Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30017367
Length (bp)1731
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase (SMED30017367) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30017367) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30017367) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30017367) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017367

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30017367h1SMcG0011819 dd_Smed_v4_6039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017367h1SMcG0011819 dd_Smed_v4_6039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017367h1SMcG0011819 dd_Smed_v4_6039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: CSK (C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC:2444])

HSP 1 Score: 361.688 bits (927), Expect = 3.382e-119
Identity = 192/474 (40.51%), Postives = 268/474 (56.54%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RP+F ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: CSK (C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC:2444])

HSP 1 Score: 361.688 bits (927), Expect = 3.382e-119
Identity = 192/474 (40.51%), Postives = 268/474 (56.54%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RP+F ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: CSK (C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC:2444])

HSP 1 Score: 361.688 bits (927), Expect = 3.382e-119
Identity = 192/474 (40.51%), Postives = 268/474 (56.54%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RP+F ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: MATK (megakaryocyte-associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6906])

HSP 1 Score: 318.546 bits (815), Expect = 3.049e-102
Identity = 174/472 (36.86%), Postives = 261/472 (55.30%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQ-GLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLT--KCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            K  +L F KG+ + +L+   + +W    ++   Q GL+    ++   +L+ +      PW+HGK+S   A ++L P E+G FL+R S + PGDY +CV F  DV  Y V++ +   T+DE  +F ++ +++EHY KD   +C  L   K     KS  + L      +  + + LG +IG GEF  VLQGEY    VAVK +K  +       F  E ++M K+ H +LV   G+   ++ +YI+ E++  G+LVN+LR+RGR ++ T   ++F++    GM YLE   LVHRDLAARNIL++  LVAKVSDFGLA+ +                                            +D +     R+PVKWTAPEAL H K+T+KSDVWSFG+LLWE+FS+GR PYP++    V + +  GYRME PE  P  ++ LM  CW  EP +RP F ++ + L ++++S
Sbjct:   22 KPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVT---AQAFLDETAVMTKMQHENLVRLLGVIL-HQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAE-----------------------------------------RKGLDSS-----RLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRS 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: MATK (megakaryocyte-associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6906])

HSP 1 Score: 318.161 bits (814), Expect = 1.239e-101
Identity = 174/472 (36.86%), Postives = 261/472 (55.30%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQ-GLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLT--KCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            K  +L F KG+ + +L+   + +W    ++   Q GL+    ++   +L+ +      PW+HGK+S   A ++L P E+G FL+R S + PGDY +CV F  DV  Y V++ +   T+DE  +F ++ +++EHY KD   +C  L   K     KS  + L      +  + + LG +IG GEF  VLQGEY    VAVK +K  +       F  E ++M K+ H +LV   G+   ++ +YI+ E++  G+LVN+LR+RGR ++ T   ++F++    GM YLE   LVHRDLAARNIL++  LVAKVSDFGLA+ +                                            +D +     R+PVKWTAPEAL H K+T+KSDVWSFG+LLWE+FS+GR PYP++    V + +  GYRME PE  P  ++ LM  CW  EP +RP F ++ + L ++++S
Sbjct:   63 KPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVT---AQAFLDETAVMTKMQHENLVRLLGVIL-HQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAE-----------------------------------------RKGLDSS-----RLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRS 484          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 318.931 bits (816), Expect = 6.083e-102
Identity = 182/512 (35.55%), Postives = 265/512 (51.76%), Query Frame = 1
Query:   94 EGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHV--------------------KLSPSLNI--------------EDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKG-YTLDEDSWFASMPELIEHYQKDADGLCCTLTK---CYESP-----------------KSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
             G  A D  F K + +++L   +DP W    N  Q +GLV  + V                     ++P                    PW+H  +SR   E+ L    +GTFL+R S  FPGD+T+C+ F+  V+ Y +  ++ G  T D++ +F+++ +L+ HY++DADGLC  L     C  +                  + R        L I   +I +G  IG GEF +V  G Y++  VA+K  K+  N    +L   E   M  L+HP+LVT  G+   + +VY+ITEYM NG+L++ LRSRGR  ++    + FA+D C GMCYLE   +VHRDLAARN+LL+  LVAKVSDFGLA+                                            ++   + ++ G+ P+KWTAPEAL H+++T KSDVWSFGILLWEIFSFGR PYPRI   +V +++  GYRME+PE  P +I+++M + WAL  + RP+F ++
Sbjct:   61 HGMPARDNVFRKDDHVRILGNTTDPAWYRARNANQEEGLVHADCVVRINGQAYDNGIVRMRASGCDVAPGAASTTSSTSSHHSTAANHQPWFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLD-EAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAK-------------------------------------------KANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQV 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 318.931 bits (816), Expect = 6.083e-102
Identity = 182/512 (35.55%), Postives = 265/512 (51.76%), Query Frame = 1
Query:   94 EGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHV--------------------KLSPSLNI--------------EDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKG-YTLDEDSWFASMPELIEHYQKDADGLCCTLTK---CYESP-----------------KSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
             G  A D  F K + +++L   +DP W    N  Q +GLV  + V                     ++P                    PW+H  +SR   E+ L    +GTFL+R S  FPGD+T+C+ F+  V+ Y +  ++ G  T D++ +F+++ +L+ HY++DADGLC  L     C  +                  + R        L I   +I +G  IG GEF +V  G Y++  VA+K  K+  N    +L   E   M  L+HP+LVT  G+   + +VY+ITEYM NG+L++ LRSRGR  ++    + FA+D C GMCYLE   +VHRDLAARN+LL+  LVAKVSDFGLA+                                            ++   + ++ G+ P+KWTAPEAL H+++T KSDVWSFGILLWEIFSFGR PYPRI   +V +++  GYRME+PE  P +I+++M + WAL  + RP+F ++
Sbjct:   61 HGMPARDNVFRKDDHVRILGNTTDPAWYRARNANQEEGLVHADCVVRINGQAYDNGIVRMRASGCDVAPGAASTTSSTSSHHSTAANHQPWFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLD-EAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAK-------------------------------------------KANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQV 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 318.931 bits (816), Expect = 5.977e-101
Identity = 182/511 (35.62%), Postives = 265/511 (51.86%), Query Frame = 1
Query:   97 GQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHV--------------------KLSPSLNI--------------EDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGY-TLDEDSWFASMPELIEHYQKDADGLCCTLTK---CYESP-----------------KSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            G  A D  F K + +++L   +DP W    N  Q +GLV  + V                     ++P                    PW+H  +SR   E+ L    +GTFL+R S  FPGD+T+C+ F+  V+ Y +  ++ G  T D++ +F+++ +L+ HY++DADGLC  L     C  +                  + R        L I   +I +G  IG GEF +V  G Y++  VA+K  K+  N    +L   E   M  L+HP+LVT  G+   + +VY+ITEYM NG+L++ LRSRGR  ++    + FA+D C GMCYLE   +VHRDLAARN+LL+  LVAKVSDFGLA+                                            ++   + ++ G+ P+KWTAPEAL H+++T KSDVWSFGILLWEIFSFGR PYPRI   +V +++  GYRME+PE  P +I+++M + WAL  + RP+F ++
Sbjct:  147 GMPARDNVFRKDDHVRILGNTTDPAWYRARNANQEEGLVHADCVVRINGQAYDNGIVRMRASGCDVAPGAASTTSSTSSHHSTAANHQPWFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLD-EAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAK-------------------------------------------KANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQV 613          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 318.931 bits (816), Expect = 5.977e-101
Identity = 182/511 (35.62%), Postives = 265/511 (51.86%), Query Frame = 1
Query:   97 GQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHV--------------------KLSPSLNI--------------EDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGY-TLDEDSWFASMPELIEHYQKDADGLCCTLTK---CYESP-----------------KSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            G  A D  F K + +++L   +DP W    N  Q +GLV  + V                     ++P                    PW+H  +SR   E+ L    +GTFL+R S  FPGD+T+C+ F+  V+ Y +  ++ G  T D++ +F+++ +L+ HY++DADGLC  L     C  +                  + R        L I   +I +G  IG GEF +V  G Y++  VA+K  K+  N    +L   E   M  L+HP+LVT  G+   + +VY+ITEYM NG+L++ LRSRGR  ++    + FA+D C GMCYLE   +VHRDLAARN+LL+  LVAKVSDFGLA+                                            ++   + ++ G+ P+KWTAPEAL H+++T KSDVWSFGILLWEIFSFGR PYPRI   +V +++  GYRME+PE  P +I+++M + WAL  + RP+F ++
Sbjct:  147 GMPARDNVFRKDDHVRILGNTTDPAWYRARNANQEEGLVHADCVVRINGQAYDNGIVRMRASGCDVAPGAASTTSSTSSHHSTAANHQPWFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLD-EAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAK-------------------------------------------KANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQV 613          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 265.388 bits (677), Expect = 1.036e-81
Identity = 164/468 (35.04%), Postives = 244/468 (52.14%), Query Frame = 1
Query:   73 LTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPC--ENGTFLIRSSDKFPGDYTICVKFND-VQFYHV-IYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTL-TKCY--ESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTV-VAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTF 1452
              AL+ ++ +  +DL F K + L++L       W          G +P N+V    S+  + PWY GK+ R  AE+ L+    E+G FL+R S+    D ++ V+ ND V+ Y +    + GY +     FA++ +LI HYQ++ADGLC  L   C   E+P++     D+    +    ++L  +IG G+F EV +G +   V VAVK LK     A+ T F  E  +M KL HP L++   + + +E + I+TE M+  +L+ +L+ RGR   +    ++ +    +GM YLEE   +HRDLAARNIL+N  L  K++DFGLAR+                             LM               +    +  R P+KWTAPEA  +N++T KSDVWSFGILL EI +FGR PYP +    V Q +  GYRM  P   P  +Y++M+ CW  +P+KRPTF
Sbjct:   62 FVALFQYDARTDDDLSFKKDDILEILNDTQGDWWFARHKATGRTGYIPSNYVAREKSIESQ-PWYFGKMRRIDAEKCLLHTLNEHGAFLVRDSESRQHDLSLSVRENDSVKHYRIRQLDHGGYFIARRRPFATLHDLIAHYQREADGLCVNLGAPCAKSEAPQTTTFTYDDQ-WEVDRRSVRLIRQIGAGQFGEVWEGRWNVNVPVAVKKLKA--GTADPTDFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELMQE-NLLTFLQRRGRQC-QMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARI-----------------------------LM------------KENEYEARTGARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTF 482          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300549)

HSP 1 Score: 328.561 bits (841), Expect = 1.794e-103
Identity = 188/438 (42.92%), Postives = 251/438 (57.31%), Query Frame = 1
Query:  217 VNHVKLSPS--------------LNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPK--------SRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            +NH  LSP+              LN   PW+HG ++R  AE  L P E+G FL+R S  FPGDYT+CV F   V+ Y V Y     T+D++ +F ++ +L+ HY+ DADGLC  L KC   PK        +  D++D+  + I   E++L   IG GEF +V+ G  ++  VAVK LK   +      F  E S+M  L H +LV F G+  +++ +Y++TEYM  GSLV+YLRSRGR  I   DQI FA D+ SGM YLE   +VHRDLAARN+L++   VAKVSDFGLAR +                               N+  D+  LP               +KWTAPEAL + +++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GY+ME+PE  P +IYE+MR  W L P KRPTF E+
Sbjct:  327 MNHASLSPTALAPQQGRSRCEVKLNAM-PWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCL--PKLGKQEFCINSKDFVDKGWV-IPEAELQLRESIGKGEFGDVMLGILRNEKVAVKMLK---DEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAREE-----------------------------CYNL--DVGKLP---------------IKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 711          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300547)

HSP 1 Score: 328.561 bits (841), Expect = 1.794e-103
Identity = 188/438 (42.92%), Postives = 251/438 (57.31%), Query Frame = 1
Query:  217 VNHVKLSPS--------------LNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPK--------SRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            +NH  LSP+              LN   PW+HG ++R  AE  L P E+G FL+R S  FPGDYT+CV F   V+ Y V Y     T+D++ +F ++ +L+ HY+ DADGLC  L KC   PK        +  D++D+  + I   E++L   IG GEF +V+ G  ++  VAVK LK   +      F  E S+M  L H +LV F G+  +++ +Y++TEYM  GSLV+YLRSRGR  I   DQI FA D+ SGM YLE   +VHRDLAARN+L++   VAKVSDFGLAR +                               N+  D+  LP               +KWTAPEAL + +++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GY+ME+PE  P +IYE+MR  W L P KRPTF E+
Sbjct:  327 MNHASLSPTALAPQQGRSRCEVKLNAM-PWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCL--PKLGKQEFCINSKDFVDKGWV-IPEAELQLRESIGKGEFGDVMLGILRNEKVAVKMLK---DEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAREE-----------------------------CYNL--DVGKLP---------------IKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 711          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300548)

HSP 1 Score: 328.561 bits (841), Expect = 1.794e-103
Identity = 188/438 (42.92%), Postives = 251/438 (57.31%), Query Frame = 1
Query:  217 VNHVKLSPS--------------LNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPK--------SRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            +NH  LSP+              LN   PW+HG ++R  AE  L P E+G FL+R S  FPGDYT+CV F   V+ Y V Y     T+D++ +F ++ +L+ HY+ DADGLC  L KC   PK        +  D++D+  + I   E++L   IG GEF +V+ G  ++  VAVK LK   +      F  E S+M  L H +LV F G+  +++ +Y++TEYM  GSLV+YLRSRGR  I   DQI FA D+ SGM YLE   +VHRDLAARN+L++   VAKVSDFGLAR +                               N+  D+  LP               +KWTAPEAL + +++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GY+ME+PE  P +IYE+MR  W L P KRPTF E+
Sbjct:  327 MNHASLSPTALAPQQGRSRCEVKLNAM-PWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCL--PKLGKQEFCINSKDFVDKGWV-IPEAELQLRESIGKGEFGDVMLGILRNEKVAVKMLK---DEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAREE-----------------------------CYNL--DVGKLP---------------IKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 711          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0299728)

HSP 1 Score: 328.561 bits (841), Expect = 1.794e-103
Identity = 188/438 (42.92%), Postives = 251/438 (57.31%), Query Frame = 1
Query:  217 VNHVKLSPS--------------LNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPK--------SRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            +NH  LSP+              LN   PW+HG ++R  AE  L P E+G FL+R S  FPGDYT+CV F   V+ Y V Y     T+D++ +F ++ +L+ HY+ DADGLC  L KC   PK        +  D++D+  + I   E++L   IG GEF +V+ G  ++  VAVK LK   +      F  E S+M  L H +LV F G+  +++ +Y++TEYM  GSLV+YLRSRGR  I   DQI FA D+ SGM YLE   +VHRDLAARN+L++   VAKVSDFGLAR +                               N+  D+  LP               +KWTAPEAL + +++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GY+ME+PE  P +IYE+MR  W L P KRPTF E+
Sbjct:  327 MNHASLSPTALAPQQGRSRCEVKLNAM-PWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCL--PKLGKQEFCINSKDFVDKGWV-IPEAELQLRESIGKGEFGDVMLGILRNEKVAVKMLK---DEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAREE-----------------------------CYNL--DVGKLP---------------IKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 711          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300546)

HSP 1 Score: 329.331 bits (843), Expect = 6.549e-103
Identity = 188/438 (42.92%), Postives = 251/438 (57.31%), Query Frame = 1
Query:  217 VNHVKLSPS--------------LNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPK--------SRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            +NH  LSP+              LN   PW+HG ++R  AE  L P E+G FL+R S  FPGDYT+CV F   V+ Y V Y     T+D++ +F ++ +L+ HY+ DADGLC  L KC   PK        +  D++D+  + I   E++L   IG GEF +V+ G  ++  VAVK LK   +      F  E S+M  L H +LV F G+  +++ +Y++TEYM  GSLV+YLRSRGR  I   DQI FA D+ SGM YLE   +VHRDLAARN+L++   VAKVSDFGLAR +                               N+  D+  LP               +KWTAPEAL + +++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GY+ME+PE  P +IYE+MR  W L P KRPTF E+
Sbjct:  409 MNHASLSPTALAPQQGRSRCEVKLNAM-PWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKYLENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCL--PKLGKQEFCINSKDFVDKGWV-IPEAELQLRESIGKGEFGDVMLGILRNEKVAVKMLK---DEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAREE-----------------------------CYNL--DVGKLP---------------IKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL 793          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: csk (C-terminal Src kinase [Source:ZFIN;Acc:ZDB-GENE-061103-493])

HSP 1 Score: 358.221 bits (918), Expect = 5.078e-118
Identity = 193/480 (40.21%), Postives = 267/480 (55.62%), Query Frame = 1
Query:   64 GDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            G    A YNF G   +DLP  KG+ L ++ +  DPNW    N+   +G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y +IY N   ++DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   + A    F  E S+M +L H +LV   G I     S+YI+TEYM  GSLV+YLRSRGRTVI  +  I F++D C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS  D      ++PVKWT+PEAL   K++ KSDVWS+GILLWEI+SFGR PYPRI    V   +  GY+M+SP+  P  +Y++M+ CW L+   RP+F ++ + L 
Sbjct:   11 GTECVARYNFPGTADQDLPMCKGDVLTIVGVTKDPNWYRAKNSAGREGTIPANYVQKREGVKSASKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIIYHNGKLSIDEEEYFENLMQLMEHYTKDADGLCTRLIKPKIMEGTVAAQDEFSRSGWALNRKELKLIQTIGKGEFGDVMVGDYRGKKVAVKCIK---HDATAQAFVAEASVMTQLRHNNLVQLLGVIVEEKGSLYIVTEYMAKGSLVDYLRSRGRTVIGGDRLINFSMDVCKAMEYLEANNFVHRDLAARNVLVSEDNIAKVSDFGLTK------------------------------------------EASSTQDT----AKLPVKWTSPEALREKKFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDSPDGCPPVVYDIMKQCWTLDAVVRPSFRDLREKLQ 441          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070705-183])

HSP 1 Score: 297.745 bits (761), Expect = 9.480e-95
Identity = 169/470 (35.96%), Postives = 259/470 (55.11%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQF-YHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMK 1488
            K  ++ + KG+   +L ++    +    N    +G V  ++++   +L I+      PW+HGK++   A ++L P E+G FL+R S + PGD+ +CV F+   F Y VIY +   T+D   +F ++ ++IE Y ++   +   L K    E  KS    L ++   +   ++ LG  IG GEF  V  GEY    VAVK +K  +       F  E S+M  L+H +LV   G+   N  ++I+TE M  G+LVN+LRSRGR  +     ++FA+D C GM +LE   L+HRDLA RNIL++   VAK+SDFGLARV                                          + +VD++     ++PVKWTAPEAL + K++ +SDVWS+G+LLWEIFS+GR PYP++  N VK+ +  GYRM+ P++ P D+Y +M  CW  EP+KRP+F ++ + L K++K
Sbjct:   25 KDGEISYHKGD---ILTLVGKGEYTARHNTTGEEGQVSGSNLREREALRIDPKLSLMPWFHGKIAGQQAVDKLKPTEDGLFLVRESVRHPGDFVLCVCFSQKVFHYRVIYQDNKLTIDNMQFFDNLIDMIEFYSRNRGAIATLLLKPKKKEGLKSAETKLLKSGWLLDLSKLTLGEIIGEGEFGAVFAGEYTGQRVAVKIIKCDVT---AQAFLEETSVMTNLHHKNLVPLLGVILHN-GLHIVTELMTKGNLVNFLRSRGRFAVSVIQLLRFALDVCEGMEHLESKKLLHRDLAGRNILVSEDGVAKISDFGLARVG-----------------------------------------SMAVDNS-----KLPVKWTAPEALKNKKFSTQSDVWSYGVLLWEIFSYGRQPYPKMTVNEVKECVEKGYRMDPPDECPADVYSIMTSCWQTEPKKRPSFHKLRERLEKELK 441          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070705-183])

HSP 1 Score: 295.819 bits (756), Expect = 4.701e-94
Identity = 168/459 (36.60%), Postives = 253/459 (55.12%), Query Frame = 1
Query:  121 FSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQF-YHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMK 1488
              KGE         +   ++ SN ++ + L      ++ P L++  PW+HGK++   A ++L P E+G FL+R S + PGD+ +CV F+   F Y VIY +   T+D   +F ++ ++IE Y ++   +   L K    E  KS    L ++   +   ++ LG  IG GEF  V  GEY    VAVK +K  +       F  E S+M  L+H +LV   G+   N  ++I+TE M  G+LVN+LRSRGR  +     ++FA+D C GM +LE   L+HRDLA RNIL++   VAK+SDFGLARV                                          + +VD++     ++PVKWTAPEAL + K++ +SDVWS+G+LLWEIFS+GR PYP++  N VK+ +  GYRM+ P++ P D+Y +M  CW  EP+KRP+F ++ + L K++K
Sbjct:   37 MRKGEYTARHNTTGEEGQVSGSNLREREAL------RIDPKLSLM-PWFHGKIAGQQAVDKLKPTEDGLFLVRESVRHPGDFVLCVCFSQKVFHYRVIYQDNKLTIDNMQFFDNLIDMIEFYSRNRGAIATLLLKPKKKEGLKSAETKLLKSGWLLDLSKLTLGEIIGEGEFGAVFAGEYTGQRVAVKIIKCDVT---AQAFLEETSVMTNLHHKNLVPLLGVILHN-GLHIVTELMTKGNLVNFLRSRGRFAVSVIQLLRFALDVCEGMEHLESKKLLHRDLAGRNILVSEDGVAKISDFGLARVG-----------------------------------------SMAVDNS-----KLPVKWTAPEALKNKKFSTQSDVWSYGVLLWEIFSYGRQPYPKMTVNEVKECVEKGYRMDPPDECPADVYSIMTSCWQTEPKKRPSFHKLRERLEKELK 438          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: lyn (LYN proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040912-7])

HSP 1 Score: 282.337 bits (721), Expect = 5.305e-88
Identity = 166/480 (34.58%), Postives = 254/480 (52.92%), Query Frame = 1
Query:   70 FLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRSSDKFPGDYTICVKFNDVQFYHVI-------YSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQD-TVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSV--GRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
             + ALY +E   A+DL F KGEKLK+++   +  W   S   + +G +P N+V  + ++  E+ W++  ++R  AE +L+   N  G++LIR S+   G Y++ ++  D Q   V+         N GY +     F+ +  +I+HY K +DGLC  L K  E PK++  + D++   I  + IK+  K+G G+F EV    Y + T VAVK LK      E   F  E +LM  L H  LV    + +  E +YIITEYM NGSL+++L+S+  + I+    I F+     GM Y+E+   +HRDL A N+L++  L+ K++DFGLARV +                                            DD  T+    + P+KWTAPEA+ +  +T KSD+WSFG+LL+EI ++G+ PYP +  + V   +  GYRM  PE+ P ++YE+M  CW  +PE RPTF  I  +L
Sbjct:   65 IVVALYPYEAIHADDLGFKKGEKLKIIEEHGE-WWKARSLTTRKEGFIPSNYVAEADTMETEE-WFYKDITRKDAERQLLAPANKPGSYLIRESETSKGSYSLSIRDVDAQGQDVVKHYKIRSLDNGGYYISPKITFSDISSMIKHYHKQSDGLCRKLDKACEKPKAQKPW-DKDAWEISKDSIKMVKKLGAGQFGEVWMAFYNNSTKVAVKTLKPGTMSVE--AFLEEANLMKTLQHDRLVRLYAVVTKTEPIYIITEYMANGSLLDFLKSQAGSKIQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSEMLLCKIADFGLARVIE--------------------------------------------DDQYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITYGKIPYPGMSNSEVMSSVQRGYRMPRPENCPVELYEIMTTCWKNKPEDRPTFDYIQSVL 495          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 276.174 bits (705), Expect = 1.284e-85
Identity = 183/489 (37.42%), Postives = 255/489 (52.15%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNW------ITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRSSDKFPGDYTICVKFNDVQFYHVI---YSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK-CYESPKSRLDYLDENVLN---IKFEEIKLGPKIGCGEFSEVLQGEYQDTV-VAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL 1497
            ALY++  +  +DL F+ G+KL+   I    +W         S NK+  G +P N+V    SL+ E PWY  +  RS AE+ L+  EN  G FLIR+ +  PG+ ++ V+ +DV+  H       N GY L     F ++ EL+EHY K  DGLC  L + C +S       L  N ++   I+   +KL  ++G G+F EV +G + DT  VAVK LK P N   K  F  E  +M KL H  L+    + +  E +YIITE M NGSL+ YL++     ++ +DQI       SGM YLE    +HRDLAARN+L+    V KV+DFGLARV                               ++  +++      +         + PVKWTAPEA+  NK+T KSDVWSFGILL+EI +FG+TPYP +    V Q L  GYRM SP +    +Y++M DCW   P  RPTF    + L  K++ F 
Sbjct:   59 ALYDYTARTDDDLSFNAGDKLE--PITKGEDWWFSKAITGISANKK--GYIPANYVAPVESLDAE-PWYFPETKRSDAEKMLISQENKKGAFLIRNCESQPGELSLSVR-DDVKVKHYKIRKLDNGGYYLSTARNFPTLRELVEHYSKHEDGLCVRLAEPCKKSVAPETHGLSYNTVDQWEIERSSVKLLKQLGAGQFGEVFEGLWNDTTPVAVKTLK-PGNMDPKD-FLREAQIMKKLRHSKLIQLYAVCTLEEPIYIITELMSNGSLLEYLQNDRGATLRMSDQIDMGAQVASGMAYLELQNYIHRDLAARNVLVGDNNVCKVADFGLARV-----------------------------FQMDNEDNVYEAKEGT---------KFPVKWTAPEAINENKFTIKSDVWSFGILLYEIVTFGQTPYPTMTNFQVVQQLPKGYRMSSPPNCHKCLYDIMLDCWKDVPADRPTF----ETLQWKLEDFF 497          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 365.155 bits (936), Expect = 1.658e-120
Identity = 196/492 (39.84%), Postives = 279/492 (56.71%), Query Frame = 1
Query:   52 PLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNES-VYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL-HKKMKSFL 1497
            P + G    A Y+F+G+  +DL FSKGE L ++ +  DPNW    N     G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y +IYS+   ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +K  ++KL   IG GEF +V+ GE+Q   VAVKC+K   N A    F  E  +M +L H +LV   G+   ++S ++I+TE+M  GSLV+YLRSRGR+V+     +KF++D   GM YLE +  VHRDLAARN+L++ + +AKVSDFGL +                                            S++ D +    ++PVKWTAPEAL    ++ KSDVWSFGILLWEI+SFGR PYPRI   +V   + NGY+M++P+  P  +Y+LM+ CW L+P++RPTF  + + L H K K   
Sbjct:   13 PWQAGTECIANYDFQGKAEQDLHFSKGEVLTIVAVTKDPNWYKAKNKVGRVGFIPANYVQKREGVKSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSGKLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTVAAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKCIK---NDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTK------------------------------------------EASAIQDTS----KLPVKWTAPEALRDKLFSTKSDVWSFGILLWEIYSFGRVPYPRIALKDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHIKAKELF 455          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 362.073 bits (928), Expect = 2.239e-119
Identity = 196/498 (39.36%), Postives = 281/498 (56.43%), Query Frame = 1
Query:   40 LLHMPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNES-VYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNK--YTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL-HKKMKSFL 1497
            ++  P + G    A Y+F+G+  +DL FSKGE L ++ +  DPNW    N     G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y +IYS+   ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +K  ++KL   IG GEF +V+ GE+Q   VAVKC+K   N A    F  E  +M +L H +LV   G+   ++S ++I+TE+M  GSLV+YLRSRGR+V+     +KF++D   GM YLE +  VHRDLAARN+L++ + +AKVSDFGL +                                            S++ D +    ++PVKWTAPEAL      ++ KSDVWSFGILLWEI+SFGR PYPRI   +V   + NGY+M++P+  P  +Y+LM+ CW L+P++RPTF  + + L H K K   
Sbjct:    3 VVQAPWQAGTECIANYDFQGKAEQDLHFSKGEVLTIVAVTKDPNWYKAKNKVGRVGFIPANYVQKREGVKSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSGKLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTVAAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKCIK---NDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTK------------------------------------------EASAIQDTS----KLPVKWTAPEALRDKASLFSTKSDVWSFGILLWEIYSFGRVPYPRIALKDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHIKAKELF 451          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 340.887 bits (873), Expect = 9.647e-112
Identity = 182/460 (39.57%), Postives = 260/460 (56.52%), Query Frame = 1
Query:  148 LKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNES-VYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL-HKKMKSFL 1497
            + ++ DPNW    N     G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y +IYS+   ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +K  ++KL   IG GEF +V+ GE+Q   VAVKC+K   N A    F  E  +M +L H +LV   G+   ++S ++I+TE+M  GSLV+YLRSRGR+V+     +KF++D   GM YLE +  VHRDLAARN+L++ + +AKVSDFGL +                                            S++ D +    ++PVKWTAPEAL    ++ KSDVWSFGILLWEI+SFGR PYPRI   +V   + NGY+M++P+  P  +Y+LM+ CW L+P++RPTF  + + L H K K   
Sbjct:    1 MSVVQDPNWYKAKNKVGRVGFIPANYVQKREGVKSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSGKLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTVAAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKCIK---NDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTK------------------------------------------EASAIQDTS----KLPVKWTAPEALRDKLFSTKSDVWSFGILLWEIYSFGRVPYPRIALKDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHIKAKELF 411          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 301.982 bits (772), Expect = 2.710e-96
Identity = 177/496 (35.69%), Postives = 264/496 (53.23%), Query Frame = 1
Query:   40 LLHMPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNES-VYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL-HKKMKSFL 1497
            ++  P + G    A Y+F+G+  +DL FSKGE L ++ +  DPNW    N     G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y +IYS+   ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +K  ++KL   IG GEF +V+ GE+Q   VAVKC+K   N A    F  E  +M +L H +LV   G+   ++S ++I+TE+M  GSLV+YLRSRGR+V+     +KF++D   GM YLE +  VHRDLAARN+L++ + +AKVSDFGL +                                            S++ D +    ++PVKWTAPEAL      +K+ V        ++ S  R     +   +V   + NGY+M++P+  P  +Y+LM+ CW L+P++RPTF  + + L H K K   
Sbjct:    3 VVQAPWQAGTECIANYDFQGKAEQDLHFSKGEVLTIVAVTKDPNWYKAKNKVGRVGFIPANYVQKREGVKSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSGKLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTVAAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKCIK---NDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTK------------------------------------------EASAIQDTS----KLPVKWTAPEAL-----RDKASV--------KLPSITRQSTRAL--KDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHIKAKELF 434          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: gpn2 (GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751862])

HSP 1 Score: 288.115 bits (736), Expect = 1.602e-90
Identity = 168/460 (36.52%), Postives = 247/460 (53.70%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQ-HQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDED--SWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTF 1452
            K ++L F KG+ + ++    +  W    ++    +GL+    V+  P + ++      PW+HG ++   A ++L P ENG FL+R S + PGDY +CV F D +  H   SN+G  L+ D    F ++ ++IE+Y      L   L K  C +   S    L +    + F+ + LG KIG GEF +VLQGEY    VA+K +K  +       F  E + M KL H +LV   G+   N  + ++ E M  G+LVNYLRSRGR+++     + F++D   GM YLE   LVHRDLAARNIL++ K  AK+SDFGL++                                          P    DD    + R+P+KWTAPEAL + K++++SDVWSFG+LLWE++S+GR PYP++    V + +  GYRME+PE+ P  IY +M+ CW  +P KRPTF
Sbjct:   21 KPKELAFHKGDLVTIVSTCQEKGWYYAHHDGSGMEGLIWSGAVRERPPIKVDAKLSVMPWFHGAITGVQAVQQLQPKENGLFLVRESVRHPGDYVLCVCFKD-EVTHYRISNQGGKLNIDLTQNFNNLMDMIEYYSAHQGVLTTRLIKPKCKQGMISAEQKLAKAGWLLNFQNLTLGKKIGEGEFGDVLQGEYMGRPVAIKNIKCDMTAQN---FLSETATMTKLQHKNLVNLLGVILKN-GLLLVMELMSKGNLVNYLRSRGRSMVPPYQLLIFSMDIVQGMEYLELKRLVHRDLAARNILVSEKGEAKISDFGLSK------------------------------------------PQLQQDD----LSRLPIKWTAPEALQNYKFSSRSDVWSFGVLLWEVYSYGRAPYPKMSVREVIEAVKKGYRMEAPENCPPMIYSIMKSCWEADPGKRPTF 429          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Csk (c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:88537])

HSP 1 Score: 362.844 bits (930), Expect = 9.079e-120
Identity = 193/474 (40.72%), Postives = 267/474 (56.33%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RPTF ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Csk (c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:88537])

HSP 1 Score: 362.844 bits (930), Expect = 9.079e-120
Identity = 193/474 (40.72%), Postives = 267/474 (56.33%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RPTF ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Csk (c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:88537])

HSP 1 Score: 362.844 bits (930), Expect = 9.079e-120
Identity = 193/474 (40.72%), Postives = 267/474 (56.33%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RPTF ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Matk (megakaryocyte-associated tyrosine kinase [Source:MGI Symbol;Acc:MGI:99259])

HSP 1 Score: 317.39 bits (812), Expect = 6.595e-102
Identity = 174/472 (36.86%), Postives = 262/472 (55.51%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQ-GLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCY--ESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            K  +L F KG+ + +L+   D +W    ++   Q GL+    ++   +L+ +      PW+HGK+S   A ++L P E+G FL+R S + PGDY +CV F  DV  Y V++ +   T+DE   F ++ +++EHY KD   +C  L K    +  KS  + L +    +  + + LG +IG GEF  VLQGEY    VAVK +K  +       F  E ++M KL H +LV   G+   +  +YI+ E++  G+LVN+LR+RGR ++ T+  ++FA+    GM YLE   LVHRDLAARNIL++  LVAKVSDFGLA+ +                                            +D +     R+PVKWTAPEAL + ++++KSDVWSFG+LLWE+FS+GR PYP++    V + +  GYRME P+  P  ++ LM  CW  EP +RP F +I + L ++++S
Sbjct:   22 KPGELAFRKGDMVTILEACEDKSWYRAKHHGSGQEGLLAAAALRQREALSTDPKLSLMPWFHGKISGQEAIQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVCFCNLMDMVEHYTKDKGAICTKLVKPRRKQGAKSAEEELAKAGWLLDLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVT---AQAFLDETAVMTKLQHRNLVRLLGVIL-HHGLYIVMEHVSKGNLVNFLRTRGRALVSTSQLLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAE-----------------------------------------RKGLDSS-----RLPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPDGCPGSVHTLMGSCWEAEPARRPPFRKIVEKLGRELRS 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Matk (megakaryocyte-associated tyrosine kinase [Source:MGI Symbol;Acc:MGI:99259])

HSP 1 Score: 317.39 bits (812), Expect = 6.595e-102
Identity = 174/472 (36.86%), Postives = 262/472 (55.51%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQ-GLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCY--ESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            K  +L F KG+ + +L+   D +W    ++   Q GL+    ++   +L+ +      PW+HGK+S   A ++L P E+G FL+R S + PGDY +CV F  DV  Y V++ +   T+DE   F ++ +++EHY KD   +C  L K    +  KS  + L +    +  + + LG +IG GEF  VLQGEY    VAVK +K  +       F  E ++M KL H +LV   G+   +  +YI+ E++  G+LVN+LR+RGR ++ T+  ++FA+    GM YLE   LVHRDLAARNIL++  LVAKVSDFGLA+ +                                            +D +     R+PVKWTAPEAL + ++++KSDVWSFG+LLWE+FS+GR PYP++    V + +  GYRME P+  P  ++ LM  CW  EP +RP F +I + L ++++S
Sbjct:   22 KPGELAFRKGDMVTILEACEDKSWYRAKHHGSGQEGLLAAAALRQREALSTDPKLSLMPWFHGKISGQEAIQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVCFCNLMDMVEHYTKDKGAICTKLVKPRRKQGAKSAEEELAKAGWLLDLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVT---AQAFLDETAVMTKLQHRNLVRLLGVIL-HHGLYIVMEHVSKGNLVNFLRTRGRALVSTSQLLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAE-----------------------------------------RKGLDSS-----RLPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPDGCPGSVHTLMGSCWEAEPARRPPFRKIVEKLGRELRS 443          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P41239|CSK_CHICK (Tyrosine-protein kinase CSK OS=Gallus gallus OX=9031 GN=CSK PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 4.017e-121
Identity = 196/482 (40.66%), Postives = 275/482 (57.05%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIE-----DPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNES-VYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIH-KILHKKMKSF 1494
            A YNF G   +DLPFSKG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y +IYS+   ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +++KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G+    +S +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M+ P+  P  +YE+M+ CW L+P  RP+F ++  +++H K K  
Sbjct:   16 AKYNFHGTAEQDLPFSKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGIKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSSKLSIDEEVYFENLMQLVEHYTTDADGLCSRLIKPKVMEGTVAAQDEFSRSGWALNMKDLKLLQIIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKSGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEANNFVHRDLAARNVLVSEDNIAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDPPDGCPAIVYEVMKKCWTLDPGHRPSFHQLREQLVHIKEKEL 448          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P41241|CSK_MOUSE (Tyrosine-protein kinase CSK OS=Mus musculus OX=10090 GN=Csk PE=1 SV=2)

HSP 1 Score: 362.844 bits (930), Expect = 6.351e-119
Identity = 193/474 (40.72%), Postives = 267/474 (56.33%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RPTF ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q0VBZ0|CSK_BOVIN (Tyrosine-protein kinase CSK OS=Bos taurus OX=9913 GN=CSK PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.201e-118
Identity = 192/481 (39.92%), Postives = 272/481 (56.55%), Query Frame = 1
Query:   64 GDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNES-VYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHK 1479
            G    A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +++KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G+    +S +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RP+F ++ + L +
Sbjct:   11 GTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLCPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFFRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKSGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPSFLQLREQLER 442          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P41240|CSK_HUMAN (Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.624e-118
Identity = 192/474 (40.51%), Postives = 268/474 (56.54%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +YE+M++CW L+   RP+F ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P32577|CSK_RAT (Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 2.369e-118
Identity = 192/474 (40.51%), Postives = 267/474 (56.33%), Query Frame = 1
Query:   79 ALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            A YNF G   +DLPF KG+ L ++ +  DPNW    N    +G++P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV     V+ Y ++Y     ++DE+ +F ++ +L+EHY  DADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+   VAVKC+K   N A    F  E S+M +L H +LV   G I      +YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   VAKVSDFGL +                                            SS  D     G++PVKWTAPEAL   K++ KSDVWSFGILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +Y++M++CW L+   RPTF ++ + L
Sbjct:   16 AKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK------------------------------------------EASSTQDT----GKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYDVMKNCWHLDAATRPTFLQLREQL 440          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A1S3ICC4 (Tyrosine-protein kinase OS=Lingula unguis OX=7574 GN=LOC106176351 PE=3 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 4.814e-133
Identity = 209/482 (43.36%), Postives = 283/482 (58.71%), Query Frame = 1
Query:   58 KPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDY-LDENVL-----NIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHK 1479
            +PG  + A Y F+G   EDLPF KG+ L ++K   DP W     +   +G++P N+V+    + +   PW+HGK+ R  AEE L P E G FL+R S  +PGDYT+CV   N V+ YH+IY     T+DE+ +F ++ EL+EHY+ DADGLC  L K     K  ++Y +D+        +IK +++  G  IG GEF +V +GE++   VA+K LK   N A++  F  E SLM  L H +LV   G+    E +YI+TE+M  G+LV+YLR+RGR+VI   D + FA D+C GM YLE   LVHRDLAARN+L++   VAKVSDFGLAR                                                D+  + G+ P+KWTAPEAL  NK+TNKSD+WSFGIL+WEI+SFGR PYPRI   +V  H+  GYRME PE  PN++YE+MR  W L+P +RPTF ++   L K
Sbjct:   13 QPGQEVLARYTFQGNSREDLPFQKGDVLTIIKATRDPMWYHARRSDNKEGMIPANYVQKRSEVKLHAMPWFHGKIKREQAEELLQPREEGLFLVRESTNYPGDYTLCVAHKNSVEHYHIIYKLNKLTIDEEEYFDNLNELVEHYKNDADGLCTKLRKSVPKTKGGMEYTVDKRQFMDAGWSIKEKDLIKGETIGRGEFGDVRKGEFKGVPVAIKYLKDTDNAAQQ--FLAEASLMTSLKHRNLVQLIGVVLGQE-IYIVTEFMAKGNLVDYLRTRGRSVITKRDLLNFASDTCEGMAYLETKSLVHRDLAARNVLISEDGVAKVSDFGLAR----------------------------------------------RADSNQAGGKFPIKWTAPEALRENKFTNKSDMWSFGILIWEIYSFGRVPYPRIPLADVVMHVERGYRMEKPEGCPNEVYEVMRKAWDLDPARRPTFADVKVELEK 445          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: L7M1U7 (Tyrosine-protein kinase OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 6.527e-129
Identity = 208/481 (43.24%), Postives = 282/481 (58.63%), Query Frame = 1
Query:   55 LKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLN-----IKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            L PG  + A YNF G+ AEDL F+KG+ + ++    D NW    +    +GL+P+N++     + +   PW+HGK+SR  AE  L P E+G FL+R S  +PGDYT+CV F + V+ Y VIY     T+DE+ +F  +P+LIEHY++DADGLC  L++        L  +D          IK +++++   IG GEF +VL   Y+   VAVK +K+    + K +   E SLM  L HP+LV   G+     S+ I+TEYM  GSLV+YLRSRGR  +   DQI FA D+C+GM YLE   +VHRDLAARN+L++   VAKVSDFGLA+ +                                              DN    G+ P+KWTAPEAL  NK++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GYRMESPE  P+D+YELMR  W  EP++RPTF ++ + L 
Sbjct:    2 LPPGTEVVARYNFNGKSAEDLSFTKGDIMTIVSETPDCNWFRARHTDGREGLIPLNYILRRAEVKLNSMPWFHGKISRERAEMLLQPREDGLFLVRESTNYPGDYTLCVCFRSKVEHYRVIYRMGKLTIDEEEYFEGLPQLIEHYEQDADGLCTRLSRSVPKQGGEL-AIDHRAFEMAGWAIKKQDLQVIENIGKGEFGDVLLATYKGQKVAVKKIKE----SGKNMLIAEASLMTSLRHPNLVQLLGLVIEENSLQIVTEYMAKGSLVDYLRSRGRLHVTRIDQINFATDTCAGMAYLESKHVVHRDLAARNVLISDDGVAKVSDFGLAKDE---------------------------------------------SDNLEG-GKFPIKWTAPEALKCNKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVRHVSKGYRMESPEGCPSDVYELMRAAWQEEPQERPTFAQVLRKLQ 431          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A224YUT6 (Tyrosine-protein kinase OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 1.086e-128
Identity = 207/481 (43.04%), Postives = 282/481 (58.63%), Query Frame = 1
Query:   55 LKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLN-----IKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            L PG  + A YNF G+  EDL F+KG+ + ++    D NW    +    +GL+P+N++     + +   PW+HGK+SR  AE  L P E+G FL+R S  +PGDYT+CV F + V+ Y VIY     T+DE+ +F  +P+LIEHY++DADGLC  L++        L  +D          IK +++++   IG GEF +VL   Y+   VAVK +K+    + K +   E SLM  L HP+LV   G+   + S+ I+TEYM  GSLV+YLRSRGR  +   DQI FA D+C+GM YLE   +VHRDLAARN+L++   VAKVSDFGLA+ +                                              DN    G+ P+KWTAPEAL  NK++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GYRMESPE  P+D+YELMR  W  EP++RPTF ++ + L 
Sbjct:    2 LPPGTEVVARYNFNGKSTEDLSFTKGDIMTIVSETPDCNWFRARHTDGREGLIPLNYILRRAEVKLNSMPWFHGKISRERAEMLLQPREDGLFLVRESTNYPGDYTLCVCFRSKVEHYRVIYRMGKLTIDEEEYFEGLPQLIEHYEQDADGLCTRLSRSVPKQGGEL-AIDHRAFEMAGWAIKKQDLQVVENIGKGEFGDVLLATYKGQKVAVKKIKE----SGKNMLIAEASLMTSLRHPNLVQLLGLVIEDNSLQIVTEYMAKGSLVDYLRSRGRLHVTRVDQINFATDTCAGMAYLESKHVVHRDLAARNVLISDDGVAKVSDFGLAKDE---------------------------------------------SDNLEG-GKFPIKWTAPEALKCNKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVRHVSKGYRMESPEGCPSDVYELMRAAWQEEPQERPTFAQVLRKLQ 431          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A131YWK3 (Tyrosine-protein kinase OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 1.086e-128
Identity = 207/481 (43.04%), Postives = 282/481 (58.63%), Query Frame = 1
Query:   55 LKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLN-----IKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            L PG  + A YNF G+  EDL F+KG+ + ++    D NW    +    +GL+P+N++     + +   PW+HGK+SR  AE  L P E+G FL+R S  +PGDYT+CV F + V+ Y VIY     T+DE+ +F  +P+LIEHY++DADGLC  L++        L  +D          IK +++++   IG GEF +VL   Y+   VAVK +K+    + K +   E SLM  L HP+LV   G+   + S+ I+TEYM  GSLV+YLRSRGR  +   DQI FA D+C+GM YLE   +VHRDLAARN+L++   VAKVSDFGLA+ +                                              DN    G+ P+KWTAPEAL  NK++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GYRMESPE  P+D+YELMR  W  EP++RPTF ++ + L 
Sbjct:    2 LPPGTEVVARYNFNGKSTEDLSFTKGDIMTIVSETPDCNWFRARHTDGREGLIPLNYILRRAEVKLNSMPWFHGKISRERAEMLLQPREDGLFLVRESTNYPGDYTLCVCFRSKVEHYRVIYRMGKLTIDEEEYFEGLPQLIEHYEQDADGLCTRLSRSVPKQGGEL-AIDHRAFEMAGWAIKKQDLQVVENIGKGEFGDVLLATYKGQKVAVKKIKE----SGKNMLIAEASLMTSLRHPNLVQLLGLVIEDNSLQIVTEYMAKGSLVDYLRSRGRLHVTRVDQINFATDTCAGMAYLESKHVVHRDLAARNVLISDDGVAKVSDFGLAKDE---------------------------------------------SDNLEG-GKFPIKWTAPEALKCNKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVRHVSKGYRMESPEGCPSDVYELMRAAWQEEPQERPTFAQVLRKLQ 431          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A1Z5KWJ4 (Tyrosine-protein kinase (Fragment) OS=Ornithodoros moubata OX=6938 PE=3 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 1.484e-128
Identity = 206/476 (43.28%), Postives = 276/476 (57.98%), Query Frame = 1
Query:   55 LKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLN-----IKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            L  G  + A YNF  +  EDL F+KG+ + ++    DPNW    +N   +GL+P+N++     + +   PW+HGK++R  AE  L P E+G FL+R S  +PGDYT+CV +   V+ Y VIY     T+DE+ +F  +P+LIEHYQ DADGLC  L++        L  +D          IK +++ +   IG GEF +VL   Y+   VAVK +K+    + K +   E SLM  L HP+LV   G+   + S+ I+TEYM  GSLV+YLRSRGR  +   DQI FA D+C+GM YLE   +VHRDLAARN+L++   +AKVSDFGLAR +                                              DN    G+ P+KWTAPEAL  N+++NKSD+WSFGILLWEI+SFGR PYPRI   +V +H+  GYRMESPE  P DIYELMR  W  +P+KRPTF E+
Sbjct:    2 LPSGTEVVARYNFIAKSREDLSFTKGDLMTIVSGTPDPNWFRAKHNDGREGLIPLNYILRRAEVKLNSMPWFHGKITRDKAEALLSPREDGLFLVRESTNYPGDYTLCVCYRGKVEHYRVIYRENKLTIDEEEYFEGLPQLIEHYQNDADGLCTRLSRSVPKQDGEL-VIDHRAFEMAGWAIKKQDLHVIENIGKGEFGDVLLANYKGQKVAVKKIKE----SGKNMLIAEASLMTSLRHPNLVQLLGLVIEDNSLQIVTEYMSKGSLVDYLRSRGRLHVTKQDQINFATDTCAGMAYLESKHVVHRDLAARNVLISEDCIAKVSDFGLARDE---------------------------------------------SDNLEG-GKFPIKWTAPEALKCNRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVRHVSKGYRMESPEGCPTDIYELMRSAWQEDPDKRPTFAEV 426          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: csk (tyrosine-protein kinase CSK [Source:NCBI gene;Acc:103033740])

HSP 1 Score: 357.836 bits (917), Expect = 5.515e-118
Identity = 192/481 (39.92%), Postives = 266/481 (55.30%), Query Frame = 1
Query:   61 PGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            PG    A YNF G   +DLP  KG+ L ++ +  DPNW    N    +G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  FPGDYT+CV  +  V+ Y ++Y N   ++DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+ T VAVKC+K   + A    F  E S+M ++ H +LV   G I     S+YI+TEYM  GSLV+YLRSRGRT+I  +  +KF+++ C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS  D      ++PVKWTAPEAL    ++ KSDVWS+GILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +Y +M+ CW L+   RPTF  +   L 
Sbjct:   10 PGTECVARYNFPGTTDQDLPLCKGDVLTIIGVTKDPNWYKAKNTVGREGTIPANYVQKREGVKSGGKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNFPGDYTLCVSCDGKVEHYRIVYQNCKLSIDEEEFFENLMQLVEHYTKDADGLCTRLIKPKLMEGTVAAQDEFSRSGWALNRKELKLLQAIGKGEFGDVMVGDYRGTKVAVKCIK---HDATAQAFVAEASVMTQMRHNNLVQLLGVIVEEKGSLYIVTEYMAKGSLVDYLRSRGRTIIGGDCLLKFSMNVCEAMEYLEANNFVHRDLAARNVLVSDDNIAKVSDFGLTK------------------------------------------EASSTQDT----AKLPVKWTAPEALREKTFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYNIMKQCWTLDVNMRPTFNALRDSLQ 441          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:103023502])

HSP 1 Score: 354.755 bits (909), Expect = 7.664e-117
Identity = 190/484 (39.26%), Postives = 271/484 (55.99%), Query Frame = 1
Query:   64 GDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMK 1488
            G    A YNF+G   +DLPF KG+ L ++ +  DPNW    N    +G +P N+V+    +         PW+HGK++R  AE  L P E G +L+R S  +PGDYT+CV     V+ Y +IY N   ++DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +   +  +++KL   IG GEF +V+ G+Y+ T VAVKC+K     A    F  E S+M +L H +LV   G I     S++I+TEYM  GSLV+YLRSRGRTV+  +  +KF++D C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS  D      ++PVKWT+PEAL   +++ KSDVWS+G+LLWEI+SFGR PYPRI    V   +  GY+M++P+  P  +Y+LM+ CW L+   RP+F    ++L +K++
Sbjct:   11 GTECVAKYNFQGTTEQDLPFCKGDVLTIIGVTKDPNWYKAKNTVGREGTIPANYVQKREGVKSGGKLSLMPWFHGKITRDQAERLLYPPETGLYLVRESTNYPGDYTLCVSCEGKVEHYRIIYHNGKLSIDEEEFFENLMQLVEHYTKDADGLCTRLIKPKLMEGTVAAQDEFSRSGWALSRKDLKLIQTIGKGEFGDVMVGDYRGTKVAVKCIKHD---ATAQAFIAEASVMTQLRHNNLVQLLGVIVEERGSLFIVTEYMAKGSLVDYLRSRGRTVLGGDCLLKFSLDVCEAMEYLEVNNFVHRDLAARNVLVSEDNIAKVSDFGLTK------------------------------------------EASSTQDT----AKLPVKWTSPEALREKRFSTKSDVWSYGVLLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDAPDGCPAVVYDLMKQCWTLDSVMRPSF----RMLREKLQ 441          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:103023502])

HSP 1 Score: 354.755 bits (909), Expect = 9.386e-117
Identity = 190/484 (39.26%), Postives = 272/484 (56.20%), Query Frame = 1
Query:   64 GDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMK 1488
            G    A YNF+G   +DLPF KG+ L ++ +  DPNW    N    +G +P N+V+    +         PW+HGK++R  AE  L P E G +L+R S  +PGDYT+CV     V+ Y +IY N   ++DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +   +  +++KL   IG GEF +V+ G+Y+ T VAVKC+K   + A    F  E S+M +L H +LV   G I     S++I+TEYM  GSLV+YLRSRGRTV+  +  +KF++D C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS  D      ++PVKWT+PEAL   +++ KSDVWS+G+LLWEI+SFGR PYPRI    V   +  GY+M++P+  P  +Y+LM+ CW L+   RP+F    ++L +K++
Sbjct:   14 GTECVAKYNFQGTTEQDLPFCKGDVLTIIGVTKDPNWYKAKNTVGREGTIPANYVQKREGVKSGGKLSLMPWFHGKITRDQAERLLYPPETGLYLVRESTNYPGDYTLCVSCEGKVEHYRIIYHNGKLSIDEEEFFENLMQLVEHYTKDADGLCTRLIKPKLMEGTVAAQDEFSRSGWALSRKDLKLIQTIGKGEFGDVMVGDYRGTKVAVKCIK---HDATAQAFIAEASVMTQLRHNNLVQLLGVIVEERGSLFIVTEYMAKGSLVDYLRSRGRTVLGGDCLLKFSLDVCEAMEYLEVNNFVHRDLAARNVLVSEDNIAKVSDFGLTK------------------------------------------EASSTQDT----AKLPVKWTSPEALREKRFSTKSDVWSYGVLLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDAPDGCPAVVYDLMKQCWTLDSVMRPSF----RMLREKLQ 444          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:103034670])

HSP 1 Score: 317.775 bits (813), Expect = 1.769e-102
Identity = 183/486 (37.65%), Postives = 261/486 (53.70%), Query Frame = 1
Query:   58 KPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWI--TCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLD--ENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKM 1485
            +PG    A  +    K  ++ + KG+ L +L ++     I     N    +G++  + V+    L ++      PW+HGK+S   A  +L P E+G FL+R S + PGDY +CV F  +V  Y VIY +   T+D    F ++ +++E Y K+   L  TL K  +   +R   L   +    +    + LG  IG GEF  V +GEY    VAVK +K  +       F  E S+M KL H +LV   G+   N  +YI+TE+M  G+LVNYLRSRGR+VI T   + +A++ C GM YLE   LVHRDLAARNILL+   VAKVSDFGLA+VD                                          S   DNT    ++PVKWTAPE L + K + +SDVWS+G+LLWEIFS+G  PYP++    VK+ +  GYRME+PE  P ++Y +MRDCW  EP+ RP+F ++ ++L  ++
Sbjct:    7 QPGTQCVAKCDHTKPKGNEIAYLKGDILTILDVLETGKSIFRARHNRTGEEGVLSASKVREREVLRVDPNLSLMPWFHGKISGPEAVSKLRPMEDGLFLVRESIRHPGDYVLCVSFKQEVIHYRVIYQDSKLTIDSTQHFYNLIDMVEFYSKNKGALVTTLQKPKQKEGARSAALQLYKTGWLLDLAGLTLGESIGEGEFGAVYEGEYMGRKVAVKNIKSDVT---AQAFLGETSVMTKLQHKNLVQLLGVILHN-GLYIVTEFMAKGNLVNYLRSRGRSVISTVQLLHYALEVCEGMEYLECKKLVHRDLAARNILLSEDNVAKVSDFGLAKVD------------------------------------------SQAFDNT----KLPVKWTAPEGLKNKKISTRSDVWSYGVLLWEIFSYGMQPYPKMSLQEVKEQVEQGYRMEAPEACPPEVYTIMRDCWEKEPKMRPSFHKLRELLQAEV 442          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:103034670])

HSP 1 Score: 312.383 bits (799), Expect = 1.140e-100
Identity = 172/423 (40.66%), Postives = 240/423 (56.74%), Query Frame = 1
Query:  226 VKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKF-NDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLD--ENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKM 1485
            +++ P+L++  PW+HGK+S   A  +L P E+G FL+R S + PGDY +CV F  +V  Y VIY +   T+D    F ++ +++E Y K+   L  TL K  +   +R   L   +    +    + LG  IG GEF  V +GEY    VAVK +K  +       F  E S+M KL H +LV   G+   N  +YI+TE+M  G+LVNYLRSRGR+VI T   + +A++ C GM YLE   LVHRDLAARNILL+   VAKVSDFGLA+VD                                          S   DNT    ++PVKWTAPE L + K + +SDVWS+G+LLWEIFS+G  PYP++    VK+ +  GYRME+PE  P ++Y +MRDCW  EP+ RP+F ++ ++L  ++
Sbjct:   44 LRVDPNLSLM-PWFHGKISGPEAVSKLRPMEDGLFLVRESIRHPGDYVLCVSFKQEVIHYRVIYQDSKLTIDSTQHFYNLIDMVEFYSKNKGALVTTLQKPKQKEGARSAALQLYKTGWLLDLAGLTLGESIGEGEFGAVYEGEYMGRKVAVKNIKSDVT---AQAFLGETSVMTKLQHKNLVQLLGVILHN-GLYIVTEFMAKGNLVNYLRSRGRSVISTVQLLHYALEVCEGMEYLECKKLVHRDLAARNILLSEDNVAKVSDFGLAKVD------------------------------------------SQAFDNT----KLPVKWTAPEGLKNKKISTRSDVWSYGVLLWEIFSYGMQPYPKMSLQEVKEQVEQGYRMEAPEACPPEVYTIMRDCWEKEPKMRPSFHKLRELLQAEV 415          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 270.781 bits (691), Expect = 4.404e-85
Identity = 164/483 (33.95%), Postives = 252/483 (52.17%), Query Frame = 1
Query:   67 DFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFAS----MPEL---IEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQD-TVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSV---GRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            + + ALY+FE    +D+ F KG+K+++++   +  W+    +  H+G +P N+V  + SL  E+ W+   VSR   E  L+   N  G +L+R S+   G Y++ V+  D+    V+   K  TLD   +F S     P+L   I+HY   +DGLC  L +   S K +    +++   I  + +KL  ++G G+F EV  G Y + T VA+K +K P + + +  F  E +LM  L HP LV    + +  E +YI+TE+MENGSL++YL+S   + +     I  A     GM ++E    +HRDL A NIL+N +L +K++DFGLAR+                                             ++DN  +     + P+KWTAPEA+ +  ++ KSDVWSFGILL EI +FGR PYP +  ++V + L  GYRM  PE  P  +Y +M DCW   PE+RPTF  +  +L 
Sbjct:    1 ELVVALYDFEQLNPDDMGFKKGDKMRIIQERGE-WWMAELMDGSHKGYIPSNYVAKANSLETEE-WFFSGVSRKEGERLLLAPGNSIGAYLLRDSESNKGSYSLSVRDYDITNGDVVRHYKIRTLDNGGYFISARLTFPDLFALIQHYTAHSDGLCQKLLRPCVSKKPQ-QLWEKDAWEIPRDSLKLSKRLGAGQFGEVWMGIYNNRTKVAIKTMK-PGSMSPEA-FLDEANLMKTLQHPRLVRLYAVVT-QEPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARI---------------------------------------------IEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMSNSDVIRQLERGYRMPCPEQAPKQLYGVMMDCWKERPEERPTFEYLQGVLE 432          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 262.307 bits (669), Expect = 1.278e-81
Identity = 165/477 (34.59%), Postives = 251/477 (52.62%), Query Frame = 1
Query:   76 TALYNFEGQKAEDLPFSKGEKLKVLKIISDPNW------ITCSNNKQH-QGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRSSDKFPGDYTICVK-FNDVQFYHV--IYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK---CYESPKS-RLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQD-TVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVG-RIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTF 1452
             ALY+++G+  EDL F +GE L+V    +   W       + SN + + +G +P N+V    SL+ E PW+ G + R+ AE+ L+   N  G FLIR S+    DY++ V+  + V+ Y +  +  N G+ +     F ++ EL+++Y+ ++DGLC  L K     E+P +  L Y   +   I    I+L  ++G G F EV QG + + T+VAVK LK      +K  F  E  +M +L H +L+    + S  E +YIITE M +GSL++YLR      +K  + +  A    +GM YLE    +HRDLAARNIL+    V KV+DFGLAR+                                        +     D+     G ++P+KWTAPEA+  ++++ KSDVWSFGILL+E+ ++GR PYP +    V + L  GYRM  P++ P   Y +M +CW  + E+RPTF
Sbjct:    2 VALYDYDGRTNEDLSFKEGELLEVTDKTNSDWWYAQKKTASTSNERYNTRGYIPANYVAEYQSLDAE-PWFFGDIKRADAEKYLLADVNTTGAFLIRQSESRKTDYSLSVRDGSTVKHYRIRQLDENGGFFISRRVTFQNLIELVQYYKSNSDGLCMALQKPCVVIEAPTTIGLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQGLWNNSTLVAVKTLKP--GAMKKEEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARI----------------------------------------IKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTF 435          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 254.218 bits (648), Expect = 1.844e-78
Identity = 162/490 (33.06%), Postives = 243/490 (49.59%), Query Frame = 1
Query:   70 FLTALYNFEGQKAEDLPFSKGEKLKVLK-------IISDPNWITC-SNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRSSDKFPGDYTIC------VKFNDVQFYHVI-YSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTV-VAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSV---GRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
               ALY+++ +  +DL F KGEK +++        +  + +W    S +  ++G +P N+V  + S+  E+ WY GKVSR  AE +L+   N  GTFLIR S+   G Y++       VK ++V+ Y +    N GY +   + F ++ +L++HY + ADGLC  LT    + K +   L  +   +  + +KL  K+G G F EV  G +  T  VA+K LK      E   F  E  +M KL H  LV    + S  E +YI+TE+M  GSL+++L+      +K    +  A    +GM Y+E    +HRDL A NIL+   L+ K++DFGLAR+                                             ++DN  +     + P+KWTAPEA    ++T KSDVWSFGILL E+ + GR PYP +    V + +  GYRM  P   P  ++ELM  CW  +PE+RPTF  +   L 
Sbjct:   17 LFVALYDYDARTQDDLSFRKGEKFQIINNTIEVAVVYREGDWWEARSLSTGNKGYIPSNYVAPADSVQAEE-WYFGKVSRKDAERQLLCPGNPRGTFLIRESETTKGAYSLSIRDWDEVKGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVQHYSEHADGLCYKLTLVCPNEKPQTQGLARDAWEMPRDSLKLELKLGQGCFGEVWAGTWNGTTKVAIKTLKPGTMSPEA--FLEEAQIMKKLRHDKLVQLYAVVS-EEPIYIVTEFMSKGSLLDFLKEGDGRYLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARL---------------------------------------------IEDNEYTARQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPPSCPESLHELMMQCWKKDPEERPTFEYLQAFLE 457          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 252.292 bits (643), Expect = 2.817e-77
Identity = 160/484 (33.06%), Postives = 256/484 (52.89%), Query Frame = 1
Query:   64 GDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFAS-------MPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEY-QDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSV---GRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILH 1476
            G  + ALY+++   A+DL F +G++L +++  +D  W   S   + +G +P N V    S+  E+ W+   +SR  AE +L+ C N  G++LIR S+   G Y++ V+ + V+    +   K  TLD+  +F +       + EL+ +Y   ADGLC  L K   + + +  + +++   I  E IKL  K+G G+F +V  G Y + T VAVK +K P + A +  F  E +LM  L H  LV    + + +E ++I+TEYME GSL+++L++   + +K    I        GM ++E+   +HRDL A NIL+N  LV K++DFGLAR+                                             ++DN  +     + P+KWTAPEA+ +  ++ KSDVWSFGILL E+ +FGR PYP +    V + L  GYRM  P++ P ++Y +M++CW  +PE+RPTF  +  +L 
Sbjct:   65 GLLVVALYDYDPIHADDLCFRRGDQLVIVEEGND-WWKARSVATKKEGYIPSNFVAKVNSIEKEE-WFFKGLSRKDAERQLLLCGNKIGSYLIRDSETNKGSYSLSVRDHIVEVGDTVKHYKIRTLDKGGYFITSRITFHTLQELVVYYHLKADGLCQKLGKPCIAIQPQKPW-EKDAWEIPRESIKLEKKLGAGQFGDVWMGVYNKKTKVAVKMMK-PGSMAPQA-FLEEANLMKTLQHDKLVRLHAVVT-DEPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARI---------------------------------------------IEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERGYRMPKPDNCPCELYSIMQECWRQKPEERPTFEYLQSLLE 497          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: abl1 (c-abl oncogene 1, non-receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-100812-9])

HSP 1 Score: 251.521 bits (641), Expect = 5.767e-73
Identity = 165/495 (33.33%), Postives = 246/495 (49.70%), Query Frame = 1
Query:   28 TKEFLLHMPLKPGD--FLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVI--YSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYL-----DENVLNIKFEEIKLGPKIGCGEFSEVLQG---EYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVG-RIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            +KE LL +P  P D     ALY+F       L  +KGEKL+VL    +  W    +++  QG VP N++    SL     WYHG +SR+ AE  L    NG+FL+R S+  PG  +I ++     +++ I   S+  Y +  +S F+++ EL+ H+   ADGL   L   Y +PK     +       +   I+  +I +  K+G G++ EV +G   +Y  TV AVK L    +  E   F  E ++M ++ HP+LV   G+ +     YI+TE+M +G+L++YLR   R  +     +  A    S M YLE+   +HRDLAARN L+    + KV+DFGL+R                              LM               D  T   G + P+KWTAPE+L +NK+       +FG+LLWEI ++G +PYP +  + V + L  GYRME PE  P  +Y+LM+ CW      RP+F EIH+  
Sbjct:   24 SKENLLSVPGDPDDTNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWCEV-HSRNGQGWVPSNYITPVNSLEKHS-WYHGPISRNAAEYLLSSGINGSFLLRESESSPGQLSISLRCEGRVYHYRINTASDGKYFVSSESRFSTLAELVHHHSSVADGLIVPLH--YPAPKRTKPTVYGVSPTYDRWEIERTDITMKHKLGGGQYGEVYEGLKKKYSRTV-AVKTLNPREDTMEVEEFLKEAAMMKEIKHPNLVQLLGVCTREPPFYIVTEFMTHGNLLDYLRECNRDEVTAVVLLHMATQISSAMEYLEKKNFIHRDLAARNCLVAESHMVKVADFGLSR------------------------------LMTG-------------DTYTARAGAKFPIKWTAPESLAYNKFCAPVSCSAFGVLLWEIATYGMSPYPGVDLSQVYERLERGYRMEQPEGCPPRVYQLMQACWQWNAADRPSFAEIHQTF 470          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 77.0258 bits (188), Expect = 1.509e-15
Identity = 75/306 (24.51%), Postives = 121/306 (39.54%), Query Frame = 1
Query:  598 LGPKIGCGEFSEVLQGEYQDTV--VAVKCL-KKPINFAEKTLFTF--EFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAK-----LVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESP--------EDTPNDIYELMRDCWALEPEKRPTFCEI 1461
             G  +G G F  V Q +  +T   VAVK L KK +   +  L     E  ++ +L+HP++V FK    S +  YIIT+  + G L + +  +G+      D ++  ++  S + Y+    +VHRDL   N+L   K     LV  V+DFG+A+                                L    +L+  P  S+             + APE LT + +    D+WS G++ + +       Y    A  V+  L      E P        +   N   + +     L+P KRPT  E+
Sbjct:   39 FGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGK--FTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLV--VADFGIAK-------------------------------RLKSDEELLYKPAGSLG------------YVAPEVLTQDGHGKPCDIWSIGVITYTLL----CGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAEL 293          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 78.1814 bits (191), Expect = 1.630e-15
Identity = 73/292 (25.00%), Postives = 120/292 (41.10%), Query Frame = 1
Query:  598 LGPKIGCGEFSEVLQG--EYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHK 1467
            L   IG G +  V +   ++ D VVA+K +    N  E      E SL+  LNH ++V + G    +  +YI+ EY  NGSL   L SR  T +  N+   +   +  G+ YL    ++HRD+ A NILL+A    K++DFG++ +                                 V +  ++L  +             + W APE L +   +  SD+WS G  + E+ +    PY  +   N+   + N      P      + + +  C+     KRPT  ++ K
Sbjct:   27 LKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE-NDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSL-RRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTI---------------------------------VNSSALTLAGT-------------LNWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDANIYYAVEND-TYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 77.7962 bits (190), Expect = 1.911e-15
Identity = 67/271 (24.72%), Postives = 120/271 (44.28%), Query Frame = 1
Query:  652 QDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTN-KSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            QD +   K L+K I+  ++T+   E SL   L HPH+     + + +   Y++ EY+  G L++Y+   G   I+ +   KFA    S + YL  + +VHRDL   NI+++     K+ DFGL+ + D                        S K +      L                     + APE L  N YT  + DVWSFG++L+ +   G+ P+    ++ + + +  G ++E P+    ++  L+     ++P++R T  ++
Sbjct:  172 QDVLERQKKLEKEISRDKRTIR--EASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHGS--IREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYD------------------------SRKQLHTFCGSLY--------------------FAAPELLKANPYTGPEVDVWSFGVVLF-VLVCGKVPFDDENSSVLHEKIKQG-KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQV 392          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: SSK2 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; interacts with Ssk1p, leading to autophosphorylation and activation of Ssk2p which phosphorylates Pbs2p; also mediates actin cytoskeleton recovery from osmotic stress; a HOG-independent function of Ssk2p mediates the calcium-sensitive phenotype of the ptp2 msg5 double disruptant; SSK2 has a paralog, SSK22, that arose from the whole genome duplication [Source:SGD;Acc:S000005314])

HSP 1 Score: 78.1814 bits (191), Expect = 2.017e-15
Identity = 74/297 (24.92%), Postives = 128/297 (43.10%), Query Frame = 1
Query:  610 IGCGEFSEVLQGEYQDT--VVAVKCLKKPINFAEKTLFTF---EFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLAR--VDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNK---SDVWSFGILLWEIFSFGRTPYPRIYAN-NVKQHLLNGYRMESP--EDTPNDIYELMRDCWALEPEKRPTFCEI 1461
            IG G F  V      D   ++AVK +    + + + +F     E S++  LNHP++V++ G+    + V I  EY E GSL   L   GR   +   Q+ + +    G+ YL E  +VHRD+   NILL+   V K  DFG A+   ++    +               +     K + N  N L+ +  + +             + APE++T +    K    DVWS G ++ E+ + GR P+  +     +  H+  G+  + P  ++  +   + +  C    P KR +  E+
Sbjct: 1272 IGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEILNHPNIVSYYGVEVHRDKVNIFMEYCEGGSLAALLE-HGRIEDEMVTQV-YTLQLLEGLAYLHESGIVHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPM-------------YMAPESITGSTTKGKLGADDVWSLGCVVLEMIT-GRRPWANLDNEWAIMYHVAAGHTPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVEL 1552          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 77.0258 bits (188), Expect = 3.724e-15
Identity = 83/312 (26.60%), Postives = 131/312 (41.99%), Query Frame = 1
Query:  601 GPKIGCGEFS------EVLQGEYQDTVVAVKCLKKP--INFAEKTLFTFE-----FSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGR---TVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEAL-THNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMES----PEDTPNDIYELMRD----CWALEPEKRPTFCEI 1461
            G  IG G F        V  GE    ++AVK ++ P   +  E  L T E      S +  L+H ++V + G  + N    +  EY+  GS+ + +R  GR    +IK             G+ YL    ++HRD+ A N+LL+   + K+SDFG++R                                     D+ S        N+    R  V W APE + T   Y+ K D+WS G ++ E+F+ G+ P+  +    V   +    + +S    PEDT   I ++ R+    C+ + PEKRPT  E+
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGE----MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIK-----HLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKS----------------------------------KDIYS--------NSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNL---EVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANEL 1434          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 191.045 bits (484), Expect = 1.963e-56
Identity = 111/307 (36.16%), Postives = 160/307 (52.12%), Query Frame = 1
Query:  577 IKFEEIKLGPKIGCGEFSEVLQGEYQ--DTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            I+  EI +  K+G G++ EV +G ++  +  VAVK L++     E+  F  E S+M  + H +LV   G+ +     YIITE+M NG+L++YLRS     +     +  A    S M YLE    +HRDLAARN L+    + KV+DFGL+R+                                 V  D+ +    +         + P+KWTAPEAL HN ++ KSDVW+FGILLWE+ ++G +PYP I  + V   L  GYRM  PE  P ++Y LM+ CW  +P  RP+F EIH+ L+    S
Sbjct:    9 IERTEIAMKHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEE--FLKEASVMKGIKHQNLVQLLGVCTREPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRL---------------------------------VSEDIYTAHQGA---------KFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPEGCPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTMFPS 271          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 192.971 bits (489), Expect = 6.858e-56
Identity = 113/311 (36.33%), Postives = 162/311 (52.09%), Query Frame = 1
Query:  577 IKFEEIKLGPKIGCGEFSEVLQG-----EYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSR-GRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            I  +++KL   IG GEF++V +G     +     VAVK LK   +   +  F  E S+M + +HP+++  KG+ +    + IITE++ENGSL N+L+S  GR  + T   +       +GM YL E   +HRDLAARNIL++  L AKVSDFGL+R                                     +L   P +   +  T  G+IPV+WTAPEA+ + K+++ SDVWS+GILLWEI SFG  PY       V   +  GYR+ +P   P  I+ LM DCW  E   RP F +I +   + ++S
Sbjct:   22 INKDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGR--LTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSR-------------------------------------ELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEVIRS 293          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO28980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4Y3])

HSP 1 Score: 177.178 bits (448), Expect = 9.676e-51
Identity = 98/260 (37.69%), Postives = 138/260 (53.08%), Query Frame = 1
Query:  715 FTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSR-GRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            F  E S+M + +HP+++  KG+ +    + IITE++ENGSL N+L+S  GR  + T   +       +GM YL E   +HRDLAARNIL++  L AKVSDFGL+R                                     +L   P +   +  T  G+IPV+WTAPEA+ + K+++ SDVWS+GILLWEI SFG  PY       V   +  GYR+ +P   P  I+ LM DCW  E   RP F +I + L + ++S
Sbjct:   10 FCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGR--LTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSR-------------------------------------ELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRLDEVIRS 230          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW8])

HSP 1 Score: 172.555 bits (436), Expect = 6.564e-49
Identity = 108/327 (33.03%), Postives = 152/327 (46.48%), Query Frame = 1
Query:  577 IKFEEIKLGPKIGCGEFSEVLQG---------EYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLN-HPHLVTFKGISSSNESVYIITEYMENGSLVNYLRS-----------RGRT---VIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKM 1485
            + +  I  G  +G G F +V +          E ++TVVAVK L       ++  F  E  +M +L  H ++V+  G  +    + +ITEY   G L NYLR+            GR     +  ND + FA     GM YL +   VHRDLAARNIL+    + K+SDFGL R                                         +  SS      + G++P+KW APEA+  N +T KSDVW+FG++LWEI + G +PYP        + L NGYRME P+    ++Y +MR CWA  PE RPTF ++   L + M
Sbjct:   13 VDYSSIAFGEVVGSGAFGKVTKATIVGLPGGPENKETVVAVKKLNAMATMEDRRNFLSEIEMMKQLGKHLNIVSILGCVTHAGQLCLITEYCPYGDLRNYLRAIRDKVSTRDSLAGRAPGRELTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDNLVKISDFGLTR----------------------------------------DVYESSEYHKMHNTGKLPLKWMAPEAIFQNVHTTKSDVWAFGVVLWEIVTLGGSPYPGQSGKEFYKKLKNGYRMEKPDMCSPELYAMMRSCWASSPEDRPTFTKLRNQLEQLM 299          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD2])

HSP 1 Score: 169.474 bits (428), Expect = 1.297e-48
Identity = 100/276 (36.23%), Postives = 144/276 (52.17%), Query Frame = 1
Query:  568 VLNIKFEEIKLGPKIGCGEFSEVLQG-----EYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSR-GRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESP 1377
             + I  +++KL   IG GEF++V +G     +     VAVK LK   +   +  F  E S+M + +HP+++  KG+ +    + IITE++ENGSL N+L+S  GR  + T   +       +GM YL E   +HRDLAARNIL++  L AKVSDFGL+R                                     +L   P +   +  T  G+IPV+WTAPEA+ + K+++ SDVWS+GILLWEI SFG  PY       V   +  GYR+ +P
Sbjct:   22 AMEINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGR--LTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSR-------------------------------------ELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAP 258          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000006131.2 (tyrosine-protein kinase CSK [Source:NCBI gene;Acc:101158271])

HSP 1 Score: 370.548 bits (950), Expect = 6.149e-123
Identity = 201/490 (41.02%), Postives = 274/490 (55.92%), Query Frame = 1
Query:   52 PLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCE----IHKILHKK 1482
            P   G    A Y+F+G   +DLPF+KG+ L ++ +  DPNW    N    +G +P N+V+    +  +      PW+HGK++R  AE  L P E G FL+R S  FPGDYT+CV  +  V+ Y +IY N   T+DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +  ++  +++KL   IG GEF +V+ G+Y+ T VAVKC+K   N A    F  E S+M ++ H +LV   G I   N S+YI+TEYM  G LV+YLRSRGRTV+     +KFAID C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS  D      ++PVKWTAPEAL    ++ KSDVWS+GILLWEI+SFGR PYPRI   +V   +  GY+M+ P+  P  +Y +M+ CW L+P  RP+F      +H I HKK
Sbjct:    7 PWPQGTECVARYSFKGTSEQDLPFNKGDILTIIVVTKDPNWYKAKNAAGQEGTIPANYVQKREGVKTDGKLSLMPWFHGKITRDQAERLLNPPETGLFLVRESTNFPGDYTLCVSCDGKVEHYRIIYHNGKLTIDEEVYFENLMQLMEHYTKDADGLCTKLIKPKLEEGTVAAQDEFSRSGWSMNRKDLKLQQVIGKGEFGDVMVGDYRGTKVAVKCIK---NDATAQAFIAEASVMTQMRHNNLVQLLGVIVEENGSLYIVTEYMAKGCLVDYLRSRGRTVLGGEALLKFAIDVCEAMAYLETNNFVHRDLAARNVLVSDDNIAKVSDFGLTK------------------------------------------EASSTQD----TAKLPVKWTAPEALREKNFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDCPDGCPEVVYNIMKQCWNLDPGARPSFQMLKEWLHHISHKK 447          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:101160398])

HSP 1 Score: 367.081 bits (941), Expect = 1.237e-121
Identity = 196/491 (39.92%), Postives = 277/491 (56.42%), Query Frame = 1
Query:   43 LHMPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMK 1488
            +H P   G    A YNF+    +DLPF KG+ L ++ +  DPNW    N    +G +P N+V+    +         PW+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y +IY N   T+DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+ T VAVKC+K   N A    F  E S+M +L H +LV   G I     S+YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS+ D      ++PVKWT+PEAL   +++ KSDVWS+GILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +Y+LM+ CW L+   RP+F    ++L +K++
Sbjct:    4 IHAPWTSGTECVAKYNFQTANEQDLPFCKGDVLTIIGVTRDPNWYRARNTTGREGTIPANYVQKREGVKSGGKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIIYHNGKLTIDEEEYFENLMQLVEHYTKDADGLCTRLIKPKLMEGTVAAQDEFSRSGWALNRKELKLLQTIGKGEFGDVILGDYRGTRVAVKCIK---NDATAQAFIAEASVMTQLRHNNLVQLLGVIVEERGSLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEANNFVHRDLAARNVLVSDDNIAKVSDFGLTK------------------------------------------EASSIQDT----AKLPVKWTSPEALREKRFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPVVYDLMKQCWTLDAAMRPSF----RMLREKLQ 441          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:101160398])

HSP 1 Score: 320.472 bits (820), Expect = 1.408e-104
Identity = 172/413 (41.65%), Postives = 241/413 (58.35%), Query Frame = 1
Query:  262 WYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTK--CYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKG-ISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMK 1488
            W+HGK++R  AE  L P E G FL+R S  +PGDYT+CV  +  V+ Y +IY N   T+DE+ +F ++ +L+EHY KDADGLC  L K    E   +  D    +   +  +E+KL   IG GEF +V+ G+Y+ T VAVKC+K   N A    F  E S+M +L H +LV   G I     S+YI+TEYM  GSLV+YLRSRGR+V+  +  +KF++D C  M YLE +  VHRDLAARN+L++   +AKVSDFGL +                                            SS+ D      ++PVKWT+PEAL   +++ KSDVWS+GILLWEI+SFGR PYPRI   +V   +  GY+M++P+  P  +Y+LM+ CW L+   RP+F    ++L +K++
Sbjct:    2 WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIIYHNGKLTIDEEEYFENLMQLVEHYTKDADGLCTRLIKPKLMEGTVAAQDEFSRSGWALNRKELKLLQTIGKGEFGDVILGDYRGTRVAVKCIK---NDATAQAFIAEASVMTQLRHNNLVQLLGVIVEERGSLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEANNFVHRDLAARNVLVSDDNIAKVSDFGLTK------------------------------------------EASSIQDT----AKLPVKWTSPEALREKRFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPVVYDLMKQCWTLDAAMRPSF----RMLREKLQ 361          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:101164299])

HSP 1 Score: 301.212 bits (770), Expect = 6.423e-96
Identity = 174/470 (37.02%), Postives = 264/470 (56.17%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQ-HQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLN--IKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKM 1485
            K  +L +SKG+ L ++   +   +    +N    +GL+   HV+   +L ++      PW+HGK+S S A  +L P E+G FL+R S + PGDY +CV F+ +V  Y VIY +   T+D   +F ++ ++IE Y K+ D +  TLTK  +   ++   L+ + +   +   +++LG  IG GEF  V +GEY    VAVK +K  +       F  E ++M KL H +LV   G+   N+ ++I+TE M  G+LVN+LR+RGR+V+ +    ++++D C GM YLE   LVHRDLAARNIL++    AK+SDFGL +V                                           S   D      ++P+KWTAPEALT  K++ KSDVWS+G+LLWEIFS+GR PYP++   +V+  +  GYRME+PED P ++Y LM+ CW  EP +RP F ++ + L ++M
Sbjct:   19 KPGELAYSKGDVLTIVACSARKRYYRAKHNATGEEGLINATHVREREALRVDPSLSLMPWFHGKISGSEAVCQLQPAEDGLFLVRESVRHPGDYVLCVSFSGEVIHYRVIYQDNKLTIDNKQYFYNLIDMIEFYSKNKDSIATTLTKPKQKQGTKSAELELSKMGWLLDMTKLRLGGIIGEGEFGAVYEGEYVGQRVAVKTIKCDVT---AQAFLQETAVMTKLQHKNLVRLLGVIL-NKGLHIVTELMIKGNLVNFLRTRGRSVVTSIQLFRYSLDVCEGMEYLESKKLVHRDLAARNILVSDDNAAKISDFGLTKV------------------------------------------VSKEADK----AKLPIKWTAPEALTKEKFSTKSDVWSYGVLLWEIFSYGRQPYPKMSLKDVQAKVEAGYRMEAPEDCPANVYSLMKLCWEQEPRRRPGFPKLREKLEREM 438          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:101164299])

HSP 1 Score: 301.212 bits (770), Expect = 6.423e-96
Identity = 174/470 (37.02%), Postives = 264/470 (56.17%), Query Frame = 1
Query:  103 KAEDLPFSKGEKLKVLKIISDPNWITCSNNKQ-HQGLVPVNHVKLSPSLNIED-----PWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFN-DVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLN--IKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKM 1485
            K  +L +SKG+ L ++   +   +    +N    +GL+   HV+   +L ++      PW+HGK+S S A  +L P E+G FL+R S + PGDY +CV F+ +V  Y VIY +   T+D   +F ++ ++IE Y K+ D +  TLTK  +   ++   L+ + +   +   +++LG  IG GEF  V +GEY    VAVK +K  +       F  E ++M KL H +LV   G+   N+ ++I+TE M  G+LVN+LR+RGR+V+ +    ++++D C GM YLE   LVHRDLAARNIL++    AK+SDFGL +V                                           S   D      ++P+KWTAPEALT  K++ KSDVWS+G+LLWEIFS+GR PYP++   +V+  +  GYRME+PED P ++Y LM+ CW  EP +RP F ++ + L ++M
Sbjct:   19 KPGELAYSKGDVLTIVACSARKRYYRAKHNATGEEGLINATHVREREALRVDPSLSLMPWFHGKISGSEAVCQLQPAEDGLFLVRESVRHPGDYVLCVSFSGEVIHYRVIYQDNKLTIDNKQYFYNLIDMIEFYSKNKDSIATTLTKPKQKQGTKSAELELSKMGWLLDMTKLRLGGIIGEGEFGAVYEGEYVGQRVAVKTIKCDVT---AQAFLQETAVMTKLQHKNLVRLLGVIL-NKGLHIVTELMIKGNLVNFLRTRGRSVVTSIQLFRYSLDVCEGMEYLESKKLVHRDLAARNILVSDDNAAKISDFGLTKV------------------------------------------VSKEADK----AKLPIKWTAPEALTKEKFSTKSDVWSYGVLLWEIFSYGRQPYPKMSLKDVQAKVEAGYRMEAPEDCPANVYSLMKLCWEQEPRRRPGFPKLREKLEREM 438          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016115.1 (SMESG000016115.1)

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:   49 MPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL 1497
            MPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDSRTNSENCNNNLNSNSKNHSSKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL
Sbjct:    1 MPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDSRTNSENCNNNLNSNSKNHSSKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL 483          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016115.1 (SMESG000016115.1)

HSP 1 Score: 479.174 bits (1232), Expect = 1.356e-168
Identity = 254/254 (100.00%), Postives = 254/254 (100.00%), Query Frame = 1
Query:  736 MAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL 1497
            MAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDSRTNSENCNNNLNSNSKNHSSKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL
Sbjct:    1 MAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDSRTNSENCNNNLNSNSKNHSSKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL 254          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016115.1 (SMESG000016115.1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.117e-142
Identity = 194/194 (100.00%), Postives = 194/194 (100.00%), Query Frame = 1
Query:   49 MPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFS 630
            MPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFS
Sbjct:    1 MPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFS 194          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000059351.1 (SMESG000059351.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.356e-94
Identity = 163/420 (38.81%), Postives = 234/420 (55.71%), Query Frame = 1
Query:  262 WYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKG-YTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRL-------DYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTF-EFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 1491
            WYHG ++R  AE+ L P E G FLIR S  +PGD+T+CV + D VQ Y +IY  K  YT+DE+ +F+S+ EL+E Y  DA+GL   LTK    PKS L        Y  +       + + L   +G G+F+EV +  Y   ++A KC+   I  ++ T     E S+M  + H +LV F G+   ++ +Y++TEYM NGSLVNYLR+RG++ I   +Q+ F+I+   GM YLE+  LVHRDLA RNILL+  +VAK++DFGL R  DS                                                  GR+P+KWTAPEA+ +N+++  SD+WSFG++LWEI+SFG+ PY  I   +V   +  G+R+  P++ P +IY LM   W + P  RP F + HK+L   + S
Sbjct:   16 WYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTK--PLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYNGKILAAKCV---IQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG----------------------------------------------GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 384          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000045588.1 (SMESG000045588.1)

HSP 1 Score: 246.514 bits (628), Expect = 2.324e-74
Identity = 165/490 (33.67%), Postives = 250/490 (51.02%), Query Frame = 1
Query:   73 LTALYNFEGQKAEDLPFSKGEKLKVLKIISDPNWITCSNNKQHQGLVPVNHVKL---SPSLNIEDPWYHGKVSRSLAEERLMPCEN--GTFLIRS-SDKFPGDYTICVK-FNDVQFYHVIYSNKGYTLDED--------SWFASMPELIEHYQKDADGLCCTLT-KCYESPKSRLDYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTV-VAVKCLKKPINFAEKTLFTFEFSLMAKLNHPHLVTFKGISSS--NESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDXXXXXXXXXXXXXXXXXXXXXKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDT----PNDIYELMRDCWALEPEKRPTFCEIHKIL 1473
            + AL+++E +  +DL FSKG+ + +   +S+  W+      +  G +P N+V L   SPS +  + WY   ++   A+++L+   N  GT++IR  SD     Y + V+ F+  + Y+V+   K  TLD +        S F ++  LI++YQ + DGLCC LT  C +  K  + + D   + +  + I+L   +G G F EV  G++ ++V VAVK LK   N  +++ F  E  LM KLNHP +V   G+ +    + V+IITE M NG+L+NYLRS     ++ N+ +        GM YLE    VHRDL A NIL++  L  KV+DFGLARV D                                              N  +  + P+KWTAPEA    +++ KSDVWSFG+L++EI ++GRTPYP I    V   +  GYR+ +P       P+++Y +   CW   PE RPTF  +  I 
Sbjct:   69 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSH--EGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDS--KHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKD---IEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKP--NSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVY-------------------------------------------NADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIF 504          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSK3.382e-11940.51C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC... [more]
CSK3.382e-11940.51C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC... [more]
CSK3.382e-11940.51C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC... [more]
MATK3.049e-10236.86megakaryocyte-associated tyrosine kinase [Source:H... [more]
MATK1.239e-10136.86megakaryocyte-associated tyrosine kinase [Source:H... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk-16.083e-10235.55Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-16.083e-10235.55Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-15.977e-10135.62Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-15.977e-10135.62Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
src-21.036e-8135.04Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csk1.794e-10342.92gene:FBgn0262081 transcript:FBtr0300549[more]
Csk1.794e-10342.92gene:FBgn0262081 transcript:FBtr0300547[more]
Csk1.794e-10342.92gene:FBgn0262081 transcript:FBtr0300548[more]
Csk1.794e-10342.92gene:FBgn0262081 transcript:FBtr0299728[more]
Csk6.549e-10342.92gene:FBgn0262081 transcript:FBtr0300546[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk5.078e-11840.21C-terminal Src kinase [Source:ZFIN;Acc:ZDB-GENE-06... [more]
matk9.480e-9535.96megakaryocyte-associated tyrosine kinase [Source:Z... [more]
matk4.701e-9436.60megakaryocyte-associated tyrosine kinase [Source:Z... [more]
lyn5.305e-8834.58LYN proto-oncogene, Src family tyrosine kinase [So... [more]
frk1.284e-8537.42fyn-related Src family tyrosine kinase [Source:ZFI... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk1.658e-12039.84C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
csk2.239e-11939.36C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
csk9.647e-11239.57C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
csk2.710e-9635.69C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
gpn21.602e-9036.52GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csk9.079e-12040.72c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:8... [more]
Csk9.079e-12040.72c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:8... [more]
Csk9.079e-12040.72c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:8... [more]
Matk6.595e-10236.86megakaryocyte-associated tyrosine kinase [Source:M... [more]
Matk6.595e-10236.86megakaryocyte-associated tyrosine kinase [Source:M... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41239|CSK_CHICK4.017e-12140.66Tyrosine-protein kinase CSK OS=Gallus gallus OX=90... [more]
sp|P41241|CSK_MOUSE6.351e-11940.72Tyrosine-protein kinase CSK OS=Mus musculus OX=100... [more]
sp|Q0VBZ0|CSK_BOVIN1.201e-11839.92Tyrosine-protein kinase CSK OS=Bos taurus OX=9913 ... [more]
sp|P41240|CSK_HUMAN1.624e-11840.51Tyrosine-protein kinase CSK OS=Homo sapiens OX=960... [more]
sp|P32577|CSK_RAT2.369e-11840.51Tyrosine-protein kinase CSK OS=Rattus norvegicus O... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3ICC44.814e-13343.36Tyrosine-protein kinase OS=Lingula unguis OX=7574 ... [more]
L7M1U76.527e-12943.24Tyrosine-protein kinase OS=Rhipicephalus pulchellu... [more]
A0A224YUT61.086e-12843.04Tyrosine-protein kinase OS=Rhipicephalus zambezien... [more]
A0A131YWK31.086e-12843.04Tyrosine-protein kinase OS=Rhipicephalus appendicu... [more]
A0A1Z5KWJ41.484e-12843.28Tyrosine-protein kinase (Fragment) OS=Ornithodoros... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk5.515e-11839.92tyrosine-protein kinase CSK [Source:NCBI gene;Acc:... [more]
CSK7.664e-11739.26C-terminal Src kinase [Source:NCBI gene;Acc:103023... [more]
CSK9.386e-11739.26C-terminal Src kinase [Source:NCBI gene;Acc:103023... [more]
matk1.769e-10237.65megakaryocyte-associated tyrosine kinase [Source:N... [more]
matk1.140e-10040.66megakaryocyte-associated tyrosine kinase [Source:N... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hck4.404e-8533.95HCK proto-oncogene, Src family tyrosine kinase [So... [more]
frk1.278e-8134.59fyn-related Src family tyrosine kinase [Source:ZFI... [more]
clul11.844e-7833.06clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
hck2.817e-7733.06HCK proto-oncogene, Src family tyrosine kinase [So... [more]
abl15.767e-7333.33c-abl oncogene 1, non-receptor tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK11.509e-1524.51Calmodulin-dependent protein kinase; may play a ro... [more]
CDC151.630e-1525.00Protein kinase of the Mitotic Exit Network; locali... [more]
KIN11.911e-1524.72Serine/threonine protein kinase involved in regula... [more]
SSK22.017e-1524.92MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
BCK13.724e-1526.60MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471951.963e-5636.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337366.858e-5636.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289809.676e-5137.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491266.564e-4933.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337311.297e-4836.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006131.26.149e-12341.02tyrosine-protein kinase CSK [Source:NCBI gene;Acc:... [more]
CSK1.237e-12139.92C-terminal Src kinase [Source:NCBI gene;Acc:101160... [more]
CSK1.408e-10441.65C-terminal Src kinase [Source:NCBI gene;Acc:101160... [more]
matk6.423e-9637.02megakaryocyte-associated tyrosine kinase [Source:N... [more]
matk6.423e-9637.02megakaryocyte-associated tyrosine kinase [Source:N... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016115.10.000e+0100.00SMESG000016115.1[more]
SMESG000016115.11.356e-168100.00SMESG000016115.1[more]
SMESG000016115.11.117e-142100.00SMESG000016115.1[more]
SMESG000059351.11.356e-9438.81SMESG000059351.1[more]
SMESG000045588.12.324e-7433.67SMESG000045588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017367 ID=SMED30017367|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1731bp
ATCTATATAAATCTTATATGTTCTTCTACAAAAGAGTTTTTGTTACATAT
GCCACTGAAACCAGGTGATTTTTTAACTGCATTATATAACTTTGAAGGCC
AAAAGGCTGAAGATTTACCTTTTTCGAAAGGGGAAAAGTTGAAAGTCTTG
AAAATAATATCGGATCCGAACTGGATAACATGCTCTAATAATAAGCAACA
CCAAGGCTTGGTCCCAGTCAATCATGTTAAATTATCGCCATCTTTAAATA
TTGAAGATCCATGGTATCATGGAAAAGTTTCCCGGTCTCTCGCAGAAGAG
CGTCTGATGCCATGCGAAAATGGCACATTCCTAATTAGATCTTCCGATAA
ATTTCCTGGAGACTACACTATTTGTGTAAAATTCAACGATGTCCAGTTTT
ATCATGTCATTTATTCTAATAAAGGATACACACTTGATGAGGATTCTTGG
TTCGCTTCAATGCCTGAACTGATTGAGCATTATCAAAAAGATGCAGATGG
GTTGTGTTGTACATTGACAAAGTGTTATGAATCTCCGAAATCCAGACTGG
ATTATTTGGACGAAAATGTACTTAATATTAAATTTGAAGAAATCAAATTA
GGTCCGAAAATTGGTTGTGGCGAATTCAGTGAGGTCCTTCAGGGAGAATA
CCAAGATACAGTTGTGGCAGTGAAATGCTTAAAGAAACCTATAAATTTCG
CCGAAAAAACCTTGTTTACCTTTGAGTTTTCTTTAATGGCGAAATTGAAT
CATCCACATCTTGTAACTTTTAAAGGCATATCGTCATCAAACGAAAGTGT
ATACATTATAACAGAGTACATGGAGAATGGATCTCTTGTTAATTATTTAC
GGTCTCGTGGTCGTACTGTGATTAAAACCAATGATCAAATTAAATTTGCT
ATTGACTCATGCTCCGGTATGTGTTATCTTGAAGAACATTGTCTTGTACA
TCGTGATCTCGCAGCTAGAAACATTCTTCTCAATGCTAAGCTGGTTGCTA
AAGTTTCTGATTTTGGACTTGCAAGAGTAGATGACAGTAGAACGAATAGT
GAAAACTGTAATAACAATTTAAACTCCAATTCAAAAAATCATTCTTCAAA
AACTCCATCTCCGAAACTGATGTTAAATGTTGTTAATGATCTCGTCTCGT
TACCAACAAGTTCAGTCGATGATAATACCACCAGTGTTGGCAGAATACCA
GTTAAGTGGACAGCTCCTGAAGCTCTTACACACAATAAATATACCAACAA
GTCAGATGTATGGAGTTTTGGAATTTTATTGTGGGAAATATTTTCCTTCG
GTCGCACTCCTTATCCTAGAATTTATGCTAACAATGTTAAACAACATCTT
TTAAATGGATACCGCATGGAGTCTCCTGAAGATACTCCTAACGACATCTA
TGAATTGATGCGAGATTGTTGGGCCTTAGAACCGGAAAAGCGACCTACAT
TTTGTGAAATTCATAAAATATTACATAAAAAGATGAAATCATTCTTGTAG
CGGTTAATTGACAAAATGTTTATGCTCAAAACTAATTGATCGAGATCAGA
TGACCTCCTATAATGTAATTTATTCATGGGTTTCTAATTGTGTTAATTGC
AATGTAAAATGCTTATTGGTAAGTAAAGTCTTGTGATTTTAAAATTTCGG
TTTTTACCAGAATTCATTTGCGCGAAAACTTTATTTATCCAATCATTAAA
AAATGATTTTTTTTGATAATTTATTGTCACT
back to top

protein sequence of SMED30017367-orf-1

>SMED30017367-orf-1 ID=SMED30017367-orf-1|Name=SMED30017367-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
IYINLICSSTKEFLLHMPLKPGDFLTALYNFEGQKAEDLPFSKGEKLKVL
KIISDPNWITCSNNKQHQGLVPVNHVKLSPSLNIEDPWYHGKVSRSLAEE
RLMPCENGTFLIRSSDKFPGDYTICVKFNDVQFYHVIYSNKGYTLDEDSW
FASMPELIEHYQKDADGLCCTLTKCYESPKSRLDYLDENVLNIKFEEIKL
GPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTFEFSLMAKLN
HPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFA
IDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDSRTNS
ENCNNNLNSNSKNHSSKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIP
VKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHL
LNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKSFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036028SH3-like_dom_sf
IPR000980SH2
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR001452SH3_domain
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 411..433
score: 64.87
coord: 455..477
score: 46.53
coord: 264..277
score: 52.26
coord: 392..402
score: 68.57
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 81..95
score: 47.74
coord: 112..123
score: 31.58
coord: 143..157
score: 34.94
coord: 100..110
score: 51.52
IPR000980SH2 domainSMARTSM00252SH2_5coord: 79..160
e-value: 1.3E-26
score: 104.5
IPR000980SH2 domainPFAMPF00017SH2coord: 81..154
e-value: 1.2E-18
score: 66.9
IPR000980SH2 domainPROSITEPS50001SH2coord: 81..173
score: 19.139
IPR001452SH3 domainSMARTSM00326SH3_2coord: 16..73
e-value: 9.5E-13
score: 58.4
IPR001452SH3 domainPFAMPF00018SH3_1coord: 19..66
e-value: 4.2E-11
score: 42.3
IPR001452SH3 domainPROSITEPS50002SH3coord: 13..74
score: 22.303
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 191..484
e-value: 1.2E-106
score: 370.2
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 279..344
e-value: 1.3E-12
score: 44.3
coord: 381..491
e-value: 3.9E-41
score: 138.8
coord: 188..287
e-value: 2.3E-7
score: 27.0
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 9..81
e-value: 2.6E-15
score: 57.6
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 184..360
e-value: 7.4E-43
score: 148.4
coord: 373..490
e-value: 6.8E-32
score: 112.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..363
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 26..343
coord: 381..490
NoneNo IPR availablePANTHERPTHR24418:SF399MEGAKARYOCYTE-ASSOCIATED TYROSINE-PROTEIN KINASEcoord: 26..343
coord: 381..490
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 194..481
e-value: 6.1E-44
score: 150.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 191..488
score: 39.184
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 82..172
e-value: 1.5E-26
score: 94.2
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 78..193
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 197..218
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 308..320
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 175..484
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 17..102