVLFYTGDNLCDGFTPRS--GFAVEQGRYVDAINRDGWRDCVLLRRGEVYTSKTRYRF 339          
BLAST of Aldose 1-epimerase vs. Ensembl Yeast
Match: GAL10 (UDP-glucose-4-epimerase; catalyzes interconversion of UDP-galactose and UDP-D-glucose in galactose metabolism; also catalyzes conversion of alpha-D-glucose or alpha-D-galactose to their beta-anomers; human homolog GALE implicated in galactosemia, can complement yeast null mutant [Source:SGD;Acc:S000000223])

HSP 1 Score: 78.9518 bits (193), Expect = 4.508e-16
Identity = 87/311 (27.97%), Postives = 136/311 (43.73%), Query Frame = 2
Query:  389 NVVLGFSTVEEY-EINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWK---LKEHTNDSITLHCFTADNEDG--FPGDMNINVKYTIS-PDNSLVIDYDA-FVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFD---------TVGIEH---CQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPS-ILLKPGEKYVQKTIYKF 1258
            +VVLG+   E Y   +  Y+G  +GR A R+S GKF++  K + +  NNG N  H       RK +    ++  + D  T      DNE    FPGD+ + ++YT++    SL + Y        A PINLTNHSYFNL  N      I    + + + K++++ K+++P G IV        +            +G     FD  ++ D         T+  E     +A   D    L + + +   Q YT +F +      G   +Q     +E   + DAIN   +   + LK GE Y  K +Y+F
Sbjct:  404 SVVLGYENEEGYLNPDSAYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKDVFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYFNL--NKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIV-------DREIATFNSTKPTVLGPKNPQFDCCFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLS-----AGYEARQ--GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRF 698          
BLAST of Aldose 1-epimerase vs. Ensembl Nematostella
Match: EDO38130 (Aldose 1-epimerase [Source:UniProtKB/TrEMBL;Acc:A7SDT3])

HSP 1 Score: 188.348 bits (477), Expect = 1.126e-55
Identity = 117/350 (33.43%), Postives = 200/350 (57.14%), Query Frame = 2
Query:  224 MNKRLFGFSKLINEEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKL---KEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQV--SDGITRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKF 1258
            + K L+G +K   ++++ Y  +N +  +V ++S GA + ++  P    D++    ++ LG+  ++ +E N  Y G  +GRVA R++  +F ++GK++ + KNNG NCLHGG  G ++  W+    ++H   S T H    D E+GFPG + + V Y+++ DN + I+Y A   K A PINLTNHSYFNL+G    D  +  HV+ I+A K L  +K  +P G+  P++   +   +  K + +   +   P G+D+ +  +    E  +A+V   +    L +FT+Q G+QLYT NF        G+ + ++  L LEAQ++P+AIN   FP+ +L+PG +Y +  I++F
Sbjct:    6 IEKSLYGQTKA-GKDVYKYTFTNMNGVQVEVISFGAIIIAVKTP----DRNGTFEDITLGYDDIKGFEDNPPYFGSTIGRVANRIANAEFTLDGKTYHLAKNNGPNCLHGGLIGFNKVLWQSSIEEDHVKMSYTSH----DGEEGFPGKVKVTVTYSLTEDNEIRINYSATTSK-ATPINLTNHSYFNLAGQVAKD--VLSHVMWIDADKYLPTNKVQIPTGEFRPVTGEPEGAFDFTKPKAIGKDIDKTPPGYDHCFCLNQG--EGMKARVVHPESGRVLQIFTNQPGMQLYTGNFLEGNTGKAGLHYHKHDGLALEAQDYPNAINEPSFPNTVLRPGMEYKRHIIFQF 341          
BLAST of Aldose 1-epimerase vs. Ensembl Medaka
Match: galm (galactose mutarotase [Source:NCBI gene;Acc:101166275])

HSP 1 Score: 156.377 bits (394), Expect = 3.031e-43
Identity = 112/329 (34.04%), Postives = 175/329 (53.19%), Query Frame = 2
Query:  299 NTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVG---IEHCQAQVSDGITR--LTLFTDQNGLQLYTSNFFN-NVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
              KV +L+LGA ++S+      + K+    +VVLGF  +E Y  ++ YLG VVGRVA R++ G+F ++GK + +  NNG N +HGG  G ++  W L       + L   + D + G+PG++ + V YT+    +L  +Y A   +   PIN+TNHSYFNL+G    D  + DH VSI A   L + +  +P G+   +        +   +   L ++     GFD+ +         +E   A+V    +   L + T Q G+Q YT+NF + +V    G  ++++GA CLE QN+PDA+N   FP  LL+PGE+Y   T + F  I
Sbjct:   27 QVKVEVLTLGAIIRSVF----SRGKNGQMEDVVLGFDDLEGYLSDKRYLGAVVGRVANRIAGGRFVVDGKEYQLETNNGPNAIHGGVKGFNKALW-LATEVQGGVQLSLSSPDGDQGYPGEVQVCVIYTLQ-GETLTAEYQARSNR-TTPINITNHSYFNLAGQAAAD--VYDHQVSICAQSFLPVDETSIPTGETRAVQGTPFDLRDPVLIGARLKELPG--PGFDHNFCLSFPSDPWMERHAARVCHPASGRVLEVSTSQPGVQFYTANFLDGSVQGKGGTKYRKHGAFCLETQNWPDAVNQASFPDCLLRPGEEYHHVTRFTFTTI 344          
BLAST of Aldose 1-epimerase vs. Planmine SMEST
Match: SMESG000011518.1 (SMESG000011518.1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 2
Query:  224 MNKRLFGFSKLINEEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLXXXXXXXXXXLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSXXXXXXXXXXXXXXXXXXVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 1267
            MNKRLFGFSKLINEEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLGVVVGRVAGRLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSKNLDLKNNKEKLENLLLKVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI
Sbjct:    1 MNKRLFGFSKLINEEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDKSQPSVNVVLGFSTVEEYEINECYLGVVVGRVAGRLSFGKFNIEGKSFDVMKNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNINVKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHVVSINASKTLELSKDLLPNGKIVPLSKNLDLKNNKEKLENLLLKVGDNPKGFDNYYIFDTVGIEHCQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHCCEGIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI 348          
The following BLAST results are available for this feature:
BLAST of Aldose 1-epimerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GALM1.403e-4633.96galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:... [more]
GALM3.561e-2635.42galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:... [more]
GALM5.848e-2433.51galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:... [more]
GALM8.653e-1437.37galactose mutarotase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y19D10A.165.170e-3427.14Aldose 1-epimerase [Source:UniProtKB/TrEMBL;Acc:G... [more]
C01B4.65.170e-3427.14Aldose 1-epimerase [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG104677.936e-4632.37gene:FBgn0035679 transcript:FBtr0077063[more]
CG49881.613e-4129.85gene:FBgn0032372 transcript:FBtr0080254[more]
CG324444.797e-3928.24gene:FBgn0043783 transcript:FBtr0078424[more]
CG324454.521e-3428.08gene:FBgn0052445 transcript:FBtr0078425[more]
CG109961.815e-3129.19gene:FBgn0030525 transcript:FBtr0073836[more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
galm5.203e-5036.83galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040... [more]
galm5.203e-5036.83galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040... [more]
galm1.060e-4936.83galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thrb3.147e-4234.36thyroid hormone receptor, beta [Source:Xenbase;Acc... [more]
thrb6.472e-1137.37thyroid hormone receptor, beta [Source:Xenbase;Acc... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Galm5.925e-4535.63galactose mutarotase [Source:MGI Symbol;Acc:MGI:24... [more]
Galm3.082e-1230.29galactose mutarotase [Source:MGI Symbol;Acc:MGI:24... [more]
back to top
BLAST of Aldose 1-epimerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96C23|GALM_HUMAN6.740e-4633.96Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM... [more]
sp|Q5R8U1|GALM_PONAB1.088e-4534.58Aldose 1-epimerase OS=Pongo abelii OX=9601 GN=GALM... [more]
sp|Q9GKX6|GALM_PIG3.640e-4535.51Aldose 1-epimerase OS=Sus scrofa OX=9823 GN=GALM P... [more]
sp|Q66HG4|GALM_RAT3.659e-4435.00Aldose 1-epimerase OS=Rattus norvegicus OX=10116 G... [more]
sp|Q8K157|GALM_MOUSE4.145e-4435.63Aldose 1-epimerase OS=Mus musculus OX=10090 GN=Gal... [more]
back to top
BLAST of Aldose 1-epimerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G4FLL94.341e-5934.40Aldose 1-epimerase OS=Planctomycetaceae bacterium ... [more]
A0A1I8GBH54.116e-5836.97Aldose 1-epimerase OS=Macrostomum lignano OX=28230... [more]
A0A2E8H9K41.189e-5733.70Aldose 1-epimerase OS=Gemmatimonadaceae bacterium ... [more]
A0A2C9JK141.537e-5737.24Aldose 1-epimerase OS=Biomphalaria glabrata OX=652... [more]
A0A136LUH82.764e-5735.86Aldose 1-epimerase OS=Chloroflexi bacterium OLB15 ... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
galm5.674e-5238.04galactose mutarotase [Source:NCBI gene;Acc:1030309... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
galm7.977e-4735.40galactose mutarotase [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YNR071C_mRNA3.101e-2028.49Putative aldose 1-epimerase [Source:SGD;Acc:S00000... [more]
YHR210C_mRNA7.387e-1728.34Putative aldose 1-epimerase superfamily protein; n... [more]
GAL104.508e-1627.97UDP-glucose-4-epimerase; catalyzes interconversion... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO381301.126e-5533.43Aldose 1-epimerase [Source:UniProtKB/TrEMBL;Acc:A... [more]
back to top
BLAST of Aldose 1-epimerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
galm3.031e-4334.04galactose mutarotase [Source:NCBI gene;Acc:1011662... [more]
back to top
BLAST of Aldose 1-epimerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000011518.10.000e+0100.00SMESG000011518.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017378 ID=SMED30017378|Name=Aldose 1-epimerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1392bp
CTTTTGCTAAATTATATAATTATATAAAATAAACATATAATTTTCAAAAT
CAATTTAATTTTAAGAATTTTAAGTGGAAATTTTTCGATAAATTTATAAT
AATATTAAATTCAAAATTTATGTTCGATTTTTCTCACAATTTGTTTACGT
TACATAGTTCGATAAAGTTTTAGATTGACTGATTAGTAATATAAATATTA
AAATCAGCAAGTTGTTTTCAATAATGAATAAACGATTATTCGGATTTTCC
AAACTTATTAATGAAGAAATTTTTCTTTATGAAATCTCAAATAAATCGAA
TACCAAGGTAAACATATTATCGTTAGGAGCAGCCGTCCAAAGTATAAATT
TACCTTGGCAAGGAAAAGACAAATCGCAACCATCTGTTAATGTTGTATTG
GGATTTTCAACTGTTGAAGAGTATGAAATAAATGAGTGCTATCTCGGTGT
AGTTGTTGGTAGAGTGGCTGGTCGATTAAGTTTTGGAAAGTTTAATATTG
AAGGAAAATCGTTTGATGTAATGAAAAATAATGGTGGAAATTGTTTGCAT
GGCGGCCGAACTGGATTATCTCGAAAAAATTGGAAACTTAAAGAGCACAC
GAATGACAGTATTACTCTTCATTGTTTTACTGCTGATAATGAAGATGGAT
TTCCCGGTGACATGAACATTAATGTGAAGTACACAATTAGTCCCGATAAT
TCATTGGTTATTGACTATGATGCATTTGTCGAGAAGCACGCATGTCCAAT
AAACCTGACCAATCACAGCTACTTTAATCTTTCTGGTAATACGGTTGTCG
ACAGAGGCATTAGAGACCATGTCGTATCAATAAATGCCTCTAAAACATTA
GAATTAAGTAAAGATTTGCTGCCTAATGGAAAAATTGTTCCACTTTCAAA
GAATTTGGATTTGAAAAACAACAAAGAAAAATTAGAAAATCTTTTGTTGA
AAGTCGGCGATAATCCTAAGGGATTTGATAACTATTATATTTTCGACACT
GTTGGAATTGAACATTGCCAGGCCCAGGTTAGCGATGGAATAACGCGATT
GACATTGTTTACCGATCAGAATGGCTTGCAATTATATACATCGAATTTTT
TCAACAATGTCCACTGTTGCGAGGGCATAGTACATCAGCAATACGGGGCC
CTGTGTTTGGAGGCTCAAAACTTTCCGGATGCTATTAACCATCACGAATT
TCCATCGATATTGCTGAAGCCCGGCGAGAAATATGTGCAAAAAACGATTT
ATAAATTCGATAAAATTTGATTTGGTGCTAAATATAAATTTCTAATTAAC
TTTAGATGATTAAATTGTTAATTTTGATAATTAATTTTACATTGATTTTG
ATTGGTTAATGTTTAATATAATTTCATATATTTGAAAAAAAA
back to top

protein sequence of SMED30017378-orf-1

>SMED30017378-orf-1 ID=SMED30017378-orf-1|Name=SMED30017378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MNKRLFGFSKLINEEIFLYEISNKSNTKVNILSLGAAVQSINLPWQGKDK
SQPSVNVVLGFSTVEEYEINECYLGVVVGRVAGRLSFGKFNIEGKSFDVM
KNNGGNCLHGGRTGLSRKNWKLKEHTNDSITLHCFTADNEDGFPGDMNIN
VKYTISPDNSLVIDYDAFVEKHACPINLTNHSYFNLSGNTVVDRGIRDHV
VSINASKTLELSKDLLPNGKIVPLSKNLDLKNNKEKLENLLLKVGDNPKG
FDNYYIFDTVGIEHCQAQVSDGITRLTLFTDQNGLQLYTSNFFNNVHCCE
GIVHQQYGALCLEAQNFPDAINHHEFPSILLKPGEKYVQKTIYKFDKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR015443Aldose_1-epimerase
IPR014718GH-type_carb-bd
IPR008183Aldose_1/G6P_1-epimerase
IPR018052Ald1_epimerase_CS
IPR011013Gal_mutarotase_sf_dom
Vocabulary: biological process
TermDefinition
GO:0019318hexose metabolic process
GO:0005975carbohydrate metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016853isomerase activity
GO:0030246carbohydrate binding
GO:0003824catalytic activity
GO:0004034aldose 1-epimerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008183Aldose 1-/Glucose-6-phosphate 1-epimerasePFAMPF01263Aldose_epimcoord: 18..344
e-value: 3.8E-67
score: 226.7
IPR015443Aldose 1-epimerasePIRSFPIRSF005096GALMcoord: 2..348
e-value: 9.6E-93
score: 308.5
IPR014718Glycoside hydrolase-type carbohydrate-bindingGENE3DG3DSA:2.70.98.10coord: 9..347
e-value: 3.4E-98
score: 330.9
NoneNo IPR availablePANTHERPTHR10091:SF0ALDOSE 1-EPIMERASEcoord: 14..346
NoneNo IPR availablePANTHERPTHR10091ALDOSE-1-EPIMERASEcoord: 14..346
NoneNo IPR availableCDDcd09019galactose_mutarotase_likecoord: 18..345
e-value: 7.65729E-124
score: 357.201
IPR018052Aldose 1-epimerase, conserved sitePROSITEPS00545ALDOSE_1_EPIMERASEcoord: 177..186
IPR011013Galactose mutarotase-like domain superfamilySUPERFAMILYSSF74650Galactose mutarotase-likecoord: 13..345