Diphthine methyltransferase

Overview
NameDiphthine methyltransferase
Smed IDSMED30017368
Length (bp)1072
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diphthine methyltransferase (SMED30017368) t-SNE clustered cells

Violin plots show distribution of expression levels for Diphthine methyltransferase (SMED30017368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diphthine methyltransferase (SMED30017368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diphthine methyltransferase (SMED30017368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30017368SMESG000060795.1 dd_Smed_v4_7236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017368SMESG000060795.1 dd_Smed_v4_7236_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diphthine methyltransferase vs. Ensembl Human
Match: DPH7 (diphthamide biosynthesis 7 [Source:HGNC Symbol;Acc:HGNC:25199])

HSP 1 Score: 124.02 bits (310), Expect = 4.364e-31
Identity = 92/280 (32.86%), Postives = 136/280 (48.57%), Query Frame = 2
Query:  191 RNGSVLLIKF-DNKSARVVGGLS--DIDGILDCCW----VSSNQFI-LASSLGTLYFC----SHEPTSIKIEQKVSITEKSLCLSVDCHSDK----------IICSNSLGEIAIL--NSKREVLFQEIV----HRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLF-SNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVV-CTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            R G + L  F DN S   +  +   D   ILD  W    V+ +  + LA + G++       S +   ++    +++ E+ L LS+D  + K          II S+S G++ +L  N  R  L Q++     H+FE W+   +     + YSGGDD    G+D R   K LF S R  MG  SIQS P   ++++TGSYD  + +WD R +KQP+      GG+WR KW P  + L+L A MH+GF ++ C            +      DSL YGADW
Sbjct:   62 RLGRLFLYSFNDNNSIHPLVEVQRKDTSAILDMKWCHIPVAGHALLGLADASGSIQLLRLVESEKSHVLEPLSSLALEEQCLALSLDWSTGKTGRAGDQPLKIISSDSTGQLHLLMVNETRPRL-QKVASWQAHQFEAWIAAFNYWHPEIVYSGGDDGLLRGWDTRVPGKFLFTSKRHTMGVCSIQSSPHREHILATGSYDEHILLWDTRNMKQPLADTPVQGGVWRIKWHPFHHHLLLAACMHSGFKILNCQKAMEERQEATVLTSHTLPDSLVYGADW 340          
BLAST of Diphthine methyltransferase vs. Ensembl Celegans
Match: Y43F4B.9 (pep chromosome:WBcel235:III:13315088:13318597:1 gene:WBGene00012806.1 transcript:Y43F4B.9a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.9)

HSP 1 Score: 56.225 bits (134), Expect = 1.176e-8
Identity = 65/283 (22.97%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  161 CYQLDESSRSRNGSVLLIKFDNKSA-RVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCS-HEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQE-IVHRF--------ECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWR-----HKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMI 961
             Y LD SS +R+GS+ ++K D     ++   +S   G+    + + +  + A + G+L      EP S +     S     L LS    S   I +++ G   I++    ++    + H          E W   +S+  + +  +GG+D     +D R   +   S   E G   +    ++ + + TGSYD  +RI+D R LK  ++  +  GG+W       ++C         + M+ G+S++ +D     D +   +  GS  +L YGA  ++A++++
Sbjct:   30 TYLLDTSSDTRSGSLCILKIDEADGLQLENEISTSAGVFRFDFRNPSTIVAALTDGSLVVQKIEEPVSSETTPVSSDMLLDLGLS---DSSLTITTDNKGHAYIVDLNTSLIVSTWLAHSLPYVPGEGCEVWSCAISKDAQTVV-TGGEDGSMKLWDARSRTQTGQSKIFEAGVVFVDFPASNEDQILTGSYDEHVRIFDRRNLKTVLKEKKLSGGVWNIEQVGSEYC--------TSCMYGGYSILNSDTL---DIVHENRDVGS--NLLYGATKMSANSVL 295          
BLAST of Diphthine methyltransferase vs. Ensembl Celegans
Match: Y43F4B.9 (pep chromosome:WBcel235:III:13315125:13318597:1 gene:WBGene00012806.1 transcript:Y43F4B.9a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.9)

HSP 1 Score: 56.225 bits (134), Expect = 1.176e-8
Identity = 65/283 (22.97%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  161 CYQLDESSRSRNGSVLLIKFDNKSA-RVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCS-HEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQE-IVHRF--------ECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWR-----HKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMI 961
             Y LD SS +R+GS+ ++K D     ++   +S   G+    + + +  + A + G+L      EP S +     S     L LS    S   I +++ G   I++    ++    + H          E W   +S+  + +  +GG+D     +D R   +   S   E G   +    ++ + + TGSYD  +RI+D R LK  ++  +  GG+W       ++C         + M+ G+S++ +D     D +   +  GS  +L YGA  ++A++++
Sbjct:   30 TYLLDTSSDTRSGSLCILKIDEADGLQLENEISTSAGVFRFDFRNPSTIVAALTDGSLVVQKIEEPVSSETTPVSSDMLLDLGLS---DSSLTITTDNKGHAYIVDLNTSLIVSTWLAHSLPYVPGEGCEVWSCAISKDAQTVV-TGGEDGSMKLWDARSRTQTGQSKIFEAGVVFVDFPASNEDQILTGSYDEHVRIFDRRNLKTVLKEKKLSGGVWNIEQVGSEYC--------TSCMYGGYSILNSDTL---DIVHENRDVGS--NLLYGATKMSANSVL 295          
BLAST of Diphthine methyltransferase vs. Ensembl Celegans
Match: Y43F4B.9 (pep chromosome:WBcel235:III:13315123:13318597:1 gene:WBGene00012806.1 transcript:Y43F4B.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.9)

HSP 1 Score: 56.225 bits (134), Expect = 1.176e-8
Identity = 65/283 (22.97%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  161 CYQLDESSRSRNGSVLLIKFDNKSA-RVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCS-HEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQE-IVHRF--------ECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWR-----HKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMI 961
             Y LD SS +R+GS+ ++K D     ++   +S   G+    + + +  + A + G+L      EP S +     S     L LS    S   I +++ G   I++    ++    + H          E W   +S+  + +  +GG+D     +D R   +   S   E G   +    ++ + + TGSYD  +RI+D R LK  ++  +  GG+W       ++C         + M+ G+S++ +D     D +   +  GS  +L YGA  ++A++++
Sbjct:   30 TYLLDTSSDTRSGSLCILKIDEADGLQLENEISTSAGVFRFDFRNPSTIVAALTDGSLVVQKIEEPVSSETTPVSSDMLLDLGLS---DSSLTITTDNKGHAYIVDLNTSLIVSTWLAHSLPYVPGEGCEVWSCAISKDAQTVV-TGGEDGSMKLWDARSRTQTGQSKIFEAGVVFVDFPASNEDQILTGSYDEHVRIFDRRNLKTVLKEKKLSGGVWNIEQVGSEYC--------TSCMYGGYSILNSDTL---DIVHENRDVGS--NLLYGATKMSANSVL 295          
BLAST of Diphthine methyltransferase vs. Ensembl Fly
Match: CG3184 (gene:FBgn0029892 transcript:FBtr0070989)

HSP 1 Score: 114.005 bits (284), Expect = 2.165e-28
Identity = 93/307 (30.29%), Postives = 140/307 (45.60%), Query Frame = 2
Query:  179 SSRSRNGSVLLIKFDNKSARVVG-GLSDIDGILDCCWVSS------NQFILASSLGTLYFCS--------HEPTSIKIEQKVSITEKSLCLSVDCHSD----KIICSNSLGEIAILN--SKREVLFQE--IVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEM-GCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLA----ADAMIAGDRCHHYLVTASSFYDH 1015
            + R R G V L +F+ ++ R+      +   ILD  W+ +            +SLG +               T   + ++ S  E  L L++D   D    ++  S+S G + +L+  S+ E++ +   + H FE W     R   ++ YSGGDD      DLR   ++ ++NR  M G T + SHP   N + TGSYD QLR++D R +K+ +   +  GGIWR K  P    L+L A M+  FSVV  D  A    L+   +     S+ YGADW       DA +    C        SFYDH
Sbjct:   50 AKRPRKGRVYLYQFEEENCRLERLQCIETSAILDMKWLPAWSSECNPHLATVNSLGQMELYEFLQDAKLLQRRTCFSLAEQDSSEEAPLALALDWQHDGQHIRLAISDSKGGLNLLSYSSQGEIIRERSWLSHGFEAWTCAFDRWSPHILYSGGDDMLLMAHDLR-TKQRAWTNRAHMAGVTCLLSHPRHENHLLTGSYDEQLRLFDTRSMKRSLAELDLSGGIWRLKPHPAQPDLILAACMYTNFSVVQLDVAAPGLSLLGAYE--EHKSICYGADWAPWRNKDDASLTMATC--------SFYDH 345          
BLAST of Diphthine methyltransferase vs. Ensembl Zebrafish
Match: dph7 (diphthamide biosynthesis 7 [Source:ZFIN;Acc:ZDB-GENE-070410-57])

HSP 1 Score: 111.694 bits (278), Expect = 6.255e-27
Identity = 65/184 (35.33%), Postives = 96/184 (52.17%), Query Frame = 2
Query:  428 KIICSNSLGEIAILN---SKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLR--CVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQT-----GS---SDSLAYGADW 940
            +++ S+S G + +L+   +    + Q   H +E W+   S  +    YSGGDD K  G+DLR  C      S R  MG  SI S+P   ++++TGSYD  + +WD R +KQP+      GG+WR KW P+   L+L A MH  F ++   +       +  Q+T     GS    +SLAYGADW
Sbjct:  159 RVVSSDSTGSLTLLSLGEADLTAVCQWKAHEYEAWISAFSYWDTQTVYSGGDDSKLKGWDLRMGCSSPTFTSKRHTMGVCSIHSNPHREHILATGSYDENVLLWDGRNMKQPLSETAVGGGVWRLKWHPSQEHLLLAACMHNDFQILYCQKA------LEGQETPCPVLGSYILHNSLAYGADW 336          
BLAST of Diphthine methyltransferase vs. Ensembl Xenopus
Match: sh2d4a (SH2 domain containing 4A [Source:Xenbase;Acc:XB-GENE-492416])

HSP 1 Score: 80.8777 bits (198), Expect = 6.352e-17
Identity = 40/85 (47.06%), Postives = 55/85 (64.71%), Query Frame = 2
Query:  686 VSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            +S  SYD  + +WD RQ+KQP+      GG+WR KW PT + L+L AGMH+GF ++  D + SD+C I +      +SLAYGADW
Sbjct:   45 ISPTSYDEHVLLWDTRQMKQPVSDTHVQGGVWRLKWHPTHSNLLLAAGMHSGFHILDCDFK-SDECPI-LTSYVLHNSLAYGADW 127          
BLAST of Diphthine methyltransferase vs. Ensembl Xenopus
Match: rnf157 (ring finger protein 157 [Source:Xenbase;Acc:XB-GENE-5933399])

HSP 1 Score: 48.9062 bits (115), Expect = 5.701e-6
Identity = 35/139 (25.18%), Postives = 62/139 (44.60%), Query Frame = 2
Query:  347 EPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEI-VHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNR-LEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRT 757
            EP S+ + + V+    +   S     +   C+     + I + K  V    I  H+ E       ++++NL  +G  DC   G+DLR V + +F  R        ++  P  AN+V++ SYD  +R+WD  +    + T
Sbjct:  144 EPDSVTLREMVNFGTANRVASTHEGKETGHCTAGDQSLRIWDMKTPVSKVVIPAHQAEILSCDWCKYDQNLLVTGAVDCSLKGWDLRTVRQPVFELRGHNYAIRRVKFSPFHANIVASCSYDFTVRLWDFSKSSSLLET 282          
BLAST of Diphthine methyltransferase vs. Ensembl Xenopus
Match: rnf157 (ring finger protein 157 [Source:Xenbase;Acc:XB-GENE-5933399])

HSP 1 Score: 48.9062 bits (115), Expect = 6.136e-6
Identity = 22/67 (32.84%), Postives = 38/67 (56.72%), Query Frame = 2
Query:  539 RHEENLFYSGGDDCKFNGFDLRCVDKKLFSNR-LEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQ 736
            ++++NL  +G  DC   G+DLR V + +F  R        ++  P  AN+V++ SYD  +R+WD  +
Sbjct:  192 KYDQNLLVTGAVDCSLKGWDLRTVRQPVFELRGHNYAIRRVKFSPFHANIVASCSYDFTVRLWDFSK 258          
BLAST of Diphthine methyltransferase vs. Ensembl Xenopus
Match: rnf157 (ring finger protein 157 [Source:Xenbase;Acc:XB-GENE-5933399])

HSP 1 Score: 48.9062 bits (115), Expect = 7.944e-6
Identity = 34/132 (25.76%), Postives = 60/132 (45.45%), Query Frame = 2
Query:  347 EPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEI-VHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNR-LEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQ 736
            EP S+ + + V+    +   S     +   C+     + I + K  V    I  H+ E       ++++NL  +G  DC   G+DLR V + +F  R        ++  P  AN+V++ SYD  +R+WD  +
Sbjct:  175 EPDSVTLREMVNFGTANRVASTHEGKETGHCTAGDQSLRIWDMKTPVSKVVIPAHQAEILSCDWCKYDQNLLVTGAVDCSLKGWDLRTVRQPVFELRGHNYAIRRVKFSPFHANIVASCSYDFTVRLWDFSK 306          
BLAST of Diphthine methyltransferase vs. Ensembl Xenopus
Match: rnf157 (ring finger protein 157 [Source:Xenbase;Acc:XB-GENE-5933399])

HSP 1 Score: 48.521 bits (114), Expect = 8.693e-6
Identity = 22/67 (32.84%), Postives = 38/67 (56.72%), Query Frame = 2
Query:  539 RHEENLFYSGGDDCKFNGFDLRCVDKKLFSNR-LEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQ 736
            ++++NL  +G  DC   G+DLR V + +F  R        ++  P  AN+V++ SYD  +R+WD  +
Sbjct:  209 KYDQNLLVTGAVDCSLKGWDLRTVRQPVFELRGHNYAIRRVKFSPFHANIVASCSYDFTVRLWDFSK 275          
BLAST of Diphthine methyltransferase vs. Ensembl Mouse
Match: Dph7 (diphthamine biosynethesis 7 [Source:MGI Symbol;Acc:MGI:1914478])

HSP 1 Score: 123.25 bits (308), Expect = 7.286e-31
Identity = 83/280 (29.64%), Postives = 140/280 (50.00%), Query Frame = 2
Query:  191 RNGSVLLIKF-DNKSARVVGGLS--DIDGILDCCW----VSSNQFI-LASSLGT-----LYFCSHEPTSIKIEQKVSITEKSLCLSVDCHSDK----------IICSNSLGEIAIL-----NSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLE-MGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVV-CTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            R G + L  F ++ +A+ +  +   D   +LD  W    VS +  + LA++ G+     L  C +   +++    +++ E  L LS+D  + K          II S+S G++ +L      ++ +++     H FE W+   +  +  L YSGGDDC   G+D R +   +F+++   MG  SIQS P   ++++TGSYD  + +WD R ++QP+      GG+WR KW P  + L+L A MH GF ++ C         +  +      +SL YGADW
Sbjct:   60 RLGRLYLFSFSEHNTAKPLLEVQRRDSSAVLDMKWCHIPVSGHVLLGLANASGSIGLLRLMECENNSYTLQPISSLALDENCLSLSMDWSTGKSVRAREQPLKIISSDSKGQLHLLMVNEGTAELQLVASWPAHHFEAWIAAFNYWQTELVYSGGDDCLLRGWDTRMLGTPVFTSKRHCMGVCSIQSSPHQEHILATGSYDEHVLLWDTRNIRQPLADVPVQGGVWRLKWHPVHHHLLLAACMHNGFKILNCQKAIEEKQDITVLTSHEMPNSLVYGADW 339          
BLAST of Diphthine methyltransferase vs. UniProt/SwissProt
Match: sp|Q55C80|DPH7_DICDI (Diphthine methyltransferase homolog OS=Dictyostelium discoideum OX=44689 GN=wdr85 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 6.898e-37
Identity = 93/253 (36.76%), Postives = 132/253 (52.17%), Query Frame = 2
Query:  266 GILDCCWVSSNQFILA--SSLGTLYFCSHEPTSIKIEQK----VSITEKSLCLSVDCHS--DKIICSNSLGEIAILNSKREV--LFQEI---VHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCV-----------DKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFET-DGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDD---CLIRMQQTGSSDSLAYGADW 940
            GILD  W ++   IL    S G L    ++    K+E K    +S++   L LS+D +   DK+ICS S G I +    ++   + +E     H +E W+   + H+E++ +SGGDDCKF  +DL  +               F+ R +MG TSI  HPT  NL++ GSYD  LRIWDL+ LKQPI T ++  GGIWR KW P     ++ A M  GF ++ TD +  +D     I     G   S+AYG DW
Sbjct:   88 GILDMKWNNNKDRILGVVMSKGELNIYQYDEVEKKLELKSSTEISLSNDILSLSLDWNKSGDKLICSFSDGNIGLFKVTKDYSKVTEEKRWKAHDYEAWICAFNYHDESIVFSGGDDCKFKIWDLNQLLNHNDDDIGIPPTPKFTKRCDMGVTSIHCHPTIENLIAVGSYDECLRIWDLKSLKQPIITTDSLGGGIWRIKWHPFQKNKLVTACMGGGFHILSTDPENINDFSTLQIEQSYNGPHKSIAYGVDW 340          
BLAST of Diphthine methyltransferase vs. UniProt/SwissProt
Match: sp|Q9BTV6|DPH7_HUMAN (Diphthine methyltransferase OS=Homo sapiens OX=9606 GN=DPH7 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 2.096e-30
Identity = 92/280 (32.86%), Postives = 136/280 (48.57%), Query Frame = 2
Query:  191 RNGSVLLIKF-DNKSARVVGGLS--DIDGILDCCW----VSSNQFI-LASSLGTLYFC----SHEPTSIKIEQKVSITEKSLCLSVDCHSDK----------IICSNSLGEIAIL--NSKREVLFQEIV----HRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLF-SNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVV-CTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            R G + L  F DN S   +  +   D   ILD  W    V+ +  + LA + G++       S +   ++    +++ E+ L LS+D  + K          II S+S G++ +L  N  R  L Q++     H+FE W+   +     + YSGGDD    G+D R   K LF S R  MG  SIQS P   ++++TGSYD  + +WD R +KQP+      GG+WR KW P  + L+L A MH+GF ++ C            +      DSL YGADW
Sbjct:   62 RLGRLFLYSFNDNNSIHPLVEVQRKDTSAILDMKWCHIPVAGHALLGLADASGSIQLLRLVESEKSHVLEPLSSLALEEQCLALSLDWSTGKTGRAGDQPLKIISSDSTGQLHLLMVNETRPRL-QKVASWQAHQFEAWIAAFNYWHPEIVYSGGDDGLLRGWDTRVPGKFLFTSKRHTMGVCSIQSSPHREHILATGSYDEHILLWDTRNMKQPLADTPVQGGVWRIKWHPFHHHLLLAACMHSGFKILNCQKAMEERQEATVLTSHTLPDSLVYGADW 340          
BLAST of Diphthine methyltransferase vs. UniProt/SwissProt
Match: sp|Q9CYU6|DPH7_MOUSE (Diphthine methyltransferase OS=Mus musculus OX=10090 GN=Dph7 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 5.097e-30
Identity = 83/280 (29.64%), Postives = 140/280 (50.00%), Query Frame = 2
Query:  191 RNGSVLLIKF-DNKSARVVGGLS--DIDGILDCCW----VSSNQFI-LASSLGT-----LYFCSHEPTSIKIEQKVSITEKSLCLSVDCHSDK----------IICSNSLGEIAIL-----NSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLE-MGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVV-CTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            R G + L  F ++ +A+ +  +   D   +LD  W    VS +  + LA++ G+     L  C +   +++    +++ E  L LS+D  + K          II S+S G++ +L      ++ +++     H FE W+   +  +  L YSGGDDC   G+D R +   +F+++   MG  SIQS P   ++++TGSYD  + +WD R ++QP+      GG+WR KW P  + L+L A MH GF ++ C         +  +      +SL YGADW
Sbjct:   60 RLGRLYLFSFSEHNTAKPLLEVQRRDSSAVLDMKWCHIPVSGHVLLGLANASGSIGLLRLMECENNSYTLQPISSLALDENCLSLSMDWSTGKSVRAREQPLKIISSDSKGQLHLLMVNEGTAELQLVASWPAHHFEAWIAAFNYWQTELVYSGGDDCLLRGWDTRMLGTPVFTSKRHCMGVCSIQSSPHQEHILATGSYDEHVLLWDTRNIRQPLADVPVQGGVWRLKWHPVHHHLLLAACMHNGFKILNCQKAIEEKQDITVLTSHEMPNSLVYGADW 339          
BLAST of Diphthine methyltransferase vs. UniProt/SwissProt
Match: sp|O74865|DPH7_SCHPO (Diphthine methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrt2 PE=3 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 3.269e-18
Identity = 90/311 (28.94%), Postives = 139/311 (44.69%), Query Frame = 2
Query:  164 YQLDESSRSRNGSVLLIKFDNKSARVVGGLSDI--DGILDCCWVSSNQFILA--SSLGTLYFCSHE-PTSIKIEQKVSITEKS-LCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEI----------VHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRL--EMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAG--MHAGFSVV-CTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDHRWSLSE 1033
            Y LDES++ R+G ++L  +D K   V+  + D+  D ILD  W   +  +LA   S G + F  H+    +   + + + + S L LS+D        S+S  E+A+  S   VL  +I           H +E W  H SR + NL YSGGDD     +D R  +  ++ +      G  SI S       ++TG Y   +   D R + +P+ +    GG+WR +   T      V G  MH G  V+  ++  +S D   R+ +    +S+ YG DW   D ++A            SFYD R  L E
Sbjct:   36 YMLDESTKLRHGKLVL--YDTKE-DVLKRVFDMHCDAILDFKWSPHDASVLAVAHSTGHVSFYRHQFRAELMFLRGIKVADSSVLMLSLDF-------SDSGKELAVSMSNGSVLIIDIDSGVIKNKWKEHDYEAWTCHYSRQDNNLLYSGGDDAALVCYDQRIPNSCIWRDIQVHHSGVVSILSRAPFGPYIATGEYGDFMHTLDTRNIGKPLFSANLGGGVWRLEHMETTENYHKVLGILMHRGAQVLRISNDFSSIDASKRIFK--EHESMCYGGDWRHTDGLLA----------TCSFYDKRVCLWE 324          
BLAST of Diphthine methyltransferase vs. UniProt/SwissProt
Match: sp|P38332|DPH7_YEAST (Diphthine methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRT2 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.966e-9
Identity = 53/197 (26.90%), Postives = 82/197 (41.62%), Query Frame = 2
Query:  506 HRFECWVGHLSRHE--ENLFYSGGDDCKFNGFDLRCVDKKLFSNRL-EMGCTSIQ-SHPTDAN----LVSTGSYDGQLRIWDLRQLKQPI-----------RTFETDGGIWRHKWCP--------TGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDH 1015
            H  ECW       +  +++ ++GGDD +    DLR  +    +NR+ + G  SI+ S P   N     + TGSYD  +R  DLR + + I              +  GG+WR    P         G+  +LV  M+ G  VV  +  + +   I+       DS+ YG DW             + L+   SFYD+
Sbjct:  196 HELECWTAEFGSLQPFQDVVFTGGDDSRIMAHDLRSKEFIWSNNRIHDAGVVSIKCSQPNFRNNKPTSIITGSYDDNIRSLDLRMMGESIFPGANVPTVNKLACDLGGGVWRFVESPIDQEQSHHNGSDRLLVCCMYNGAKVVTMNDNSDEYFQIQHYLKKGHDSMCYGGDW------------SNSLIATCSFYDN 380          
BLAST of Diphthine methyltransferase vs. TrEMBL
Match: A0A564Y0H3 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1785 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.298e-43
Identity = 103/288 (35.76%), Postives = 160/288 (55.56%), Query Frame = 2
Query:  110 YSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIKFD---NKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSK-REVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC-VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQL----KQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQT--GSSDSLAYGADW 940
            ++DS E SP     +   Y+L+ES+R R GSV  I++D   NK+ + +G   D+ G+LD  W+SS   + A+S G +Y    + TS  I   V+   + L LS+D  + KII S+  G + +++S    V+     H +E W    +R+++NL  +GGDDC  + +D R   +K +FS + +MG  S+   P  + L+STG +D +LR+WDLR+     ++ +      GG+WRHKW P+G+  VL+A MHAGF+V       S   L     T    ++ LAYG DW
Sbjct:   14 HTDSVEFSPSGSQALVGSYELNESTRERTGSV--IRYDIASNKAEKSLG--VDLPGVLDLSWMSSELCLAATSSGEIYTIKSKVTSPLILHCVNRVSEKLLLSIDFCNSKIITSDEAGYVHLISSSDNNVICTWKAHEYESWCARFNRNDDNLLLTGGDDCMAHVWDQRIGFNKAVFSQQHQMGVCSLSGIPMHSRLISTGCFDEKLRLWDLRKTSSESEEIVVLHSEGGGVWRHKWSPSGHH-VLMACMHAGFAVASVTNFGSGAALPIATATFYRPTEKLAYGIDW 296          
BLAST of Diphthine methyltransferase vs. TrEMBL
Match: A0A0R3WB59 (WD_REPEATS_REGION domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7846 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 4.314e-43
Identity = 115/325 (35.38%), Postives = 169/325 (52.00%), Query Frame = 2
Query:   83 EITHIDTLQYSDSSEISPDKIFCINCCYQLDESSRS---RNGSVLLIKFDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPT-SIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEI-VHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC-VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQ----LKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTD----RQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDH 1015
            E++  +   ++DS E SP     +   Y+LDE+S +   RNG ++  + D K       L  + G+LD CW+ S+  + A+S G LY     P+  + I+   SI++K L LSVD H  K + ++  G + +++S +  +      H FE W    S++++NL  SGGDDC  + +D R    K +FS R EMG  S+ S P   +L+STG +D +LRIWDLR       + +      GG+WRHKW P  + L L+A MHAGF+VV       + +SD  L +      S  LAYG DW   D      R    L T  SFYD+
Sbjct:    7 EVSSYNFGLHADSIEFSPCGKQALVGFYELDEASLTSGKRNGQLVKFEIDGKHVEKSYELK-VPGVLDLCWMRSDLCLAATSSGELYTILSPPSQPLTIQSTTSISQK-LLLSVDFHGTKAVTADETGNMYLIDSPKGAVISTCKAHEFESWCVRFSKNDDNLVLSGGDDCMAHVWDQRVGFTKCVFSKRHEMGVCSLSSIPKHRHLISTGCFDEKLRIWDLRSDGSGGAEIVVCHSEGGGVWRHKWSPWASRL-LMACMHAGFAVVGVPADLIKPSSDGPLAKPTFYRPSAKLAYGVDWCINDWADEQRRFEALLATC-SFYDN 327          
BLAST of Diphthine methyltransferase vs. TrEMBL
Match: A0A0R3TTI2 (WD_REPEATS_REGION domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11015 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.618e-43
Identity = 102/303 (33.66%), Postives = 167/303 (55.12%), Query Frame = 2
Query:   77 WKEITHIDTLQYSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIKFD----NKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILN-SKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC-VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLK----QPIRTFETD-GGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGS----SDSLAYGADW 940
            + EI+      ++D+ E SP     +   Y+L+ES+R R GSV+  +      NKS  +     D+ G+LD  W+  +  ++ASS G +Y     P+       ++   +SL LS+D +S+KI+ S++ G I ++N S   V+ +   H +E W    +R+++ L  +GGDDC    +D R    + +F  + EMG  S+   P  ++L+STG +D +LR+WDLR+ +    + +  F ++ GG+WRHKW P G+  VL+A MHAGF+VV      SDD  ++   T +    ++ LAYG DW
Sbjct:    3 FSEISSWTLRLHTDAVEFSPSGSQALIGTYELNESTRERYGSVICYEISPNQANKSFEI-----DLPGVLDLSWMCPDLCLVASSSGEIYTIQSHPSQPLTVHSINKVSESLLLSIDFNSNKIVTSDADGFIYLINASDNHVICKWKAHEYEPWCAQFNRNDDYLLLTGGDDCMARVWDQRVGFSQSVFDQKHEMGVCSLYGVPMHSHLISTGCFDEKLRLWDLRKTRSDKPEELVVFHSEGGGVWRHKWSPNGHH-VLMACMHAGFAVVHVTHFGSDD--LKPVATAAFYRPTEKLAYGVDW 297          
BLAST of Diphthine methyltransferase vs. TrEMBL
Match: A0A068WIS6 (WD40 repeat containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_001034600 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.083e-42
Identity = 114/319 (35.74%), Postives = 165/319 (51.72%), Query Frame = 2
Query:  110 YSDSSEISPDKIFCINCCYQLDESSRS---RNGSVLLIKFDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPT-SIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEI-VHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC-VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQL-----KQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQAS----DDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHY--LVTASSFYDH 1015
            ++DS E+SP     +   Y+LDE+S +   RNG ++  + D K       L  + G+LD CW+ S+  + A+S G LY  S +P+  + I   +S+++K L LS D H  K + ++  G I +++S +  +      H FE W    S++++NL  SGGDDC    +D R    K  FS R EMG  S+ S PT  +L+STG +D +LRIWDLR +      + +      GG+WRHKW P    L L+A MHAGF+VV      S    D  L +      S  LAYG DW         D   H+  L+   SFYD+
Sbjct:   16 HTDSIELSPCGEQALVGSYELDEASLTTGKRNGQLVRFEIDEKHVAKSYELK-VPGVLDLCWMCSDLCLAATSSGELYTISSQPSQPLTIRNIISVSQK-LLLSADFHGTKAVTADETGNIYLVDSPKGAVISTCKAHEFESWCVRFSKNDDNLVLSGGDDCISRVWDQRVGFTKCTFSRRHEMGVCSLSSVPTHRHLISTGCFDEKLRIWDLRSVGGGGSAEVVVCHSEGGGVWRHKWSPCAGRL-LMACMHAGFAVVRVPAGLSVPSPDGPLAKPTFYQPSAKLAYGVDW---HINAWADEQQHFEALLATCSFYDN 328          
BLAST of Diphthine methyltransferase vs. TrEMBL
Match: A0A5K3FTQ2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.471e-41
Identity = 113/315 (35.87%), Postives = 164/315 (52.06%), Query Frame = 2
Query:  110 YSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIKFDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLY-FCSHEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNS-KREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC-VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQAS--------DDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHY--LVTASSFYDH 1015
            ++D  E SP     +   YQLDE+++ R+G +   +     A  V  L D  GILD  W+ S+  + A+S G LY   S +   + I    +I+E S+ LS DCH + ++ S+  G + +++  K+++L     H FE W   L+R++ NL  SGGDDC    +D R    K + S R EMG  SI S P   + +STG +D +LR+WDLR   + +    + GG+WRHKW P+    VL+A MHAGF+V   D Q +        D  L   +Q   S  LAYG DW      I  D   H+  L+   SFYD+
Sbjct:   83 HADCVEFSPCGEQALVGYYQLDETAKKRSGQIAKFQVVGNQAEKVC-LLDTAGILDLSWMGSDFCLAAASSGELYTIISPKSQPLVISDVFAISE-SILLSSDCHGNMVVTSDECGIVYLVDPCKKKILDYWKGHDFEAWCVRLNRNDANLILSGGDDCMARVWDRRLGFAKPVISKRHEMGVCSISSVPGYCHFISTGCFDEKLRMWDLRGGGEILICHTSGGGVWRHKWSPSATK-VLMASMHAGFAVASIDGQENIIENTTGFDTSLTYYRQ---SAKLAYGVDW-----RIDADGKEHFKALIATCSFYDN 386          
BLAST of Diphthine methyltransferase vs. Ensembl Cavefish
Match: dph7 (diphthamide biosynthesis 7 [Source:NCBI gene;Acc:103040961])

HSP 1 Score: 117.472 bits (293), Expect = 4.976e-29
Identity = 87/288 (30.21%), Postives = 141/288 (48.96%), Query Frame = 2
Query:  170 LDESSRSRNGSVLLIKFDNKSARVVGGLSDID-----GILDCCWV-----SSNQFILASSLGTLYFCS----HEPTSIKIEQKVSITEKSLCLSVDCHSDK-------IICSNSLGEIAILN---SKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC--VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVV-CTDRQASDD-----CLIRMQQTGSSDSLAYGAD 937
            ++ ++ SR G + L KF ++ +     L++I       ILD  W            +A++ G +   S     + + ++      +    L LS+D  + +       ++ S+S G +++L+   ++  V+ Q   H FE W+   S  +  L YSGGDDCK  G+DLR         S R  MG  SI S+P   ++++TGSYD  + +WD R ++QP+      GG+WR KW PT   L+L A MH  + ++ C  +QA D+     C I +      +SLAYGAD
Sbjct:   50 VESTTPSRTGRLYLFKFQSQGS-FTPPLTEIQQIDTPAILDLKWCHIPVCERPMLGMATARGEIQLHSLVDAQQSSCLEHVSSTELGPDRLALSLDWSTGRGESSDARVVSSDSTGSLSVLSLGEARLNVVSQWKAHDFEAWISAFSYWDTQLLYSGGDDCKLKGWDLRMGPSTPTFTSKRHSMGVCSIHSNPHREHVLATGSYDENVLLWDGRNMRQPLSETAVGGGVWRLKWHPTQEHLLLAACMHNDYHILHC--KQAMDEGNEGPCPI-LASYILHNSLAYGAD 333          
BLAST of Diphthine methyltransferase vs. Ensembl Yeast
Match: RRT2 (Methylesterase performing penultimate step of diphthamide biosynthesis; hydrolyzes methylated diphthine to produce diphthine and allows Dph6-catalyzed amidation reaction to occur; deletion leads to resistance to sordarin and accumulation of methylatediphthine; WD40 domain-containing protein; involved in endosomal recycling; forms complex with Rtt10p that functions in retromer-mediated pathway for recycling internalized cell-surface proteins [Source:SGD;Acc:S000000450])

HSP 1 Score: 61.2326 bits (147), Expect = 5.711e-11
Identity = 53/197 (26.90%), Postives = 82/197 (41.62%), Query Frame = 2
Query:  506 HRFECWVGHLSRHE--ENLFYSGGDDCKFNGFDLRCVDKKLFSNRL-EMGCTSIQ-SHPTDAN----LVSTGSYDGQLRIWDLRQLKQPI-----------RTFETDGGIWRHKWCP--------TGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDH 1015
            H  ECW       +  +++ ++GGDD +    DLR  +    +NR+ + G  SI+ S P   N     + TGSYD  +R  DLR + + I              +  GG+WR    P         G+  +LV  M+ G  VV  +  + +   I+       DS+ YG DW             + L+   SFYD+
Sbjct:  196 HELECWTAEFGSLQPFQDVVFTGGDDSRIMAHDLRSKEFIWSNNRIHDAGVVSIKCSQPNFRNNKPTSIITGSYDDNIRSLDLRMMGESIFPGANVPTVNKLACDLGGGVWRFVESPIDQEQSHHNGSDRLLVCCMYNGAKVVTMNDNSDEYFQIQHYLKKGHDSMCYGGDW------------SNSLIATCSFYDN 380          
BLAST of Diphthine methyltransferase vs. Ensembl Nematostella
Match: EDO48279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK3])

HSP 1 Score: 114.775 bits (286), Expect = 1.039e-29
Identity = 63/190 (33.16%), Postives = 99/190 (52.11%), Query Frame = 2
Query:  401 CLSVDCHSDKIICSNSLGEIAILNSKR-----EVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLR--CVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDS---LAYGADW 940
            C  + C +   + S+S GE+ +L   +       + Q   H +E W+    R   N+ YSGGDDC   G+D R  C +    S R EMG +SIQ +P   ++++TGSYD ++ +WD R  + P+ +    GG+WR KW P     +L A M++G+ ++        +C   +++T S      LAYGADW
Sbjct:   92 CPFMCCSTLTCVVSDSKGELTLLQCSKGSWETRQISQWAAHGYEAWIAAFDRWSHNVVYSGGDDCLLRGWDTRTNCTNPIFTSKRHEMGVSSIQCNPVHEHIMATGSYDEKILVWDTRNRRTPLTSASPGGGVWRIKWHPVTGNHMLTASMYSGYHIL-----KFINCQGNLKKTTSYTENAVLAYGADW 276          
BLAST of Diphthine methyltransferase vs. Ensembl Medaka
Match: dph7 (diphthamide biosynthesis 7 [Source:NCBI gene;Acc:101168963])

HSP 1 Score: 117.472 bits (293), Expect = 4.201e-29
Identity = 104/333 (31.23%), Postives = 149/333 (44.74%), Query Frame = 2
Query:   77 WKEITH----IDTLQYSDSSEISP-----DKIFCINCCYQLD------ESSRSRNGSVLLIKFDNKSARVVGGLS-----DIDGILDCCW----VSSNQFI-LASSLGTL--YFCSHEPTSIKIEQKVSITE---KSLCLSVDCHSDK-------IICSNSLGEIAILNSKREVLF---QEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRC--VDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVV-CTDRQASDD--CLIRMQQTGSSDSLAYGADW 940
            WK  T      DT   +DS E  P     D + C    YQL       ++  SR G + L +F N    +   L+     D   +LD  W    VS    + +A++ G L  Y     P   +  Q +S TE   + L LS+D  + +       + CS+S G + + +     L    Q   H FE W+   S  +  L +SGGDDCK  G+DLR         S R  MG  S+ S     ++V+TGSYD  + +WD R +++P+      GG+WR KW PT   L+L A MH  F ++ C      D+  C +        +SLAYGADW
Sbjct:    3 WKSRTRSLQVFDTQLSADSVEWCPVAQSHDVLVC--GTYQLQKGEGEGDAPPSRTGRLYLFEF-NGGGSIGPPLTELQRMDTAAVLDLKWCHVPVSGRPVLGMAAATGQLQLYALWESPVGQRSLQPLSSTEVGAERLLLSLDWSTGRMDGNDLRVACSDSAGCVGVFSFAEGALTPLSQWKAHDFEAWITAFSYWDTQLIFSGGDDCKLKGWDLRAGPSSPAFTSKRHSMGVCSVHSSAHREHVVATGSYDEHVLLWDSRNMRRPLSDTPMGGGVWRLKWHPTHEHLLLAACMHNDFHILHCKQAFEGDEGACPVVASYI-LHNSLAYGADW 331          
BLAST of Diphthine methyltransferase vs. Planmine SMEST
Match: SMESG000060795.1 (SMESG000060795.1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 324/325 (99.69%), Postives = 324/325 (99.69%), Query Frame = 2
Query:   68 MSLWKEITHIDTLQYSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIKFDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPTSIKIEQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDHRWSLSELFL 1042
            MSLWKEITHIDTLQYSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIKFDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPTSIKIEQKVSITE SLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDHRWSLSELFL
Sbjct:    1 MSLWKEITHIDTLQYSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIKFDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPTSIKIEQKVSITENSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAGDRCHHYLVTASSFYDHRWSLSELFL 325          
BLAST of Diphthine methyltransferase vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.692e-8
Identity = 49/196 (25.00%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  416 CHSDKIICSNSLGEIA---ILNSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVD--------KKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMH----------AGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            C  D+ IC+  + + A    LN  R +   +      CW       E N+F S GDD +   +D R  +        +++ ++  +  C S   HP  + L+ TG  DG + +WD R+L   +  F+T+  ++R  W P    L L AG+            G  V+  D +      + M  +G +D++    DW
Sbjct:  168 CSFDQTICAFDISQSAGGSTLNPARTITGHQDKVEDVCW----HPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSW--HPVTSCLLLTGGADGLVHLWDQRKLVSALHVFDTEASVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVT-DIDW 356          
BLAST of Diphthine methyltransferase vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.766e-8
Identity = 49/196 (25.00%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  416 CHSDKIICSNSLGEIA---ILNSKREVLFQEIVHRFECWVGHLSRHEENLFYSGGDDCKFNGFDLRCVD--------KKLFSNRLEMGCTSIQSHPTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLVLVAGMH----------AGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADW 940
            C  D+ IC+  + + A    LN  R +   +      CW       E N+F S GDD +   +D R  +        +++ ++  +  C S   HP  + L+ TG  DG + +WD R+L   +  F+T+  ++R  W P    L L AG+            G  V+  D +      + M  +G +D++    DW
Sbjct:  167 CSFDQTICAFDISQSAGGSTLNPARTITGHQDKVEDVCW----HPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSW--HPVTSCLLLTGGADGLVHLWDQRKLVSALHVFDTEASVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVT-DIDW 355          
The following BLAST results are available for this feature:
BLAST of Diphthine methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DPH74.364e-3132.86diphthamide biosynthesis 7 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y43F4B.91.176e-822.97pep chromosome:WBcel235:III:13315088:13318597:1 ge... [more]
Y43F4B.91.176e-822.97pep chromosome:WBcel235:III:13315125:13318597:1 ge... [more]
Y43F4B.91.176e-822.97pep chromosome:WBcel235:III:13315123:13318597:1 ge... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG31842.165e-2830.29gene:FBgn0029892 transcript:FBtr0070989[more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dph76.255e-2735.33diphthamide biosynthesis 7 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh2d4a6.352e-1747.06SH2 domain containing 4A [Source:Xenbase;Acc:XB-GE... [more]
rnf1575.701e-625.18ring finger protein 157 [Source:Xenbase;Acc:XB-GEN... [more]
rnf1576.136e-632.84ring finger protein 157 [Source:Xenbase;Acc:XB-GEN... [more]
rnf1577.944e-625.76ring finger protein 157 [Source:Xenbase;Acc:XB-GEN... [more]
rnf1578.693e-632.84ring finger protein 157 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dph77.286e-3129.64diphthamine biosynethesis 7 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Diphthine methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q55C80|DPH7_DICDI6.898e-3736.76Diphthine methyltransferase homolog OS=Dictyosteli... [more]
sp|Q9BTV6|DPH7_HUMAN2.096e-3032.86Diphthine methyltransferase OS=Homo sapiens OX=960... [more]
sp|Q9CYU6|DPH7_MOUSE5.097e-3029.64Diphthine methyltransferase OS=Mus musculus OX=100... [more]
sp|O74865|DPH7_SCHPO3.269e-1828.94Diphthine methyltransferase OS=Schizosaccharomyces... [more]
sp|P38332|DPH7_YEAST3.966e-926.90Diphthine methyltransferase OS=Saccharomyces cerev... [more]
back to top
BLAST of Diphthine methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y0H31.298e-4335.76WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A0R3WB594.314e-4335.38WD_REPEATS_REGION domain-containing protein OS=Tae... [more]
A0A0R3TTI24.618e-4333.66WD_REPEATS_REGION domain-containing protein OS=Rod... [more]
A0A068WIS62.083e-4235.74WD40 repeat containing protein OS=Echinococcus gra... [more]
A0A5K3FTQ21.471e-4135.87Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dph74.976e-2930.21diphthamide biosynthesis 7 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RRT25.711e-1126.90Methylesterase performing penultimate step of diph... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO482791.039e-2933.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diphthine methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dph74.201e-2931.23diphthamide biosynthesis 7 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diphthine methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000060795.10.000e+099.69SMESG000060795.1[more]
SMESG000037114.11.692e-825.00SMESG000037114.1[more]
SMESG000037114.11.766e-825.00SMESG000037114.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017368 ID=SMED30017368|Name=Diphthine methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1072bp
ATTTGTTTAAATATTCACTTTACAAACTCTTTTATTCAACTTATGTTATA
AACCAAATTTTTATTAAATGTCTCTCTGGAAAGAAATAACACATATAGAC
ACTCTCCAATATTCAGATAGCTCTGAAATATCTCCAGATAAAATTTTTTG
CATAAATTGTTGTTATCAACTTGATGAATCAAGTAGAAGTAGAAATGGAT
CTGTGTTATTGATAAAATTCGATAACAAATCAGCGCGTGTTGTAGGGGGT
CTTTCAGACATTGATGGGATATTAGATTGCTGTTGGGTTTCGTCAAACCA
ATTTATTTTAGCTAGTTCTCTAGGAACATTATATTTTTGTTCTCATGAAC
CCACATCTATTAAAATCGAGCAAAAAGTTTCCATTACTGAAAAAAGTTTA
TGTTTGTCAGTTGATTGTCATTCAGACAAAATTATTTGCAGTAATTCATT
GGGAGAAATAGCCATACTCAATTCAAAACGTGAGGTGTTGTTTCAGGAAA
TTGTTCACAGATTCGAATGCTGGGTTGGTCATTTATCTCGCCACGAGGAG
AATTTGTTTTATTCCGGTGGAGACGATTGCAAATTTAACGGATTCGATTT
GAGATGTGTCGATAAAAAACTGTTTTCGAATAGGTTAGAAATGGGCTGCA
CAAGCATCCAGTCTCATCCAACAGATGCTAATCTCGTATCGACTGGCAGT
TATGACGGTCAATTGCGGATCTGGGATTTGAGGCAGTTGAAACAGCCAAT
TAGAACGTTTGAAACGGATGGAGGCATTTGGCGCCACAAATGGTGTCCGA
CCGGCAATCCGCTGGTGCTAGTAGCAGGAATGCATGCGGGATTCTCTGTT
GTGTGCACAGATCGGCAGGCGTCAGATGATTGCTTGATTCGGATGCAGCA
AACGGGTAGCAGCGATTCATTGGCCTATGGCGCTGATTGGCTGGCAGCTG
ATGCTATGATTGCGGGCGATCGTTGCCACCATTATCTAGTCACTGCCAGC
TCGTTCTATGACCACCGATGGAGCCTTTCTGAGCTCTTTCTGTGATTTTT
ACAAAATATAATCGACAGATCG
back to top

protein sequence of SMED30017368-orf-1

>SMED30017368-orf-1 ID=SMED30017368-orf-1|Name=SMED30017368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MSLWKEITHIDTLQYSDSSEISPDKIFCINCCYQLDESSRSRNGSVLLIK
FDNKSARVVGGLSDIDGILDCCWVSSNQFILASSLGTLYFCSHEPTSIKI
EQKVSITEKSLCLSVDCHSDKIICSNSLGEIAILNSKREVLFQEIVHRFE
CWVGHLSRHEENLFYSGGDDCKFNGFDLRCVDKKLFSNRLEMGCTSIQSH
PTDANLVSTGSYDGQLRIWDLRQLKQPIRTFETDGGIWRHKWCPTGNPLV
LVAGMHAGFSVVCTDRQASDDCLIRMQQTGSSDSLAYGADWLAADAMIAG
DRCHHYLVTASSFYDHRWSLSELFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0005515protein binding
GO:0003674molecular_function
GO:0016787hydrolase activity
GO:0061685diphthine methylesterase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0008150biological_process
GO:0017183peptidyl-diphthamide biosynthetic process from peptidyl-histidine
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR001680WD40_repeat
IPR017986WD40_repeat_dom
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 16..291
e-value: 8.5E-25
score: 89.9
NoneNo IPR availablePANTHERPTHR46042FAMILY NOT NAMEDcoord: 5..321
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 207..221
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 203..222
score: 9.539
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 64..263