Acetyl-CoA carboxylase 1

Overview
NameAcetyl-CoA carboxylase 1
Smed IDSMED30017347
Length (bp)7478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetyl-CoA carboxylase 1 (SMED30017347) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetyl-CoA carboxylase 1 (SMED30017347) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetyl-CoA carboxylase 1 (SMED30017347) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetyl-CoA carboxylase 1 (SMED30017347) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017347

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017347SMESG000065082.1 Contig5150uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017347SMESG000065082.1 Contig5150uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017347SMESG000065082.1 Contig5150newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017347SMESG000065082.1 Contig5150newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017347SMESG000032321.1 Contig5150uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017347SMESG000032321.1 Contig5150uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017347SMESG000032321.1 Contig5150newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017347SMESG000032321.1 Contig5150newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30017347SMESG000065082.1 dd_Smed_v4_7598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017347SMESG000065082.1 dd_Smed_v4_7598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
whole organismSMED30017347SMESG000065082.1 Contig24203newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30017347SMESG000065082.1 Contig24203uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Human
Match: ACACA (acetyl-CoA carboxylase alpha [Source:HGNC Symbol;Acc:HGNC:84])

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 839/1157 (72.52%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P   + I+F +    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF MN IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  139 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNSF 1263          

HSP 2 Score: 1183.32 bits (3060), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 821/1180 (69.58%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  FS    ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   ++ GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M   +PEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ ++N GARIGLAEE +++F++AW+D  DP KG++YLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+GIG ENLR SGMIAGE+SLAY+EI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+   QPV VYIPP  ELRGG+WVV+D +IN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +T  +K L + L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV+S ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +A WLE Q+   ++  H  I + ++C  RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1264 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPE-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--TPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE-EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPS 2382          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Human
Match: ACACA (acetyl-CoA carboxylase alpha [Source:HGNC Symbol;Acc:HGNC:84])

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 839/1157 (72.52%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P   + I+F +    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF MN IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  139 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNSF 1263          

HSP 2 Score: 1183.32 bits (3060), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 821/1180 (69.58%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  FS    ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   ++ GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M   +PEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ ++N GARIGLAEE +++F++AW+D  DP KG++YLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+GIG ENLR SGMIAGE+SLAY+EI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+   QPV VYIPP  ELRGG+WVV+D +IN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +T  +K L + L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV+S ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +A WLE Q+   ++  H  I + ++C  RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1264 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPE-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--TPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE-EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPS 2382          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Human
Match: ACACA (acetyl-CoA carboxylase alpha [Source:HGNC Symbol;Acc:HGNC:84])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 839/1157 (72.52%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P   + I+F +    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF MN IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:   44 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNSF 1168          

HSP 2 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 821/1180 (69.58%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  FS    ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   ++ GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M   +PEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ ++N GARIGLAEE +++F++AW+D  DP KG++YLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+GIG ENLR SGMIAGE+SLAY+EI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+   QPV VYIPP  ELRGG+WVV+D +IN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +T  +K L + L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV+S ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +A WLE Q+   ++  H  I + ++C  RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1169 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPE-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--TPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE-EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPS 2287          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Human
Match: ACACA (acetyl-CoA carboxylase alpha [Source:HGNC Symbol;Acc:HGNC:84])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 839/1157 (72.52%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P   + I+F +    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF MN IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:   44 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNSF 1168          

HSP 2 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 821/1180 (69.58%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  FS    ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   ++ GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M   +PEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ ++N GARIGLAEE +++F++AW+D  DP KG++YLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+GIG ENLR SGMIAGE+SLAY+EI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+   QPV VYIPP  ELRGG+WVV+D +IN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +T  +K L + L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV+S ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +A WLE Q+   ++  H  I + ++C  RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1169 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPE-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--TPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE-EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPS 2287          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Human
Match: ACACA (acetyl-CoA carboxylase alpha [Source:HGNC Symbol;Acc:HGNC:84])

HSP 1 Score: 1293.87 bits (3347), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 839/1157 (72.52%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P   + I+F +    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF MN IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:   24 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNSF 1148          

HSP 2 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 821/1180 (69.58%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  FS    ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   ++ GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M   +PEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ ++N GARIGLAEE +++F++AW+D  DP KG++YLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+GIG ENLR SGMIAGE+SLAY+EI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+   QPV VYIPP  ELRGG+WVV+D +IN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +T  +K L + L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV+S ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +A WLE Q+   ++  H  I + ++C  RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1149 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPE-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--TPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE-EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPS 2267          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Celegans
Match: pod-2 (pep chromosome:WBcel235:II:1143908:1152699:1 gene:WBGene00004076.1 transcript:W09B6.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pod-2)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 316/726 (43.53%), Postives = 455/726 (62.67%), Query Frame = 2
Query:  230 INEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSD-KIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALE--RATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLY----DIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELY----KEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKV-QTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMEL 2371
            I+  V +    RPIK++L+A NGIAA++C+ + + + + TF++ + I FVCM T ++  + +E ++M +  +   P G+N+ N+ANVD IL  A++ +VDAVWAGWGHASENP LP  L  HNI FIGPP  AM+ LGDK+ASTIIAQ+  +PT+ WSG+G+T            +ES  R R    +               +P+DL  QACV++  E LE  +   IGFP+MIKASEGGGGKGIRK +  E+F+S+F +V  EV GSPIFLMK  + ARH+EVQ+LAD+Y   IS++ RDCS+QRR QKI+EEAP I+A   + + M++ A+ LA+ VGY SAGTVEYLY    + + + ++FLELNPRLQVEHP TE+V++I++PA QLQIAMG+PLH+IK+IR+LY      D  L +++  +          H IA RIT ENPD+ F+PS G + E+NF S++  W YFSV     +H+F+DSQFGH F+   +R +A   M  TLK M+IR  F T V YL+ ++    FI N  +T WLD  I+ K+ Q  S+  ++    +A  IG+ ++   F +++  I+R Q+     LT      L+ D   Y +++ ++    + +I+N + V   V +L +G  ++T+    Y    +E    Y+V ++N  ITFEK+ D SVL SP TGKL+Q+  EDG  +    VYA  E MK+  ++
Sbjct:   35 IHSHVADIEKRRPIKRLLVATNGIAAMRCLMTAKKFLHHTFRNDNLIHFVCMTTEDEIQSMSESLRMPNITLAESPSGTNKNNFANVDEILKHAIKYEVDAVWAGWGHASENPDLPRRLNDHNIAFIGPPASAMFSLGDKIASTIIAQTVGVPTVAWSGSGIT------------MESIERSRGDFVV---------------VPEDLLEQACVANYKEGLEALKTHNIGFPLMIKASEGGGGKGIRKCTKVEDFKSMFEEVAQEVQGSPIFLMKCVDGARHIEVQLLADRYENVISVYTRDCSIQRRCQKIIEEAPAIIASSHIRKSMQEDAVRLAKYVGYESAGTVEYLYLPASEGQEEHYYFLELNPRLQVEHPTTEMVSNISIPAIQLQIAMGLPLHKIKDIRKLYDLPIDGDSELPDEVLVDTKL-------HAIAARITCENPDDSFRPSTGKVYEINFPSSQDAWAYFSVGRGSSVHQFADSQFGHIFTRGTSRTEAMNTMCSTLKHMTIRSSFPTQVNYLVDLMHDADFINNAFNTQWLDKRIAMKIKQKCSLSMSVIIAVSAAVIGSSRVTGVFESFEESIDRGQVRPPNDLTETFIFDLVKDLNIYSLKVVRSAENTFVIILNGSKVTVGVKELQNGEFMVTHCEIVYRCAFEETKEAYKVTVNNEIITFEKDNDVSVLKSPYTGKLLQWKKEDGDWLNVGDVYATAESMKMVFQV 726          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Celegans
Match: pod-2 (pep chromosome:WBcel235:II:1143908:1152665:1 gene:WBGene00004076.1 transcript:W09B6.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pod-2)

HSP 1 Score: 609.757 bits (1571), Expect = 1.486e-180
Identity = 331/790 (41.90%), Postives = 481/790 (60.89%), Query Frame = 2
Query:  263 RPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSD-KIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALE--RATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLY----DIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELY----KEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKV-QTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTT-ASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDG 2593
            RPIK++L+A NGIAA++C+ + + + + TF++ + I FVCM T ++  + +E ++M +  +   P G+N+ N+ANVD IL  A++ +VDAVWAGWGHASENP LP  L  HNI FIGPP  AM+ LGDK+ASTIIAQ+  +PT+ WSG+G+T            +ES  R R    +               +P+DL  QACV++  E LE  +   IGFP+MIKASEGGGGKGIRK +  E+F+S+F +V  EV GSPIFLMK  + ARH+EVQ+LAD+Y   IS++ RDCS+QRR QKI+EEAP I+A   + + M++ A+ LA+ VGY SAGTVEYLY    + + + ++FLELNPRLQVEHP TE+V++I++PA QLQIAMG+PLH+IK+IR+LY      D  L +++  +          H IA RIT ENPD+ F+PS G + E+NF S++  W YFSV     +H+F+DSQFGH F+   +R +A   M  TLK M+IR  F T V YL+ ++    FI N  +T WLD  I+ K+ Q  S+  ++    +A  IG+ ++   F +++  I+R Q+     LT      L+ D   Y +++ ++    + +I+N + V   V +L +G  ++T+    Y    +E    Y+V ++N  ITFEK+ D SVL SP TGKL+Q+  EDG  +    VYA  E MK+  ++    A G +  +   G  +  G  +A L         RA+ F G+F   +  +S A     F+ C+ + + +L G
Sbjct:   46 RPIKRLLVATNGIAAMRCLMTAKKFLHHTFRNDNLIHFVCMTTEDEIQSMSESLRMPNITLAESPSGTNKNNFANVDEILKHAIKYEVDAVWAGWGHASENPDLPRRLNDHNIAFIGPPASAMFSLGDKIASTIIAQTVGVPTVAWSGSGIT------------MESIERSRGDFVV---------------VPEDLLEQACVANYKEGLEALKTHNIGFPLMIKASEGGGGKGIRKCTKVEDFKSMFEEVAQEVQGSPIFLMKCVDGARHIEVQLLADRYENVISVYTRDCSIQRRCQKIIEEAPAIIASSHIRKSMQEDAVRLAKYVGYESAGTVEYLYLPASEGQEEHYYFLELNPRLQVEHPTTEMVSNISIPAIQLQIAMGLPLHKIKDIRKLYDLPIDGDSELPDEVLVDTKL-------HAIAARITCENPDDSFRPSTGKVYEINFPSSQDAWAYFSVGRGSSVHQFADSQFGHIFTRGTSRTEAMNTMCSTLKHMTIRSSFPTQVNYLVDLMHDADFINNAFNTQWLDKRIAMKIKQKCSLSMSVIIAVSAAVIGSSRVTGVFESFEESIDRGQVRPPNDLTETFIFDLVKDLNIYSLKVVRSAENTFVIILNGSKVTVGVKELQNGEFMVTHCEIVYRCAFEETKEAYKVTVNNEIITFEKDNDVSVLKSPYTGKLLQWKKEDGDWLNVGDVYATAESMKMVFQVEVAKAPGRLQRVVNEGDPIHPGSVLAKLVDQTESEADRAQPFHGTFLEWSWHSSKANEQSKFNDCLAQCQNLLAG 801          

HSP 2 Score: 473.011 bits (1216), Expect = 3.333e-135
Identity = 273/670 (40.75%), Postives = 387/670 (57.76%), Query Frame = 2
Query: 4934 YQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM---------ELLTYIELILDD-------NNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDE-GENRYKITDIIG-KEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRL 6889
            Y   + ++ KR  A   N++Y+YD+P +   A    W   +  + L N            E     EL+L++       + +I++ +    +NN GMVAW M L TPE P  G ++I+I NDVT++ GSF   ED LF  AS  +R+  +PR+  + N GARIGL+ +   +  +   ++  PE+GF+Y+Y+      Q+ G      E++ +E G  R KI  +IG K + IGVENL+ SG+IAGET+ AY E+ T   V+ R+VGIGAY  RL  R++Q + SH+ILTG  ALN +LG  VYTSN+QLGG ++M  NGV+HAVV ++L+GI  +++W+S++P+      P F  +    D   R V        +  D R LI      N    +G+ D  S+ EI   WA+S+V GRARL GIPI V+++E RN    +PADPA   ++ Q  Q AGQVW+P SA+KTA+A+ D N+E LPL I A+ RGFSGG  DMYD +LKFG+ IVD L  Y +PV VYIP  GELRGGAW VLD  I  +++ + AD + S GGILEP  +V IK+R+  +++ +KR DP      S+L S      + Q      L  R ++L   Y   ++ FA  HD   RM + GV+  +    +SRR F   LR  L
Sbjct: 1322 YPVINTIEKKRLAARRVNSSYIYDFPIIFGMAAMNFWKSASSAMELPNEMAQALKEQRWREFFQIRELVLENGVLTEISDAEILKKRSANALNNCGMVAWIMTLYTPEKPR-GFDLIVIGNDVTFQSGSFGTAEDDLFAAASTYSREHKLPRVNVSVNSGARIGLSTKISKLVKLQLENEDKPEQGFEYIYIDGEHKAQIEG------EVVYEELGNGRLKILAVIGAKNEKIGVENLQGSGLIAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHLILTGYEALNTLLGKKVYTSNNQLGGPEVMFRNGVTHAVVDNDLEGIAKVIRWMSFLPT-PTEEFPFFSKHG--DDCSARDVVIPSDSEQNTYDVRDLIDSKNLSNQ---TGICDTMSFDEICGDWAKSIVAGRARLCGIPIGVVSSEFRNFSTIVPADPAIDGSQVQNTQRAGQVWYPDSAFKTAEAINDLNKENLPLMIIASLRGFSGGQKDMYDMVLKFGAQIVDALAVYNRPVIVYIPEAGELRGGAWAVLDSKIRPEFIHLVADEK-SRGGILEPNAVVGIKFRKPMMMEMMKRSDP----TYSKLSSSTEPEAREQ------LEERYEELSKTYRNASVEFADAHDRWQRMKSVGVVEHVTSLTNSRRLFSELLRNEL 1967          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Celegans
Match: pod-2 (pep chromosome:WBcel235:II:1143908:1152699:1 gene:WBGene00004076.1 transcript:W09B6.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pod-2)

HSP 1 Score: 609.757 bits (1571), Expect = 1.486e-180
Identity = 331/790 (41.90%), Postives = 481/790 (60.89%), Query Frame = 2
Query:  263 RPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSD-KIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALE--RATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLY----DIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELY----KEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKV-QTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTT-ASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDG 2593
            RPIK++L+A NGIAA++C+ + + + + TF++ + I FVCM T ++  + +E ++M +  +   P G+N+ N+ANVD IL  A++ +VDAVWAGWGHASENP LP  L  HNI FIGPP  AM+ LGDK+ASTIIAQ+  +PT+ WSG+G+T            +ES  R R    +               +P+DL  QACV++  E LE  +   IGFP+MIKASEGGGGKGIRK +  E+F+S+F +V  EV GSPIFLMK  + ARH+EVQ+LAD+Y   IS++ RDCS+QRR QKI+EEAP I+A   + + M++ A+ LA+ VGY SAGTVEYLY    + + + ++FLELNPRLQVEHP TE+V++I++PA QLQIAMG+PLH+IK+IR+LY      D  L +++  +          H IA RIT ENPD+ F+PS G + E+NF S++  W YFSV     +H+F+DSQFGH F+   +R +A   M  TLK M+IR  F T V YL+ ++    FI N  +T WLD  I+ K+ Q  S+  ++    +A  IG+ ++   F +++  I+R Q+     LT      L+ D   Y +++ ++    + +I+N + V   V +L +G  ++T+    Y    +E    Y+V ++N  ITFEK+ D SVL SP TGKL+Q+  EDG  +    VYA  E MK+  ++    A G +  +   G  +  G  +A L         RA+ F G+F   +  +S A     F+ C+ + + +L G
Sbjct:   46 RPIKRLLVATNGIAAMRCLMTAKKFLHHTFRNDNLIHFVCMTTEDEIQSMSESLRMPNITLAESPSGTNKNNFANVDEILKHAIKYEVDAVWAGWGHASENPDLPRRLNDHNIAFIGPPASAMFSLGDKIASTIIAQTVGVPTVAWSGSGIT------------MESIERSRGDFVV---------------VPEDLLEQACVANYKEGLEALKTHNIGFPLMIKASEGGGGKGIRKCTKVEDFKSMFEEVAQEVQGSPIFLMKCVDGARHIEVQLLADRYENVISVYTRDCSIQRRCQKIIEEAPAIIASSHIRKSMQEDAVRLAKYVGYESAGTVEYLYLPASEGQEEHYYFLELNPRLQVEHPTTEMVSNISIPAIQLQIAMGLPLHKIKDIRKLYDLPIDGDSELPDEVLVDTKL-------HAIAARITCENPDDSFRPSTGKVYEINFPSSQDAWAYFSVGRGSSVHQFADSQFGHIFTRGTSRTEAMNTMCSTLKHMTIRSSFPTQVNYLVDLMHDADFINNAFNTQWLDKRIAMKIKQKCSLSMSVIIAVSAAVIGSSRVTGVFESFEESIDRGQVRPPNDLTETFIFDLVKDLNIYSLKVVRSAENTFVIILNGSKVTVGVKELQNGEFMVTHCEIVYRCAFEETKEAYKVTVNNEIITFEKDNDVSVLKSPYTGKLLQWKKEDGDWLNVGDVYATAESMKMVFQVEVAKAPGRLQRVVNEGDPIHPGSVLAKLVDQTESEADRAQPFHGTFLEWSWHSSKANEQSKFNDCLAQCQNLLAG 801          

HSP 2 Score: 473.011 bits (1216), Expect = 3.333e-135
Identity = 273/670 (40.75%), Postives = 387/670 (57.76%), Query Frame = 2
Query: 4934 YQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM---------ELLTYIELILDD-------NNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDE-GENRYKITDIIG-KEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRL 6889
            Y   + ++ KR  A   N++Y+YD+P +   A    W   +  + L N            E     EL+L++       + +I++ +    +NN GMVAW M L TPE P  G ++I+I NDVT++ GSF   ED LF  AS  +R+  +PR+  + N GARIGL+ +   +  +   ++  PE+GF+Y+Y+      Q+ G      E++ +E G  R KI  +IG K + IGVENL+ SG+IAGET+ AY E+ T   V+ R+VGIGAY  RL  R++Q + SH+ILTG  ALN +LG  VYTSN+QLGG ++M  NGV+HAVV ++L+GI  +++W+S++P+      P F  +    D   R V        +  D R LI      N    +G+ D  S+ EI   WA+S+V GRARL GIPI V+++E RN    +PADPA   ++ Q  Q AGQVW+P SA+KTA+A+ D N+E LPL I A+ RGFSGG  DMYD +LKFG+ IVD L  Y +PV VYIP  GELRGGAW VLD  I  +++ + AD + S GGILEP  +V IK+R+  +++ +KR DP      S+L S      + Q      L  R ++L   Y   ++ FA  HD   RM + GV+  +    +SRR F   LR  L
Sbjct: 1322 YPVINTIEKKRLAARRVNSSYIYDFPIIFGMAAMNFWKSASSAMELPNEMAQALKEQRWREFFQIRELVLENGVLTEISDAEILKKRSANALNNCGMVAWIMTLYTPEKPR-GFDLIVIGNDVTFQSGSFGTAEDDLFAAASTYSREHKLPRVNVSVNSGARIGLSTKISKLVKLQLENEDKPEQGFEYIYIDGEHKAQIEG------EVVYEELGNGRLKILAVIGAKNEKIGVENLQGSGLIAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHLILTGYEALNTLLGKKVYTSNNQLGGPEVMFRNGVTHAVVDNDLEGIAKVIRWMSFLPT-PTEEFPFFSKHG--DDCSARDVVIPSDSEQNTYDVRDLIDSKNLSNQ---TGICDTMSFDEICGDWAKSIVAGRARLCGIPIGVVSSEFRNFSTIVPADPAIDGSQVQNTQRAGQVWYPDSAFKTAEAINDLNKENLPLMIIASLRGFSGGQKDMYDMVLKFGAQIVDALAVYNRPVIVYIPEAGELRGGAWAVLDSKIRPEFIHLVADEK-SRGGILEPNAVVGIKFRKPMMMEMMKRSDP----TYSKLSSSTEPEAREQ------LEERYEELSKTYRNASVEFADAHDRWQRMKSVGVVEHVTSLTNSRRLFSELLRNEL 1967          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Celegans
Match: pod-2 (pep chromosome:WBcel235:II:1136801:1152665:1 gene:WBGene00004076.1 transcript:W09B6.1c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pod-2)

HSP 1 Score: 609.372 bits (1570), Expect = 7.798e-180
Identity = 331/790 (41.90%), Postives = 481/790 (60.89%), Query Frame = 2
Query:  263 RPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSD-KIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALE--RATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLY----DIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELY----KEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKV-QTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTT-ASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDG 2593
            RPIK++L+A NGIAA++C+ + + + + TF++ + I FVCM T ++  + +E ++M +  +   P G+N+ N+ANVD IL  A++ +VDAVWAGWGHASENP LP  L  HNI FIGPP  AM+ LGDK+ASTIIAQ+  +PT+ WSG+G+T            +ES  R R    +               +P+DL  QACV++  E LE  +   IGFP+MIKASEGGGGKGIRK +  E+F+S+F +V  EV GSPIFLMK  + ARH+EVQ+LAD+Y   IS++ RDCS+QRR QKI+EEAP I+A   + + M++ A+ LA+ VGY SAGTVEYLY    + + + ++FLELNPRLQVEHP TE+V++I++PA QLQIAMG+PLH+IK+IR+LY      D  L +++  +          H IA RIT ENPD+ F+PS G + E+NF S++  W YFSV     +H+F+DSQFGH F+   +R +A   M  TLK M+IR  F T V YL+ ++    FI N  +T WLD  I+ K+ Q  S+  ++    +A  IG+ ++   F +++  I+R Q+     LT      L+ D   Y +++ ++    + +I+N + V   V +L +G  ++T+    Y    +E    Y+V ++N  ITFEK+ D SVL SP TGKL+Q+  EDG  +    VYA  E MK+  ++    A G +  +   G  +  G  +A L         RA+ F G+F   +  +S A     F+ C+ + + +L G
Sbjct:  157 RPIKRLLVATNGIAAMRCLMTAKKFLHHTFRNDNLIHFVCMTTEDEIQSMSESLRMPNITLAESPSGTNKNNFANVDEILKHAIKYEVDAVWAGWGHASENPDLPRRLNDHNIAFIGPPASAMFSLGDKIASTIIAQTVGVPTVAWSGSGIT------------MESIERSRGDFVV---------------VPEDLLEQACVANYKEGLEALKTHNIGFPLMIKASEGGGGKGIRKCTKVEDFKSMFEEVAQEVQGSPIFLMKCVDGARHIEVQLLADRYENVISVYTRDCSIQRRCQKIIEEAPAIIASSHIRKSMQEDAVRLAKYVGYESAGTVEYLYLPASEGQEEHYYFLELNPRLQVEHPTTEMVSNISIPAIQLQIAMGLPLHKIKDIRKLYDLPIDGDSELPDEVLVDTKL-------HAIAARITCENPDDSFRPSTGKVYEINFPSSQDAWAYFSVGRGSSVHQFADSQFGHIFTRGTSRTEAMNTMCSTLKHMTIRSSFPTQVNYLVDLMHDADFINNAFNTQWLDKRIAMKIKQKCSLSMSVIIAVSAAVIGSSRVTGVFESFEESIDRGQVRPPNDLTETFIFDLVKDLNIYSLKVVRSAENTFVIILNGSKVTVGVKELQNGEFMVTHCEIVYRCAFEETKEAYKVTVNNEIITFEKDNDVSVLKSPYTGKLLQWKKEDGDWLNVGDVYATAESMKMVFQVEVAKAPGRLQRVVNEGDPIHPGSVLAKLVDQTESEADRAQPFHGTFLEWSWHSSKANEQSKFNDCLAQCQNLLAG 912          

HSP 2 Score: 473.011 bits (1216), Expect = 7.205e-135
Identity = 273/670 (40.75%), Postives = 387/670 (57.76%), Query Frame = 2
Query: 4934 YQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM---------ELLTYIELILDD-------NNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDE-GENRYKITDIIG-KEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRL 6889
            Y   + ++ KR  A   N++Y+YD+P +   A    W   +  + L N            E     EL+L++       + +I++ +    +NN GMVAW M L TPE P  G ++I+I NDVT++ GSF   ED LF  AS  +R+  +PR+  + N GARIGL+ +   +  +   ++  PE+GF+Y+Y+      Q+ G      E++ +E G  R KI  +IG K + IGVENL+ SG+IAGET+ AY E+ T   V+ R+VGIGAY  RL  R++Q + SH+ILTG  ALN +LG  VYTSN+QLGG ++M  NGV+HAVV ++L+GI  +++W+S++P+      P F  +    D   R V        +  D R LI      N    +G+ D  S+ EI   WA+S+V GRARL GIPI V+++E RN    +PADPA   ++ Q  Q AGQVW+P SA+KTA+A+ D N+E LPL I A+ RGFSGG  DMYD +LKFG+ IVD L  Y +PV VYIP  GELRGGAW VLD  I  +++ + AD + S GGILEP  +V IK+R+  +++ +KR DP      S+L S      + Q      L  R ++L   Y   ++ FA  HD   RM + GV+  +    +SRR F   LR  L
Sbjct: 1433 YPVINTIEKKRLAARRVNSSYIYDFPIIFGMAAMNFWKSASSAMELPNEMAQALKEQRWREFFQIRELVLENGVLTEISDAEILKKRSANALNNCGMVAWIMTLYTPEKPR-GFDLIVIGNDVTFQSGSFGTAEDDLFAAASTYSREHKLPRVNVSVNSGARIGLSTKISKLVKLQLENEDKPEQGFEYIYIDGEHKAQIEG------EVVYEELGNGRLKILAVIGAKNEKIGVENLQGSGLIAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHLILTGYEALNTLLGKKVYTSNNQLGGPEVMFRNGVTHAVVDNDLEGIAKVIRWMSFLPT-PTEEFPFFSKHG--DDCSARDVVIPSDSEQNTYDVRDLIDSKNLSNQ---TGICDTMSFDEICGDWAKSIVAGRARLCGIPIGVVSSEFRNFSTIVPADPAIDGSQVQNTQRAGQVWYPDSAFKTAEAINDLNKENLPLMIIASLRGFSGGQKDMYDMVLKFGAQIVDALAVYNRPVIVYIPEAGELRGGAWAVLDSKIRPEFIHLVAD-EKSRGGILEPNAVVGIKFRKPMMMEMMKRSDP----TYSKLSSSTEPEAREQ------LEERYEELSKTYRNASVEFADAHDRWQRMKSVGVVEHVTSLTNSRRLFSELLRNEL 2078          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Celegans
Match: pod-2 (pep chromosome:WBcel235:II:1136781:1152701:1 gene:WBGene00004076.1 transcript:W09B6.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pod-2)

HSP 1 Score: 609.372 bits (1570), Expect = 7.798e-180
Identity = 331/790 (41.90%), Postives = 481/790 (60.89%), Query Frame = 2
Query:  263 RPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSD-KIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALE--RATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLY----DIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELY----KEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKV-QTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTT-ASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDG 2593
            RPIK++L+A NGIAA++C+ + + + + TF++ + I FVCM T ++  + +E ++M +  +   P G+N+ N+ANVD IL  A++ +VDAVWAGWGHASENP LP  L  HNI FIGPP  AM+ LGDK+ASTIIAQ+  +PT+ WSG+G+T            +ES  R R    +               +P+DL  QACV++  E LE  +   IGFP+MIKASEGGGGKGIRK +  E+F+S+F +V  EV GSPIFLMK  + ARH+EVQ+LAD+Y   IS++ RDCS+QRR QKI+EEAP I+A   + + M++ A+ LA+ VGY SAGTVEYLY    + + + ++FLELNPRLQVEHP TE+V++I++PA QLQIAMG+PLH+IK+IR+LY      D  L +++  +          H IA RIT ENPD+ F+PS G + E+NF S++  W YFSV     +H+F+DSQFGH F+   +R +A   M  TLK M+IR  F T V YL+ ++    FI N  +T WLD  I+ K+ Q  S+  ++    +A  IG+ ++   F +++  I+R Q+     LT      L+ D   Y +++ ++    + +I+N + V   V +L +G  ++T+    Y    +E    Y+V ++N  ITFEK+ D SVL SP TGKL+Q+  EDG  +    VYA  E MK+  ++    A G +  +   G  +  G  +A L         RA+ F G+F   +  +S A     F+ C+ + + +L G
Sbjct:  157 RPIKRLLVATNGIAAMRCLMTAKKFLHHTFRNDNLIHFVCMTTEDEIQSMSESLRMPNITLAESPSGTNKNNFANVDEILKHAIKYEVDAVWAGWGHASENPDLPRRLNDHNIAFIGPPASAMFSLGDKIASTIIAQTVGVPTVAWSGSGIT------------MESIERSRGDFVV---------------VPEDLLEQACVANYKEGLEALKTHNIGFPLMIKASEGGGGKGIRKCTKVEDFKSMFEEVAQEVQGSPIFLMKCVDGARHIEVQLLADRYENVISVYTRDCSIQRRCQKIIEEAPAIIASSHIRKSMQEDAVRLAKYVGYESAGTVEYLYLPASEGQEEHYYFLELNPRLQVEHPTTEMVSNISIPAIQLQIAMGLPLHKIKDIRKLYDLPIDGDSELPDEVLVDTKL-------HAIAARITCENPDDSFRPSTGKVYEINFPSSQDAWAYFSVGRGSSVHQFADSQFGHIFTRGTSRTEAMNTMCSTLKHMTIRSSFPTQVNYLVDLMHDADFINNAFNTQWLDKRIAMKIKQKCSLSMSVIIAVSAAVIGSSRVTGVFESFEESIDRGQVRPPNDLTETFIFDLVKDLNIYSLKVVRSAENTFVIILNGSKVTVGVKELQNGEFMVTHCEIVYRCAFEETKEAYKVTVNNEIITFEKDNDVSVLKSPYTGKLLQWKKEDGDWLNVGDVYATAESMKMVFQVEVAKAPGRLQRVVNEGDPIHPGSVLAKLVDQTESEADRAQPFHGTFLEWSWHSSKANEQSKFNDCLAQCQNLLAG 912          

HSP 2 Score: 473.011 bits (1216), Expect = 7.205e-135
Identity = 273/670 (40.75%), Postives = 387/670 (57.76%), Query Frame = 2
Query: 4934 YQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM---------ELLTYIELILDD-------NNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDE-GENRYKITDIIG-KEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRL 6889
            Y   + ++ KR  A   N++Y+YD+P +   A    W   +  + L N            E     EL+L++       + +I++ +    +NN GMVAW M L TPE P  G ++I+I NDVT++ GSF   ED LF  AS  +R+  +PR+  + N GARIGL+ +   +  +   ++  PE+GF+Y+Y+      Q+ G      E++ +E G  R KI  +IG K + IGVENL+ SG+IAGET+ AY E+ T   V+ R+VGIGAY  RL  R++Q + SH+ILTG  ALN +LG  VYTSN+QLGG ++M  NGV+HAVV ++L+GI  +++W+S++P+      P F  +    D   R V        +  D R LI      N    +G+ D  S+ EI   WA+S+V GRARL GIPI V+++E RN    +PADPA   ++ Q  Q AGQVW+P SA+KTA+A+ D N+E LPL I A+ RGFSGG  DMYD +LKFG+ IVD L  Y +PV VYIP  GELRGGAW VLD  I  +++ + AD + S GGILEP  +V IK+R+  +++ +KR DP      S+L S      + Q      L  R ++L   Y   ++ FA  HD   RM + GV+  +    +SRR F   LR  L
Sbjct: 1433 YPVINTIEKKRLAARRVNSSYIYDFPIIFGMAAMNFWKSASSAMELPNEMAQALKEQRWREFFQIRELVLENGVLTEISDAEILKKRSANALNNCGMVAWIMTLYTPEKPR-GFDLIVIGNDVTFQSGSFGTAEDDLFAAASTYSREHKLPRVNVSVNSGARIGLSTKISKLVKLQLENEDKPEQGFEYIYIDGEHKAQIEG------EVVYEELGNGRLKILAVIGAKNEKIGVENLQGSGLIAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHLILTGYEALNTLLGKKVYTSNNQLGGPEVMFRNGVTHAVVDNDLEGIAKVIRWMSFLPT-PTEEFPFFSKHG--DDCSARDVVIPSDSEQNTYDVRDLIDSKNLSNQ---TGICDTMSFDEICGDWAKSIVAGRARLCGIPIGVVSSEFRNFSTIVPADPAIDGSQVQNTQRAGQVWYPDSAFKTAEAINDLNKENLPLMIIASLRGFSGGQKDMYDMVLKFGAQIVDALAVYNRPVIVYIPEAGELRGGAWAVLDSKIRPEFIHLVAD-EKSRGGILEPNAVVGIKFRKPMMMEMMKRSDP----TYSKLSSSTEPEAREQ------LEERYEELSKTYRNASVEFADAHDRWQRMKSVGVVEHVTSLTNSRRLFSELLRNEL 2078          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0088871)

HSP 1 Score: 1316.6 bits (3406), Expect = 0.000e+0
Identity = 638/1128 (56.56%), Postives = 823/1128 (72.96%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASID 3601
            +A+  EFV   GG R I K+LIANNGIAAVKC+RSIR WAYE FK++ AIRFV MVTPED  ANAEYIKM+D    VPGGSN  NYANV+LI+D+ALRT+V AVWAGWGHASENPKLPE+L+K  ++F+GPP  AMW LGDKVAS+I+AQ+  IPTLPWSG+ L                                Y+ +KI   I  +L+ + CV++  + L    +IGFP+MIKASEGGGGKGIR+  ++E F  LF QVQ EVPGSPIF+MK A  ARHLEVQ+LADQYG AISLFGRDCS+QRRHQKI+EEAP IVA  EVFE MEKAA+ LA++VGYVSAGTVEYLYD +  ++FFLELNPRLQVEHPCTE+V D+NLPA+QLQI MGIPL+R+K+IR LY E P   + I+F NP  KPRP+GHVIA RITSENPDEGFKPS G ++ELNF+S+++VWGYFSV++ GG+HEF+DSQFGHCFS+ E R++AREN+V+ LKE+SIRGDFRTTVEYLI +LE+  F+ N IDT WLD +I+++VQ++  D  L  MC ++HI + ++  SFS++Q  +E+ QI  +  LTN+VDV LI+D ++Y++Q  K+G  +Y L+MN++  E EVH+L DG LLI+    SYTTY+KEE+  YR++I N T  FEKE DPS+L SPS GKL+   VEDG+HV     YA +EVMK+ M L +  +G + +++RPGA+LDAG  +  L LDD   + +A+ F G F          KLN+V +     LE  L GYCLPEP+   +L+  + +FM  LRDP LPL+ELQE+++ ISGRIP +VE+ I++ M++Y  N+TSVL+QFP  +I  ++ +   +L K++++D + + TQ I  LV +Y  G+RG MK A+  L  +YY+VE  FQ GH+DKCV ++ E  KD  Q ++N IFSH  VA KN L+ LLIDHL  NE GL  +L + L   T+LN++E+S+V+LRSRQVLIAA  PAYE+RHNQ+ESIFLSA+D YGH F PENL+RLILSET +FDI+ DFFYH N  V +AALEVYVRRAY +YELTC+   +L  G  +V F+FLLP+ HP+R    +  P  +D
Sbjct:  244 IATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLK-----------------------------AQYSGKKI--KISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEG-RYFFLELNPRLQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLD 1339          

HSP 2 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 550/1004 (54.78%), Postives = 717/1004 (71.41%), Query Frame = 2
Query: 3935 RMGAMAAFKTMDEFEEVFDEIMDHFS--------------------SIQEENDQNTV-VTFQDPPYCSTNIKE----EPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYN---PELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITG-VTDVNG-EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSD-LNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADS 6853
            R GA+AAF + + FE   DEI+D                       SI +     ++ V+  DP   +   +E    EPIHI +VA RE   ++D    +I  ++C    +   +R IRR+TF       FP++FTFRA++ F EDRIYRHLEPA AF LE+NRM+ YDLE +P  N++MHLYL KAKVS+GQEVTDYRFF+RSIIRH+DL+TKEASFEY+ NE ER LLE++D LE+A +HP A+RT+CNHIFLNF PT+ + D  ++EE+V +M+MRYG RLWKLRV QAELKM++R S Q     +R+ +AN+ GY L+ISMY E  +  TG I+F+++G  K+G LHG  +  PY TKD LQ KRFQA +  TTYVYD P +  Q  E  W E++   P + +  PD  L+   EL+L+ +N +VE+Q++PG NN GMVAWR+ L TPEYP  GREII+I+ND+TY +GSF I ED+LF KAS+LAR+L +PRI+ + N GARIGLAEE K +F IAW D  +P+KGFKYLYL+  DY Q+  LN+V   LIEDEGE RYKITDIIGK+DG+GVENLR +G+IAGETS AY+EIVTI++V+ R +GIG+Y+VRLG RVIQ++NSHIILTG AALNK+LG  VY SN+QLGG QIM NNGV+H   A +L G+  +L WLSYIP+     LP+ L N    D I RPV +MP K  S  DPR ++ G V  VN  ++ +G FD+DSW EI+  WA++VVTGRARLGG+P+ VI  ETR V   +PADPAN  +E + +Q AGQVW+P S+YKTAQA++DF RE LPL +FANWRGFSGGM DMY+QI+KFG+YIVD L+ Y +PV +Y+PP+ ELRGGAW VLD  IN  YME +ADP+ + GG+LEPEGIVEIKY+EKDL+KTI RLDP  ++++ EL   ++   +++ + + + + ARI  L+ +YH +A+ FA LHDTP RM  K  +S ++PW DS
Sbjct: 1352 RTGAIAAFDSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIM-DPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGE-KQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDN-LVEMQRLPGENNCGMVAWRIVLATPEYP-NGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPN----DRIERPVDFMPTK--SPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPE-ARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVPWRDS 2344          

HSP 3 Score: 55.8398 bits (133), Expect = 7.478e-7
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 7088 LLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQEL 7330
            +L+RW VE++GA ++YLW  +  + +W E QI+     +   +   +   RRD  +S I K++   PD+ ++ ++ + Q L
Sbjct: 2380 MLRRWLVEEKGATEAYLWDKNEEMVSWYEEQIN-----AESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGL 2455          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0339124)

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 638/1128 (56.56%), Postives = 823/1128 (72.96%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASID 3601
            +A+  EFV   GG R I K+LIANNGIAAVKC+RSIR WAYE FK++ AIRFV MVTPED  ANAEYIKM+D    VPGGSN  NYANV+LI+D+ALRT+V AVWAGWGHASENPKLPE+L+K  ++F+GPP  AMW LGDKVAS+I+AQ+  IPTLPWSG+ L                                Y+ +KI   I  +L+ + CV++  + L    +IGFP+MIKASEGGGGKGIR+  ++E F  LF QVQ EVPGSPIF+MK A  ARHLEVQ+LADQYG AISLFGRDCS+QRRHQKI+EEAP IVA  EVFE MEKAA+ LA++VGYVSAGTVEYLYD +  ++FFLELNPRLQVEHPCTE+V D+NLPA+QLQI MGIPL+R+K+IR LY E P   + I+F NP  KPRP+GHVIA RITSENPDEGFKPS G ++ELNF+S+++VWGYFSV++ GG+HEF+DSQFGHCFS+ E R++AREN+V+ LKE+SIRGDFRTTVEYLI +LE+  F+ N IDT WLD +I+++VQ++  D  L  MC ++HI + ++  SFS++Q  +E+ QI  +  LTN+VDV LI+D ++Y++Q  K+G  +Y L+MN++  E EVH+L DG LLI+    SYTTY+KEE+  YR++I N T  FEKE DPS+L SPS GKL+   VEDG+HV     YA +EVMK+ M L +  +G + +++RPGA+LDAG  +  L LDD   + +A+ F G F          KLN+V +     LE  L GYCLPEP+   +L+  + +FM  LRDP LPL+ELQE+++ ISGRIP +VE+ I++ M++Y  N+TSVL+QFP  +I  ++ +   +L K++++D + + TQ I  LV +Y  G+RG MK A+  L  +YY+VE  FQ GH+DKCV ++ E  KD  Q ++N IFSH  VA KN L+ LLIDHL  NE GL  +L + L   T+LN++E+S+V+LRSRQVLIAA  PAYE+RHNQ+ESIFLSA+D YGH F PENL+RLILSET +FDI+ DFFYH N  V +AALEVYVRRAY +YELTC+   +L  G  +V F+FLLP+ HP+R    +  P  +D
Sbjct:   85 IATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLK-----------------------------AQYSGKKI--KISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEG-RYFFLELNPRLQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLD 1180          

HSP 2 Score: 1088.95 bits (2815), Expect = 0.000e+0
Identity = 550/1004 (54.78%), Postives = 717/1004 (71.41%), Query Frame = 2
Query: 3935 RMGAMAAFKTMDEFEEVFDEIMDHFS--------------------SIQEENDQNTV-VTFQDPPYCSTNIKE----EPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYN---PELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITG-VTDVNG-EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSD-LNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADS 6853
            R GA+AAF + + FE   DEI+D                       SI +     ++ V+  DP   +   +E    EPIHI +VA RE   ++D    +I  ++C    +   +R IRR+TF       FP++FTFRA++ F EDRIYRHLEPA AF LE+NRM+ YDLE +P  N++MHLYL KAKVS+GQEVTDYRFF+RSIIRH+DL+TKEASFEY+ NE ER LLE++D LE+A +HP A+RT+CNHIFLNF PT+ + D  ++EE+V +M+MRYG RLWKLRV QAELKM++R S Q     +R+ +AN+ GY L+ISMY E  +  TG I+F+++G  K+G LHG  +  PY TKD LQ KRFQA +  TTYVYD P +  Q  E  W E++   P + +  PD  L+   EL+L+ +N +VE+Q++PG NN GMVAWR+ L TPEYP  GREII+I+ND+TY +GSF I ED+LF KAS+LAR+L +PRI+ + N GARIGLAEE K +F IAW D  +P+KGFKYLYL+  DY Q+  LN+V   LIEDEGE RYKITDIIGK+DG+GVENLR +G+IAGETS AY+EIVTI++V+ R +GIG+Y+VRLG RVIQ++NSHIILTG AALNK+LG  VY SN+QLGG QIM NNGV+H   A +L G+  +L WLSYIP+     LP+ L N    D I RPV +MP K  S  DPR ++ G V  VN  ++ +G FD+DSW EI+  WA++VVTGRARLGG+P+ VI  ETR V   +PADPAN  +E + +Q AGQVW+P S+YKTAQA++DF RE LPL +FANWRGFSGGM DMY+QI+KFG+YIVD L+ Y +PV +Y+PP+ ELRGGAW VLD  IN  YME +ADP+ + GG+LEPEGIVEIKY+EKDL+KTI RLDP  ++++ EL   ++   +++ + + + + ARI  L+ +YH +A+ FA LHDTP RM  K  +S ++PW DS
Sbjct: 1193 RTGAIAAFDSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIM-DPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGE-KQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDN-LVEMQRLPGENNCGMVAWRIVLATPEYP-NGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPN----DRIERPVDFMPTK--SPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPE-ARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVPWRDS 2185          

HSP 3 Score: 55.8398 bits (133), Expect = 7.490e-7
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 7088 LLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQEL 7330
            +L+RW VE++GA ++YLW  +  + +W E QI+     +   +   +   RRD  +S I K++   PD+ ++ ++ + Q L
Sbjct: 2221 MLRRWLVEEKGATEAYLWDKNEEMVSWYEEQIN-----AESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGL 2296          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0339125)

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 638/1128 (56.56%), Postives = 823/1128 (72.96%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASID 3601
            +A+  EFV   GG R I K+LIANNGIAAVKC+RSIR WAYE FK++ AIRFV MVTPED  ANAEYIKM+D    VPGGSN  NYANV+LI+D+ALRT+V AVWAGWGHASENPKLPE+L+K  ++F+GPP  AMW LGDKVAS+I+AQ+  IPTLPWSG+ L                                Y+ +KI   I  +L+ + CV++  + L    +IGFP+MIKASEGGGGKGIR+  ++E F  LF QVQ EVPGSPIF+MK A  ARHLEVQ+LADQYG AISLFGRDCS+QRRHQKI+EEAP IVA  EVFE MEKAA+ LA++VGYVSAGTVEYLYD +  ++FFLELNPRLQVEHPCTE+V D+NLPA+QLQI MGIPL+R+K+IR LY E P   + I+F NP  KPRP+GHVIA RITSENPDEGFKPS G ++ELNF+S+++VWGYFSV++ GG+HEF+DSQFGHCFS+ E R++AREN+V+ LKE+SIRGDFRTTVEYLI +LE+  F+ N IDT WLD +I+++VQ++  D  L  MC ++HI + ++  SFS++Q  +E+ QI  +  LTN+VDV LI+D ++Y++Q  K+G  +Y L+MN++  E EVH+L DG LLI+    SYTTY+KEE+  YR++I N T  FEKE DPS+L SPS GKL+   VEDG+HV     YA +EVMK+ M L +  +G + +++RPGA+LDAG  +  L LDD   + +A+ F G F          KLN+V +     LE  L GYCLPEP+   +L+  + +FM  LRDP LPL+ELQE+++ ISGRIP +VE+ I++ M++Y  N+TSVL+QFP  +I  ++ +   +L K++++D + + TQ I  LV +Y  G+RG MK A+  L  +YY+VE  FQ GH+DKCV ++ E  KD  Q ++N IFSH  VA KN L+ LLIDHL  NE GL  +L + L   T+LN++E+S+V+LRSRQVLIAA  PAYE+RHNQ+ESIFLSA+D YGH F PENL+RLILSET +FDI+ DFFYH N  V +AALEVYVRRAY +YELTC+   +L  G  +V F+FLLP+ HP+R    +  P  +D
Sbjct:   85 IATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLK-----------------------------AQYSGKKI--KISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEG-RYFFLELNPRLQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLD 1180          

HSP 2 Score: 1088.95 bits (2815), Expect = 0.000e+0
Identity = 550/1004 (54.78%), Postives = 717/1004 (71.41%), Query Frame = 2
Query: 3935 RMGAMAAFKTMDEFEEVFDEIMDHFS--------------------SIQEENDQNTV-VTFQDPPYCSTNIKE----EPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYN---PELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITG-VTDVNG-EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSD-LNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADS 6853
            R GA+AAF + + FE   DEI+D                       SI +     ++ V+  DP   +   +E    EPIHI +VA RE   ++D    +I  ++C    +   +R IRR+TF       FP++FTFRA++ F EDRIYRHLEPA AF LE+NRM+ YDLE +P  N++MHLYL KAKVS+GQEVTDYRFF+RSIIRH+DL+TKEASFEY+ NE ER LLE++D LE+A +HP A+RT+CNHIFLNF PT+ + D  ++EE+V +M+MRYG RLWKLRV QAELKM++R S Q     +R+ +AN+ GY L+ISMY E  +  TG I+F+++G  K+G LHG  +  PY TKD LQ KRFQA +  TTYVYD P +  Q  E  W E++   P + +  PD  L+   EL+L+ +N +VE+Q++PG NN GMVAWR+ L TPEYP  GREII+I+ND+TY +GSF I ED+LF KAS+LAR+L +PRI+ + N GARIGLAEE K +F IAW D  +P+KGFKYLYL+  DY Q+  LN+V   LIEDEGE RYKITDIIGK+DG+GVENLR +G+IAGETS AY+EIVTI++V+ R +GIG+Y+VRLG RVIQ++NSHIILTG AALNK+LG  VY SN+QLGG QIM NNGV+H   A +L G+  +L WLSYIP+     LP+ L N    D I RPV +MP K  S  DPR ++ G V  VN  ++ +G FD+DSW EI+  WA++VVTGRARLGG+P+ VI  ETR V   +PADPAN  +E + +Q AGQVW+P S+YKTAQA++DF RE LPL +FANWRGFSGGM DMY+QI+KFG+YIVD L+ Y +PV +Y+PP+ ELRGGAW VLD  IN  YME +ADP+ + GG+LEPEGIVEIKY+EKDL+KTI RLDP  ++++ EL   ++   +++ + + + + ARI  L+ +YH +A+ FA LHDTP RM  K  +S ++PW DS
Sbjct: 1193 RTGAIAAFDSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIM-DPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGE-KQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDN-LVEMQRLPGENNCGMVAWRIVLATPEYP-NGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPN----DRIERPVDFMPTK--SPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPE-ARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVPWRDS 2185          

HSP 3 Score: 55.8398 bits (133), Expect = 7.490e-7
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 7088 LLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQEL 7330
            +L+RW VE++GA ++YLW  +  + +W E QI+     +   +   +   RRD  +S I K++   PD+ ++ ++ + Q L
Sbjct: 2221 MLRRWLVEEKGATEAYLWDKNEEMVSWYEEQIN-----AESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGL 2296          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0088872)

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 638/1128 (56.56%), Postives = 823/1128 (72.96%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASID 3601
            +A+  EFV   GG R I K+LIANNGIAAVKC+RSIR WAYE FK++ AIRFV MVTPED  ANAEYIKM+D    VPGGSN  NYANV+LI+D+ALRT+V AVWAGWGHASENPKLPE+L+K  ++F+GPP  AMW LGDKVAS+I+AQ+  IPTLPWSG+ L                                Y+ +KI   I  +L+ + CV++  + L    +IGFP+MIKASEGGGGKGIR+  ++E F  LF QVQ EVPGSPIF+MK A  ARHLEVQ+LADQYG AISLFGRDCS+QRRHQKI+EEAP IVA  EVFE MEKAA+ LA++VGYVSAGTVEYLYD +  ++FFLELNPRLQVEHPCTE+V D+NLPA+QLQI MGIPL+R+K+IR LY E P   + I+F NP  KPRP+GHVIA RITSENPDEGFKPS G ++ELNF+S+++VWGYFSV++ GG+HEF+DSQFGHCFS+ E R++AREN+V+ LKE+SIRGDFRTTVEYLI +LE+  F+ N IDT WLD +I+++VQ++  D  L  MC ++HI + ++  SFS++Q  +E+ QI  +  LTN+VDV LI+D ++Y++Q  K+G  +Y L+MN++  E EVH+L DG LLI+    SYTTY+KEE+  YR++I N T  FEKE DPS+L SPS GKL+   VEDG+HV     YA +EVMK+ M L +  +G + +++RPGA+LDAG  +  L LDD   + +A+ F G F          KLN+V +     LE  L GYCLPEP+   +L+  + +FM  LRDP LPL+ELQE+++ ISGRIP +VE+ I++ M++Y  N+TSVL+QFP  +I  ++ +   +L K++++D + + TQ I  LV +Y  G+RG MK A+  L  +YY+VE  FQ GH+DKCV ++ E  KD  Q ++N IFSH  VA KN L+ LLIDHL  NE GL  +L + L   T+LN++E+S+V+LRSRQVLIAA  PAYE+RHNQ+ESIFLSA+D YGH F PENL+RLILSET +FDI+ DFFYH N  V +AALEVYVRRAY +YELTC+   +L  G  +V F+FLLP+ HP+R    +  P  +D
Sbjct:   85 IATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLK-----------------------------AQYSGKKI--KISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEG-RYFFLELNPRLQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLD 1180          

HSP 2 Score: 1088.95 bits (2815), Expect = 0.000e+0
Identity = 550/1004 (54.78%), Postives = 717/1004 (71.41%), Query Frame = 2
Query: 3935 RMGAMAAFKTMDEFEEVFDEIMDHFS--------------------SIQEENDQNTV-VTFQDPPYCSTNIKE----EPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYN---PELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITG-VTDVNG-EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSD-LNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADS 6853
            R GA+AAF + + FE   DEI+D                       SI +     ++ V+  DP   +   +E    EPIHI +VA RE   ++D    +I  ++C    +   +R IRR+TF       FP++FTFRA++ F EDRIYRHLEPA AF LE+NRM+ YDLE +P  N++MHLYL KAKVS+GQEVTDYRFF+RSIIRH+DL+TKEASFEY+ NE ER LLE++D LE+A +HP A+RT+CNHIFLNF PT+ + D  ++EE+V +M+MRYG RLWKLRV QAELKM++R S Q     +R+ +AN+ GY L+ISMY E  +  TG I+F+++G  K+G LHG  +  PY TKD LQ KRFQA +  TTYVYD P +  Q  E  W E++   P + +  PD  L+   EL+L+ +N +VE+Q++PG NN GMVAWR+ L TPEYP  GREII+I+ND+TY +GSF I ED+LF KAS+LAR+L +PRI+ + N GARIGLAEE K +F IAW D  +P+KGFKYLYL+  DY Q+  LN+V   LIEDEGE RYKITDIIGK+DG+GVENLR +G+IAGETS AY+EIVTI++V+ R +GIG+Y+VRLG RVIQ++NSHIILTG AALNK+LG  VY SN+QLGG QIM NNGV+H   A +L G+  +L WLSYIP+     LP+ L N    D I RPV +MP K  S  DPR ++ G V  VN  ++ +G FD+DSW EI+  WA++VVTGRARLGG+P+ VI  ETR V   +PADPAN  +E + +Q AGQVW+P S+YKTAQA++DF RE LPL +FANWRGFSGGM DMY+QI+KFG+YIVD L+ Y +PV +Y+PP+ ELRGGAW VLD  IN  YME +ADP+ + GG+LEPEGIVEIKY+EKDL+KTI RLDP  ++++ EL   ++   +++ + + + + ARI  L+ +YH +A+ FA LHDTP RM  K  +S ++PW DS
Sbjct: 1193 RTGAIAAFDSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIM-DPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGE-KQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDN-LVEMQRLPGENNCGMVAWRIVLATPEYP-NGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPN----DRIERPVDFMPTK--SPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPE-ARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVPWRDS 2185          

HSP 3 Score: 55.8398 bits (133), Expect = 7.490e-7
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 7088 LLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQEL 7330
            +L+RW VE++GA ++YLW  +  + +W E QI+     +   +   +   RRD  +S I K++   PD+ ++ ++ + Q L
Sbjct: 2221 MLRRWLVEEKGATEAYLWDKNEEMVSWYEEQIN-----AESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGL 2296          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0113053)

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 638/1128 (56.56%), Postives = 823/1128 (72.96%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASID 3601
            +A+  EFV   GG R I K+LIANNGIAAVKC+RSIR WAYE FK++ AIRFV MVTPED  ANAEYIKM+D    VPGGSN  NYANV+LI+D+ALRT+V AVWAGWGHASENPKLPE+L+K  ++F+GPP  AMW LGDKVAS+I+AQ+  IPTLPWSG+ L                                Y+ +KI   I  +L+ + CV++  + L    +IGFP+MIKASEGGGGKGIR+  ++E F  LF QVQ EVPGSPIF+MK A  ARHLEVQ+LADQYG AISLFGRDCS+QRRHQKI+EEAP IVA  EVFE MEKAA+ LA++VGYVSAGTVEYLYD +  ++FFLELNPRLQVEHPCTE+V D+NLPA+QLQI MGIPL+R+K+IR LY E P   + I+F NP  KPRP+GHVIA RITSENPDEGFKPS G ++ELNF+S+++VWGYFSV++ GG+HEF+DSQFGHCFS+ E R++AREN+V+ LKE+SIRGDFRTTVEYLI +LE+  F+ N IDT WLD +I+++VQ++  D  L  MC ++HI + ++  SFS++Q  +E+ QI  +  LTN+VDV LI+D ++Y++Q  K+G  +Y L+MN++  E EVH+L DG LLI+    SYTTY+KEE+  YR++I N T  FEKE DPS+L SPS GKL+   VEDG+HV     YA +EVMK+ M L +  +G + +++RPGA+LDAG  +  L LDD   + +A+ F G F          KLN+V +     LE  L GYCLPEP+   +L+  + +FM  LRDP LPL+ELQE+++ ISGRIP +VE+ I++ M++Y  N+TSVL+QFP  +I  ++ +   +L K++++D + + TQ I  LV +Y  G+RG MK A+  L  +YY+VE  FQ GH+DKCV ++ E  KD  Q ++N IFSH  VA KN L+ LLIDHL  NE GL  +L + L   T+LN++E+S+V+LRSRQVLIAA  PAYE+RHNQ+ESIFLSA+D YGH F PENL+RLILSET +FDI+ DFFYH N  V +AALEVYVRRAY +YELTC+   +L  G  +V F+FLLP+ HP+R    +  P  +D
Sbjct:   85 IATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLK-----------------------------AQYSGKKI--KISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEG-RYFFLELNPRLQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLD 1180          

HSP 2 Score: 1088.95 bits (2815), Expect = 0.000e+0
Identity = 550/1004 (54.78%), Postives = 717/1004 (71.41%), Query Frame = 2
Query: 3935 RMGAMAAFKTMDEFEEVFDEIMDHFS--------------------SIQEENDQNTV-VTFQDPPYCSTNIKE----EPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYN---PELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITG-VTDVNG-EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSD-LNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADS 6853
            R GA+AAF + + FE   DEI+D                       SI +     ++ V+  DP   +   +E    EPIHI +VA RE   ++D    +I  ++C    +   +R IRR+TF       FP++FTFRA++ F EDRIYRHLEPA AF LE+NRM+ YDLE +P  N++MHLYL KAKVS+GQEVTDYRFF+RSIIRH+DL+TKEASFEY+ NE ER LLE++D LE+A +HP A+RT+CNHIFLNF PT+ + D  ++EE+V +M+MRYG RLWKLRV QAELKM++R S Q     +R+ +AN+ GY L+ISMY E  +  TG I+F+++G  K+G LHG  +  PY TKD LQ KRFQA +  TTYVYD P +  Q  E  W E++   P + +  PD  L+   EL+L+ +N +VE+Q++PG NN GMVAWR+ L TPEYP  GREII+I+ND+TY +GSF I ED+LF KAS+LAR+L +PRI+ + N GARIGLAEE K +F IAW D  +P+KGFKYLYL+  DY Q+  LN+V   LIEDEGE RYKITDIIGK+DG+GVENLR +G+IAGETS AY+EIVTI++V+ R +GIG+Y+VRLG RVIQ++NSHIILTG AALNK+LG  VY SN+QLGG QIM NNGV+H   A +L G+  +L WLSYIP+     LP+ L N    D I RPV +MP K  S  DPR ++ G V  VN  ++ +G FD+DSW EI+  WA++VVTGRARLGG+P+ VI  ETR V   +PADPAN  +E + +Q AGQVW+P S+YKTAQA++DF RE LPL +FANWRGFSGGM DMY+QI+KFG+YIVD L+ Y +PV +Y+PP+ ELRGGAW VLD  IN  YME +ADP+ + GG+LEPEGIVEIKY+EKDL+KTI RLDP  ++++ EL   ++   +++ + + + + ARI  L+ +YH +A+ FA LHDTP RM  K  +S ++PW DS
Sbjct: 1193 RTGAIAAFDSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIM-DPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGE-KQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDN-LVEMQRLPGENNCGMVAWRIVLATPEYP-NGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPN----DRIERPVDFMPTK--SPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPE-ARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVPWRDS 2185          

HSP 3 Score: 55.8398 bits (133), Expect = 7.490e-7
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 7088 LLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQEL 7330
            +L+RW VE++GA ++YLW  +  + +W E QI+     +   +   +   RRD  +S I K++   PD+ ++ ++ + Q L
Sbjct: 2221 MLRRWLVEEKGATEAYLWDKNEEMVSWYEEQIN-----AESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGL 2296          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Zebrafish
Match: acaca (acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-GENE-060526-74])

HSP 1 Score: 2482.21 bits (6432), Expect = 0.000e+0
Identity = 1291/2443 (52.84%), Postives = 1690/2443 (69.18%), Query Frame = 2
Query:  125 DDLD--INSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMH-SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            D LD  ++++    S   +V+Q    R I++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+                            T  + +K   ++P +LY Q CV D    L+ A Q+GFP+M+KASEGGGGKGIRK + +E+F +L+ QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F+  +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMN +SVE +VH+L DG +L++Y  +SYTTY+KEE+  YR+II N T  FEKE DPSVL SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L  + SGCIHY+KR GA+L+ GC +  L LDD   +++AE +TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+ KL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE+AIK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+L              P S  N   I          P++ NRK S             P  D           P +          A++ + S D  +FS    ++      +  +++D L  LD   +PPCQRMGAM +F++  EF     +++  FS    S     +    V +++    S +I++EPIHI NVA + D  ++DD    +  +F   KK +  + GIRR+TFL+     FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LF +ASE+AR+ GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY++I+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL WLSY+P   + P+P+     +  DPI+R + ++P K  +  DPR ++ G  + N  G ++SG FD+ S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     +   +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W+ SR+ FY +LRR LLE                              + VK++    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM   A
Sbjct:   66 DSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEW--------------------------TENDQKKGIINVPTELYEQGCVHDVEAGLKAAEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLYGMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDGSSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYAEIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQSVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVDMANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFML--------------PTSHPNRGNI----------PTL-NRKLSA------------PLQDY--------KPPANTANTSGATEAASDSAESEDRMSFS---SNLNHYGMVHVASVSDVL--LDTSFTPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREED--SKSIQDEPIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGHKDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPIL----SAKDPIDRAIEFVPTK--APYDPRWMLAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELSVSERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLE------------------------------ETVKRKIQCANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLERQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPA 2373          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Zebrafish
Match: acaca (acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-GENE-060526-74])

HSP 1 Score: 2477.59 bits (6420), Expect = 0.000e+0
Identity = 1293/2452 (52.73%), Postives = 1695/2452 (69.13%), Query Frame = 2
Query:  125 DDLD--INSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVP-DSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMH-SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            D LD  ++++    S   +V+Q    R I++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+                            T  + +K   ++P +LY Q CV D    L+ A Q+GFP+M+KASEGGGGKGIRK + +E+F +L+ QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F+  +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMN +SVE +VH+L DG +L++Y  +SYTTY+KEE+  YR+II N T  FEKE DPSVL SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L  + SGCIHY+KR GA+L+ GC +  L LDD   +++AE +TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+ KL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE+AIK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+L              P S  N   I          P++ NRK S             P  D     Y  P ++ N +   +     A++ + S D  +FS    ++      +  +++D L  LD   +PPCQRMGAM +F++  EF     +++  FS    S     +    V +++    S +I++EPIHI NVA + D  ++DD    +  +F   KK +  + GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LF +ASE+AR+ GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY++I+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL WLSY+P   + P+P+     +  DPI+R + ++P K  +  DPR ++ G  + N  G ++SG FD+ S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     +   +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W+ SR+ FY +LRR LLE                              + VK++    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM   A
Sbjct:   66 DSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEW--------------------------TENDQKKGIINVPTELYEQGCVHDVEAGLKAAEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLYGMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDGSSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYAEIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQSVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVDMANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFML--------------PTSHPNRGNI----------PTL-NRKLSA------------PLQD-----YKPPANTANTSGATEA----ASDSAESEDRMSFS---SNLNHYGMVHVASVSDVL--LDTSFTPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREED--SKSIQDEPIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQKDFRKQINCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPIL----SAKDPIDRAIEFVPTK--APYDPRWMLAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELSVSERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLE------------------------------ETVKRKIQCANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLERQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPA 2381          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Zebrafish
Match: acaca (acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-GENE-060526-74])

HSP 1 Score: 2471.04 bits (6403), Expect = 0.000e+0
Identity = 1293/2459 (52.58%), Postives = 1695/2459 (68.93%), Query Frame = 2
Query:  125 DDLD--INSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVP-DSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMH-SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            D LD  ++++    S   +V+Q    R I++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+                            T  + +K   ++P +LY Q CV D    L+ A Q+GFP+M+KASEGGGGKGIRK + +E+F +L+ QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F+  +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMN +SVE +VH+L DG +L++Y  +SYTTY+KEE+  YR+II N T  FEKE DPSVL SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L  + SGCIHY+KR GA+L+ GC +  L LDD   +++AE +TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+ KL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE+AIK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+L              P S  N   I          P++ NRK S             P  D     Y  P ++ N +   +     A++ + S D  +FS    ++      +  +++D L  LD   +PPCQRMGAM +F++  EF     +++  FS    S     +    V +++    S +I++EPIHI NVA + D  ++DD    +  +F   KK +  + GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LF +ASE+AR+ GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY++I+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL WLSY+P   + P+P+     +  DPI+R + ++P K  +  DPR ++ G  + N  G ++SG FD+ S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     +   +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W+ SR+ FY +LRR LLE                              + VK++    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM   A
Sbjct:   66 DSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEW--------------------------TENDQKKGIINVPTELYEQGCVHDVEAGLKAAEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLYGMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDGSSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYAEIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQSVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVDMANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFML--------------PTSHPNRGNI----------PTL-NRKLSA------------PLQD-----YKPPANTANTSGATEA----ASDSAESEDRMSFS---SNLNHYGMVHVASVSDVL--LDTSFTPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREED--SKSIQDEPIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQKDFRKQINCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGHKDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPIL----SAKDPIDRAIEFVPTK--APYDPRWMLAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELSVSERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLE------------------------------ETVKRKIQCANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLERQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPA 2388          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Zebrafish
Match: acaca (acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-GENE-060526-74])

HSP 1 Score: 2453.32 bits (6357), Expect = 0.000e+0
Identity = 1287/2446 (52.62%), Postives = 1686/2446 (68.93%), Query Frame = 2
Query:  125 DDLD--INSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVP-DSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMH-SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKN--DFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            D LD  ++++    S   +V+Q    R I++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+                            T  + +K   ++P +LY Q CV D    L+ A Q+GFP+M+KASEGGGGKGIRK + +E+F +L+ QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F+  +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMN +SVE +VH+L DG +L++Y  +SYTTY+KEE+  YR+II N T  FEKE DPSVL SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L  + SGCIHY+KR GA+L+ GC +  L LDD   +++AE +TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+ KL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE+AIK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+L              P S  N   I          P++ NRK S             P  D     Y  P ++ N +   +     A++ + S D  +FS    ++      +  +++D L  LD   +PPCQRMGAM +F++  EF     +++  FS    S     +    V +++    S +I++EPIHI NVA + D  ++DD    +  +F   KK +  + GIRR+TFL+     F +           F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LF +ASE+AR+ GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY++I+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL WLSY+P   + P+P+     +  DPI+R + ++P K  +  DPR ++ G  + N  G ++SG FD+ S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     +   +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W+ SR+ FY +LRR LLE                              + VK++    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM   A
Sbjct:   66 DSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEW--------------------------TENDQKKGIINVPTELYEQGCVHDVEAGLKAAEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLYGMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDGSSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYAEIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQSVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVDMANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFML--------------PTSHPNRGNI----------PTL-NRKLSA------------PLQD-----YKPPANTANTSGATEA----ASDSAESEDRMSFS---SNLNHYGMVHVASVSDVL--LDTSFTPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREED--SKSIQDEPIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQK-DFRKQINCEVDQRFHFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGHKDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPIL----SAKDPIDRAIEFVPTK--APYDPRWMLAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELSVSERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLE------------------------------ETVKRKIQCANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLERQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPA 2374          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Zebrafish
Match: acaca (acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-GENE-060526-74])

HSP 1 Score: 1308.12 bits (3384), Expect = 0.000e+0
Identity = 653/1153 (56.63%), Postives = 838/1153 (72.68%), Query Frame = 2
Query:  125 DDLD--INSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            D LD  ++++    S   +V+Q    R I++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+                            T  + +K   ++P +LY Q CV D    L+ A Q+GFP+M+KASEGGGGKGIRK + +E+F +L+ QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F+  +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMN +SVE +VH+L DG +L++Y  +SYTTY+KEE+  YR+II N T  FEKE DPSVL SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L  + SGCIHY+KR GA+L+ GC +  L LDD   +++AE +TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+ KL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE+AIK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+LP++HP+R
Sbjct:   66 DSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEW--------------------------TENDQKKGIINVPTELYEQGCVHDVEAGLKAAEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLYGMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDGSSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYAEIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQSVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVDMANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPTSHPNR 1191          

HSP 2 Score: 1187.56 bits (3071), Expect = 0.000e+0
Identity = 615/1173 (52.43%), Postives = 817/1173 (69.65%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRA--KNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMGAM +F++  EF     +++  FS    S     +    V +++    S +I++EPIHI NVA + D  ++DD    +  +F   KK +  + GIRR+TFL+     F +        +  F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LF +ASE+AR+ GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY++I+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL WLSY+P   + P+P+     +  DPI+R + ++P K  +  DPR ++ G  + N  G ++SG FD+ S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     +   +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W+ SR+ FY +LRR LLE                              + VK++    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM   A
Sbjct: 1223 TPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREED--SKSIQDEPIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQK-DFRKQINCEVDQRFHFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGHKDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPIL----SAKDPIDRAIEFVPTK--APYDPRWMLAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELSVSERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLE------------------------------ETVKRKIQCANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLERQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPA 2336          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Xenopus
Match: cntn5 (contactin 5 [Source:Xenbase;Acc:XB-GENE-953061])

HSP 1 Score: 2418.27 bits (6266), Expect = 0.000e+0
Identity = 1256/2409 (52.14%), Postives = 1641/2409 (68.12%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q S                          +L+K    +P ++Y +  V D ++ L+ A  +G+P+MIKASEGGGGKGIRK +++E+F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQIL+DQYG AISLFGRDCSVQRRHQKI+EEAP  +A   +FEQME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMG+PLHRIK+IR LY       + I+F+N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+KVQ +  D  L  +C A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMNN+ VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA L+ GC +A L LDD   +++AE   G     + TA    KL++VF   +  L  +++GYCLPEPYF+ KL+  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++S+++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   +   ++N IFSH  V  KN LI +LID L   +  L  +L + L+  T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++                              ++H  S   LD+ +  P             C+               + G + F T      + DD+      SPP                  VF E   H S   E++++++    +D P          IHI NVA + D  ++DD    +  +F   KK V ++ GIRR+TFL+                    FP++FTFRA+N F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL  +W        L    +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TYK+GSF   ED+L+L+ASEL+R  GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+TI+LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L+WLSY+P     P+P+        D I R + +   K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  S+PADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S GG+LEPEG VEIK+R KDLIKT++R+DP+ + + +E L          K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ +I W  SR  FY +LRR LLE                              +  KK+  S N  P    G I +           +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   + + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM +
Sbjct:  102 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLKVDWQES--------------------------DLKKSTLIVPPEVYGKGYVKDVDDGLKAAEVVGYPVMIKASEGGGGKGIRKVNNAEDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILSDQYGNAISLFGRDCSVQRRHQKIIEEAPASIATATIFEQMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGVPLHRIKDIRMLYGLPAWGDSPIDFDNSLNAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQNNRIDTGWLDRLISEKVQAERPDAMLGVVCGALHVADVTFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGEKYVLKVTRQSPNSYVVIMNNSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALEPGCVIAKLQLDDPSRVQQAELHRGPLPLIHSTALRGEKLHRVFHCVLDNLVNVMNGYCLPEPYFSSKLKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSDREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSDLTMVLNSIFSHAQVTKKNLLITMLIDQLCGRDPTLTDELLNILMELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHY---------------------------GMVHVVSDVLLDTSFTPP-------------CQR--------------MGGMVAFRTFEDFVRLFDDVMSCFSDSPPQS---------------PVFPE-AGHPSLYDEDDNKSS----RDEP----------IHILNVAIKTDCDIDDDGLAAMFREFTQSKKAVLMDHGIRRLTFLVAQKDFRKQVNCEVDQRFQREFPKFFTFRARNKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDIPEMFRQALIKLWESMEAHAFLPKSPLPSDVLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYKIGSFGPQEDLLYLRASELSRSEGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITINLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVYDDFEGVYTILQWLSYMPKCVASPVPILTPK----DSIERLIEFTHTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKE-SRGGVLEPEGTVEIKFRRKDLIKTMRRVDPVYIHL-AEKLGTPELGAADCKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVIEWKTSRTFFYWRLRRLLLE------------------------------NVAKKKIHSAN--PELTDGQIQA-----------MLRRWFVEVEGTVKAYLWDNNKDVVEWLEKQM-AEEEGTRSVVDENIKYISRDYILKQIRSLVQENPEVAMDSIVHMTQHISPTQRAEIVRILSTMDS 2343          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Xenopus
Match: cntn5 (contactin 5 [Source:Xenbase;Acc:XB-GENE-953061])

HSP 1 Score: 2395.93 bits (6208), Expect = 0.000e+0
Identity = 1249/2396 (52.13%), Postives = 1633/2396 (68.16%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRA--KNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q S                          +L+K    +P ++Y +  V D ++ L+ A  +G+P+MIKASEGGGGKGIRK +++E+F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQIL+DQYG AISLFGRDCSVQRRHQKI+EEAP  +A   +FEQME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMG+PLHRIK+IR LY       + I+F+N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+KVQ +  D  L  +C A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMNN+ VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA L+ GC +A L LDD   +++AE   G     + TA    KL++VF   +  L  +++GYCLPEPYF+ KL+  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++S+++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   +   ++N IFSH  V  KN LI +LID L   +  L  +L + L+  T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++                              ++H  S   LD+ +  P             C+               + G + F T      + DD+      SPP                  VF E   H S   E++++++    +D P          IHI NVA + D  ++DD    +  +F   KK V ++ GIRR+TFL+     F +        +  F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL  +W        L    +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TYK+GSF   ED+L+L+ASEL+R  GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+TI+LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L+WLSY+P     P+P+        D I R + +   K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  S+PADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S GG+LEPEG VEIK+R KDLIKT++R+DP+ + + +E L          K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ +I W  SR  FY +LRR LLE                              +  KK+  S N  P    G I +           +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   + + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM +
Sbjct:  102 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLKVDWQES--------------------------DLKKSTLIVPPEVYGKGYVKDVDDGLKAAEVVGYPVMIKASEGGGGKGIRKVNNAEDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILSDQYGNAISLFGRDCSVQRRHQKIIEEAPASIATATIFEQMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGVPLHRIKDIRMLYGLPAWGDSPIDFDNSLNAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQNNRIDTGWLDRLISEKVQAERPDAMLGVVCGALHVADVTFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGEKYVLKVTRQSPNSYVVIMNNSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALEPGCVIAKLQLDDPSRVQQAELHRGPLPLIHSTALRGEKLHRVFHCVLDNLVNVMNGYCLPEPYFSSKLKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSDREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSDLTMVLNSIFSHAQVTKKNLLITMLIDQLCGRDPTLTDELLNILMELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHY---------------------------GMVHVVSDVLLDTSFTPP-------------CQR--------------MGGMVAFRTFEDFVRLFDDVMSCFSDSPPQS---------------PVFPE-AGHPSLYDEDDNKSS----RDEP----------IHILNVAIKTDCDIDDDGLAAMFREFTQSKKAVLMDHGIRRLTFLVAQK-DFRKQVNCEVDQRFQFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDIPEMFRQALIKLWESMEAHAFLPKSPLPSDVLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYKIGSFGPQEDLLYLRASELSRSEGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITINLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVYDDFEGVYTILQWLSYMPKCVASPVPILTPK----DSIERLIEFTHTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKE-SRGGVLEPEGTVEIKFRRKDLIKTMRRVDPVYIHL-AEKLGTPELGAADCKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVIEWKTSRTFFYWRLRRLLLE------------------------------NVAKKKIHSAN--PELTDGQIQA-----------MLRRWFVEVEGTVKAYLWDNNKDVVEWLEKQM-AEEEGTRSVVDENIKYISRDYILKQIRSLVQENPEVAMDSIVHMTQHISPTQRAEIVRILSTMDS 2329          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Xenopus
Match: cntn5 (contactin 5 [Source:Xenbase;Acc:XB-GENE-953061])

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 634/1117 (56.76%), Postives = 817/1117 (73.14%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q S                          +L+K    +P ++Y +  V D ++ L+ A  +G+P+MIKASEGGGGKGIRK +++E+F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQIL+DQYG AISLFGRDCSVQRRHQKI+EEAP  +A   +FEQME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMG+PLHRIK+IR LY       + I+F+N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+KVQ +  D  L  +C A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMNN+ VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA L+ GC +A L LDD   +++AE   G     + TA    KL++VF   +  L  +++GYCLPEPYF+ KL+  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++S+++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   +   ++N IFSH  V  KN LI +LID L   +  L  +L + L+  T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R
Sbjct:  136 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLKVDWQES--------------------------DLKKSTLIVPPEVYGKGYVKDVDDGLKAAEVVGYPVMIKASEGGGGKGIRKVNNAEDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILSDQYGNAISLFGRDCSVQRRHQKIIEEAPASIATATIFEQMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGVPLHRIKDIRMLYGLPAWGDSPIDFDNSLNAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQNNRIDTGWLDRLISEKVQAERPDAMLGVVCGALHVADVTFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGEKYVLKVTRQSPNSYVVIMNNSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALEPGCVIAKLQLDDPSRVQQAELHRGPLPLIHSTALRGEKLHRVFHCVLDNLVNVMNGYCLPEPYFSSKLKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSDREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSDLTMVLNSIFSHAQVTKKNLLITMLIDQLCGRDPTLTDELLNILMELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNR 1225          

HSP 2 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 603/1165 (51.76%), Postives = 795/1165 (68.24%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYC-----STNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRA--KNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            +PPCQRMG M AF+T ++F  +FD++M  FS   +   Q+ V      P       + + ++EPIHI NVA + D  ++DD    +  +F  + K  F    +      +     F +        +  F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL  +W        L    +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TYK+GSF   ED+L+L+ASEL+R  GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+TI+LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L+WLSY+P     P+P+        D I R + +   K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  S+PADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S GG+LEPEG VEIK+R KDLIKT++R+DP+ + + +E L          K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ +I W  SR  FY +LRR LLE                              +  KK+  S N  P    G I +           +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   + + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM +
Sbjct: 1251 TPPCQRMGGMVAFRTFEDFVRLFDDVMSCFS---DSPPQSPVFPEAGHPSLYDEDDNKSSRDEPIHILNVAIKTDCDIDDDGLAAMFREFT-QSKVTFFPCCLFLCLAFLFLHKDFRKQVNCEVDQRFQFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDIPEMFRQALIKLWESMEAHAFLPKSPLPSDVLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYKIGSFGPQEDLLYLRASELSRSEGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITINLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVYDDFEGVYTILQWLSYMPKCVASPVPILTPK----DSIERLIEFTHTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKE-SRGGVLEPEGTVEIKFRRKDLIKTMRRVDPVYIHL-AEKLGTPELGAADCKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVIEWKTSRTFFYWRLRRLLLE------------------------------NVAKKKIHSAN--PELTDGQIQA-----------MLRRWFVEVEGTVKAYLWDNNKDVVEWLEKQM-AEEEGTRSVVDENIKYISRDYILKQIRSLVQENPEVAMDSIVHMTQHISPTQRAEIVRILSTMDS 2355          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Xenopus
Match: cntn5 (contactin 5 [Source:Xenbase;Acc:XB-GENE-953061])

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 634/1117 (56.76%), Postives = 817/1117 (73.14%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q S                          +L+K    +P ++Y +  V D ++ L+ A  +G+P+MIKASEGGGGKGIRK +++E+F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQIL+DQYG AISLFGRDCSVQRRHQKI+EEAP  +A   +FEQME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMG+PLHRIK+IR LY       + I+F+N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+KVQ +  D  L  +C A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMNN+ VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA L+ GC +A L LDD   +++AE   G     + TA    KL++VF   +  L  +++GYCLPEPYF+ KL+  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++S+++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   +   ++N IFSH  V  KN LI +LID L   +  L  +L + L+  T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R
Sbjct:  102 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLKVDWQES--------------------------DLKKSTLIVPPEVYGKGYVKDVDDGLKAAEVVGYPVMIKASEGGGGKGIRKVNNAEDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILSDQYGNAISLFGRDCSVQRRHQKIIEEAPASIATATIFEQMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGVPLHRIKDIRMLYGLPAWGDSPIDFDNSLNAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQNNRIDTGWLDRLISEKVQAERPDAMLGVVCGALHVADVTFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGEKYVLKVTRQSPNSYVVIMNNSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALEPGCVIAKLQLDDPSRVQQAELHRGPLPLIHSTALRGEKLHRVFHCVLDNLVNVMNGYCLPEPYFSSKLKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSDREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSDLTMVLNSIFSHAQVTKKNLLITMLIDQLCGRDPTLTDELLNILMELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNR 1191          

HSP 2 Score: 1183.7 bits (3061), Expect = 0.000e+0
Identity = 612/1161 (52.71%), Postives = 804/1161 (69.25%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYC-----STNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTM 7375
            +PPCQRMG M AF+T ++F  +FD++M  FS   +   Q+ V      P       + + ++EPIHI NVA + D  ++DD    +  +F   KK V ++ GIRR+TFL+    TF  +      + F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL  +W        L    +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TYK+GSF   ED+L+L+ASEL+R  GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+TI+LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L+WLSY+P     P+P+        D I R + +   K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  S+PADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S GG+LEPEG VEIK+R KDLIKT++R+DP+ + + +E L          K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ +I W  SR  FY +LRR LLE                              +  KK+  S N  P    G I +           +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   + + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM
Sbjct: 1217 TPPCQRMGGMVAFRTFEDFVRLFDDVMSCFS---DSPPQSPVFPEAGHPSLYDEDDNKSSRDEPIHILNVAIKTDCDIDDDGLAAMFREFTQSKKAVLMDHGIRRLTFLVAQKVTFHFFHVICFFSKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDIPEMFRQALIKLWESMEAHAFLPKSPLPSDVLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYKIGSFGPQEDLLYLRASELSRSEGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITINLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVYDDFEGVYTILQWLSYMPKCVASPVPILTPK----DSIERLIEFTHTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKE-SRGGVLEPEGTVEIKFRRKDLIKTMRRVDPVYIHL-AEKLGTPELGAADCKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVIEWKTSRTFFYWRLRRLLLE------------------------------NVAKKKIHSAN--PELTDGQIQA-----------MLRRWFVEVEGTVKAYLWDNNKDVVEWLEKQM-AEEEGTRSVVDENIKYISRDYILKQIRSLVQENPEVAMDSIVHMTQHISPTQRAEIVRILSTM 2318          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Xenopus
Match: cntn5 (contactin 5 [Source:Xenbase;Acc:XB-GENE-953061])

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 634/1117 (56.76%), Postives = 817/1117 (73.14%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q S                          +L+K    +P ++Y +  V D ++ L+ A  +G+P+MIKASEGGGGKGIRK +++E+F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQIL+DQYG AISLFGRDCSVQRRHQKI+EEAP  +A   +FEQME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMG+PLHRIK+IR LY       + I+F+N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+KVQ +  D  L  +C A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMNN+ VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA L+ GC +A L LDD   +++AE   G     + TA    KL++VF   +  L  +++GYCLPEPYF+ KL+  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++S+++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   +   ++N IFSH  V  KN LI +LID L   +  L  +L + L+  T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R
Sbjct:  106 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLKVDWQES--------------------------DLKKSTLIVPPEVYGKGYVKDVDDGLKAAEVVGYPVMIKASEGGGGKGIRKVNNAEDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILSDQYGNAISLFGRDCSVQRRHQKIIEEAPASIATATIFEQMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGVPLHRIKDIRMLYGLPAWGDSPIDFDNSLNAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQNNRIDTGWLDRLISEKVQAERPDAMLGVVCGALHVADVTFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGEKYVLKVTRQSPNSYVVIMNNSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALEPGCVIAKLQLDDPSRVQQAELHRGPLPLIHSTALRGEKLHRVFHCVLDNLVNVMNGYCLPEPYFSSKLKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSDREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSDLTMVLNSIFSHAQVTKKNLLITMLIDQLCGRDPTLTDELLNILMELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNR 1195          

HSP 2 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 605/1165 (51.93%), Postives = 794/1165 (68.15%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPP--YCSTNIK---EEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRA--KNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            +PPCQRMG M AF+T ++F  +FD++M  FS   +   Q+ V      P  Y   + K    EPIHI NVA + D  ++DD    +  +F  + K  F    +      +     F +        +  F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL  +W        L    +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TYK+GSF   ED+L+L+ASEL+R  GIPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+TI+LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L+WLSY+P     P+P+        D I R + +   K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  S+PADPAN  +E + +Q AGQVWFP SA+KTAQA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S GG+LEPEG VEIK+R KDLIKT++R+DP+ + + +E L          K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ +I W  SR  FY +LRR LLE                              +  KK+  S N  P    G I +           +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   + + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM +
Sbjct: 1221 TPPCQRMGGMVAFRTFEDFVRLFDDVMSCFS---DSPPQSPVFPEAGHPSLYDEDDNKVPINEPIHILNVAIKTDCDIDDDGLAAMFREFT-QSKVTFFPCCLFLCLAFLFLHKDFRKQVNCEVDQRFQFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDIPEMFRQALIKLWESMEAHAFLPKSPLPSDVLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYKIGSFGPQEDLLYLRASELSRSEGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITINLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVYDDFEGVYTILQWLSYMPKCVASPVPILTPK----DSIERLIEFTHTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKE-SRGGVLEPEGTVEIKFRRKDLIKTMRRVDPVYIHL-AEKLGTPELGAADCKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVIEWKTSRTFFYWRLRRLLLE------------------------------NVAKKKIHSAN--PELTDGQIQA-----------MLRRWFVEVEGTVKAYLWDNNKDVVEWLEKQM-AEEEGTRSVVDENIKYISRDYILKQIRSLVQENPEVAMDSIVHMTQHISPTQRAEIVRILSTMDS 2325          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Mouse
Match: Acaca (acetyl-Coenzyme A carboxylase alpha [Source:MGI Symbol;Acc:MGI:108451])

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 837/1157 (72.34%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQDLY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL RIK+IR +Y   P     I+F N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF +N IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ +++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  101 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFASNLN-----HYGMTHVASVSDVLLDNAF 1225          

HSP 2 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 822/1180 (69.66%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDEIM  F     ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   +E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ A+N GARIGLAEE +++F++AW+D  DP KG+KYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+G ENLR SGMIAGE+SLAYDE++TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+  +QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S G +LEPEG VEIK+R+KDL+KT++R+DP+ + +   L + +   T+ +K L S L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +  WLE Q+   ++     I + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1226 TPPCQRMGGMVSFRTFEDFVRIFDEIMGCFCDSPPQSP-----TFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPD-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEVITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTINPRHMEMYADRE-SRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTE-RKELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE-EDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPS 2344          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Mouse
Match: Acaca (acetyl-Coenzyme A carboxylase alpha [Source:MGI Symbol;Acc:MGI:108451])

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 837/1157 (72.34%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQDLY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL RIK+IR +Y   P     I+F N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF +N IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ +++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  101 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFASNLN-----HYGMTHVASVSDVLLDNAF 1225          

HSP 2 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 822/1180 (69.66%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDEIM  F     ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   +E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ A+N GARIGLAEE +++F++AW+D  DP KG+KYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+G ENLR SGMIAGE+SLAYDE++TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+  +QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S G +LEPEG VEIK+R+KDL+KT++R+DP+ + +   L + +   T+ +K L S L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +  WLE Q+   ++     I + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1226 TPPCQRMGGMVSFRTFEDFVRIFDEIMGCFCDSPPQSP-----TFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPD-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEVITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTINPRHMEMYADRE-SRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTE-RKELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE-EDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPS 2344          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Mouse
Match: Acacb (acetyl-Coenzyme A carboxylase beta [Source:MGI Symbol;Acc:MGI:2140940])

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 641/1133 (56.58%), Postives = 815/1133 (71.93%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASV--AKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMD 3610
            VAS  EFV   GGNR I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D+   VPGG N  NYANV+LI+D+A R  V AVWAGWGHASENPKLPE+L KH I F+GPP EAMW LGDK+ASTI+AQ+  IPTLPWSG+GLT+            E     RH     G   S         +P+D+Y Q CV D +E L+ A +IGFP+MIKASEGGGGKGIRKA S+E+F  LF QVQ+E+PGSPIFLMK A++ARHLEVQ+LADQYG A+SLFGRDCS+QRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F FLELNPRLQVEHPCTE++ D+NLPA+QLQIAMG+PLHR+K+IR LY E P     I F  P   P   GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYL+ +LE+ESF  NDIDTGWLD++I+Q+VQ +  D  L  +C A+++ +       + +   +ER Q+  +  L NIVDV LI+  +KY +++ +     + LIMN   +E + H+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DP+VL SPS GKL+QYTVEDG HV + S YA MEVMK+ M L+   SG + YIKRPG IL+AGC VA L LDD   +  A+ FTG    + QT  +   KL+QVF   ++ L  ++ GYCLPEP+F+ KL+  V + M  LR P LPL+ELQE+M+ ++GRIP  VE+A+++ M+ YASN+TSVL QFP  +I  IL     +L ++++++ + M TQ I  LV +Y  G RG+MK  + +L  KY NVE  FQ+ H+DKCV  L EQ K     +++ IFSH  VA KN+L+ +LID L   +  L  +L   L   T L++SE+ KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF PENL++LILSET +FD++  FFYH N +V  A+LEVYVRR YIAYEL  +   +L +G  +VEF+F+LPS+HP+R    +  P S+ N D
Sbjct:  234 VASPAEFVTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADQYVPVPGGPNNNNYANVELIIDIAKRIPVQAVWAGWGHASENPKLPELLCKHEIAFLGPPSEAMWALGDKIASTIVAQTLQIPTLPWSGSGLTV------------EWTEDSRHQ----GKCIS---------VPEDVYEQGCVKDVDEGLQAAEKIGFPLMIKASEGGGGKGIRKAESAEDFPMLFRQVQSEIPGSPIFLMKLAQNARHLEVQVLADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIAAPAVFEFMEQCAVLLAKMVGYVSAGTVEYLYS-QDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPIPFETPLSPPIARGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLVNLLETESFQNNDIDTGWLDHLIAQRVQAEKPDIMLGVVCGALNVADAMFRTCMTEFLHSLERGQVLPADSLLNIVDVELIYGGIKYALKVARQSLTMFVLIMNGCHIEIDAHRLNDGGLLLSYNGSSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLMQYTVEDGDHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGVILEAGCVVARLELDDPSKVHAAQPFTGEL-PAQQTLPILGEKLHQVFHGVLENLTNVMSGYCLPEPFFSMKLKDWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKAVRRVMAQYASNITSVLCQFPSQQIATILDCHAATLQRKADREVFFMNTQSIVQLVQRYRSGTRGYMKAVVLDLLRKYLNVEHHFQQAHYDKCVINLREQFKPDMTQVLDCIFSHSQVAKKNQLVTMLIDELCGPDPTLSDELTSILCELTQLSRSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETTIFDVLPTFFYHENKVVCMASLEVYVRRGYIAYELNSLQHRELPDGTCVVEFQFMLPSSHPNR----MAVPISVSNPD 1335          

HSP 2 Score: 1167.53 bits (3019), Expect = 0.000e+0
Identity = 597/1164 (51.29%), Postives = 799/1164 (68.64%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEEN-----DQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGG-EFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            SP CQRMGAM AF+  +EF   FDE++  F+++Q +         ++ + +D    S +++EEPIHI NVA +    +ED+    +   F   KK + ++ G+RR+TFL+     FP++FTFRA+++F EDRIYRHLEPALAFQLE++RMRN+DL  +P  N +MHLYL  AKV EG EVTD+RFF+R+IIRH+DL+TKEASFEY+ NE ER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D  ++EE+VR MVMRYGSRLWKLRV QAE+K+ +R +     IP+R+++ NE GY L+IS+Y+EV D  +G I F SFGN K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +PE   + P  ++LTY EL+LD    +VE+ ++PG N +GMVA++M+  TPEYPE GR+ ++I ND+T+++GSF I ED L+L+ASE+AR  GIP+I+ A+N GAR+GLAEE K IF +AW+D  DP KGF+YLYLTP DY Q+   N+V C+ IEDEGE+RY I D+IGK+  +GVENLR SGMIAGE SLAY++ VTIS+V+ RA+GIGAYLVRLG RVIQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM  NGVSH  V D+ +G+  +L+WLS+IP     P+P+    P+  DPI+R + + P K  +  DPR ++ G     + G + SG FD  S++EI+  WA++VVTGRARLGGIP+ VI  ETR V  ++PADPAN  +E + +Q AGQVWFP SAYKTAQ +RDFN+E LPL IFANWRGFSGGM DMY+Q+LKFG+YIVD L+ Y QP+ +YIPP  ELRGG+WVVLD TIN   +EM+AD + S GG+LEPEG VEIK+R+KDL+KTI+R+DP+C  +  +L      +   +K L   L AR + LLP+YHQ+A+ FA LHDTPG M  KG++S ++ W  +R  FY +LRR LLE               ++ ++I     E NH                               H  ++L+RWFVE +GA K+YLW  + VV  WLE      K+     I + +   +RD+ L  I+ LV+ +P++ M+ +  + Q L   +   +  +LST  + A
Sbjct: 1350 SPLCQRMGAMVAFRRFEEFTRNFDEVISCFANVQTDTLLFSKACTSLYSEED----SKSLREEPIHILNVAIQCADHMEDEALVPVFRAFVQSKKHILVDYGLRRITFLVAQEREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRNFDLTAVPCANHKMHLYLGAAKVKEGLEVTDHRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNNTSV-RTDCNHIFLNFVPTVIM-DPLKIEESVRDMVMRYGSRLWKLRVLQAEVKINIRQTTSDSAIPIRLFITNESGYYLDISLYREVTDSRSGNIMFHSFGN-KQGSLHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWG--SPE---KYPK-DILTYTELVLDSQGQLVEMNRLPGCNEVGMVAFKMRFKTPEYPE-GRDAVVIGNDITFQIGSFGIGEDFLYLRASEMARTEGIPQIYLAANSGARMGLAEEIKQIFQVAWVDPEDPHKGFRYLYLTPQDYTQISSQNSVHCKHIEDEGESRYVIVDVIGKDANLGVENLRGSGMIAGEASLAYEKTVTISMVTCRALGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHTNGVSHVTVPDDFEGVCTILEWLSFIPKDNRSPVPI--TTPS--DPIDREIEFTPTK--APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQVIRDFNKERLPLMIFANWRGFSGGMKDMYEQMLKFGAYIVDGLRLYEQPILIYIPPCAELRGGSWVVLDSTINPLCIEMYADKE-SRGGVLEPEGTVEIKFRKKDLVKTIRRIDPVCKKLVGQLGKAQLPDKD-RKELEGQLKAREELLLPIYHQVAVQFADLHDTPGHMLEKGIISDVLEWKTARTFFYWRLRRLLLE--------------AQVKQEILRASPELNH------------------------------EHTQSMLRRWFVETEGAVKAYLWDSNQVVVQWLEQHWS-AKDGLRSTIRENINYLKRDSVLKTIQSLVQEHPEVIMDCVAYLSQHLTPAERIQVAQLLSTTESPA 2446          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Mouse
Match: Acacb (acetyl-Coenzyme A carboxylase beta [Source:MGI Symbol;Acc:MGI:2140940])

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 641/1133 (56.58%), Postives = 815/1133 (71.93%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASV--AKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMD 3610
            VAS  EFV   GGNR I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D+   VPGG N  NYANV+LI+D+A R  V AVWAGWGHASENPKLPE+L KH I F+GPP EAMW LGDK+ASTI+AQ+  IPTLPWSG+GLT+            E     RH     G   S         +P+D+Y Q CV D +E L+ A +IGFP+MIKASEGGGGKGIRKA S+E+F  LF QVQ+E+PGSPIFLMK A++ARHLEVQ+LADQYG A+SLFGRDCS+QRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F FLELNPRLQVEHPCTE++ D+NLPA+QLQIAMG+PLHR+K+IR LY E P     I F  P   P   GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYL+ +LE+ESF  NDIDTGWLD++I+Q+VQ +  D  L  +C A+++ +       + +   +ER Q+  +  L NIVDV LI+  +KY +++ +     + LIMN   +E + H+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DP+VL SPS GKL+QYTVEDG HV + S YA MEVMK+ M L+   SG + YIKRPG IL+AGC VA L LDD   +  A+ FTG    + QT  +   KL+QVF   ++ L  ++ GYCLPEP+F+ KL+  V + M  LR P LPL+ELQE+M+ ++GRIP  VE+A+++ M+ YASN+TSVL QFP  +I  IL     +L ++++++ + M TQ I  LV +Y  G RG+MK  + +L  KY NVE  FQ+ H+DKCV  L EQ K     +++ IFSH  VA KN+L+ +LID L   +  L  +L   L   T L++SE+ KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF PENL++LILSET +FD++  FFYH N +V  A+LEVYVRR YIAYEL  +   +L +G  +VEF+F+LPS+HP+R    +  P S+ N D
Sbjct:  234 VASPAEFVTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADQYVPVPGGPNNNNYANVELIIDIAKRIPVQAVWAGWGHASENPKLPELLCKHEIAFLGPPSEAMWALGDKIASTIVAQTLQIPTLPWSGSGLTV------------EWTEDSRHQ----GKCIS---------VPEDVYEQGCVKDVDEGLQAAEKIGFPLMIKASEGGGGKGIRKAESAEDFPMLFRQVQSEIPGSPIFLMKLAQNARHLEVQVLADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIAAPAVFEFMEQCAVLLAKMVGYVSAGTVEYLYS-QDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPIPFETPLSPPIARGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLVNLLETESFQNNDIDTGWLDHLIAQRVQAEKPDIMLGVVCGALNVADAMFRTCMTEFLHSLERGQVLPADSLLNIVDVELIYGGIKYALKVARQSLTMFVLIMNGCHIEIDAHRLNDGGLLLSYNGSSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLMQYTVEDGDHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGVILEAGCVVARLELDDPSKVHAAQPFTGEL-PAQQTLPILGEKLHQVFHGVLENLTNVMSGYCLPEPFFSMKLKDWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKAVRRVMAQYASNITSVLCQFPSQQIATILDCHAATLQRKADREVFFMNTQSIVQLVQRYRSGTRGYMKAVVLDLLRKYLNVEHHFQQAHYDKCVINLREQFKPDMTQVLDCIFSHSQVAKKNQLVTMLIDELCGPDPTLSDELTSILCELTQLSRSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETTIFDVLPTFFYHENKVVCMASLEVYVRRGYIAYELNSLQHRELPDGTCVVEFQFMLPSSHPNR----MAVPISVSNPD 1335          

HSP 2 Score: 1167.53 bits (3019), Expect = 0.000e+0
Identity = 597/1164 (51.29%), Postives = 799/1164 (68.64%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEEN-----DQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGG-EFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            SP CQRMGAM AF+  +EF   FDE++  F+++Q +         ++ + +D    S +++EEPIHI NVA +    +ED+    +   F   KK + ++ G+RR+TFL+     FP++FTFRA+++F EDRIYRHLEPALAFQLE++RMRN+DL  +P  N +MHLYL  AKV EG EVTD+RFF+R+IIRH+DL+TKEASFEY+ NE ER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D  ++EE+VR MVMRYGSRLWKLRV QAE+K+ +R +     IP+R+++ NE GY L+IS+Y+EV D  +G I F SFGN K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL  +W   +PE   + P  ++LTY EL+LD    +VE+ ++PG N +GMVA++M+  TPEYPE GR+ ++I ND+T+++GSF I ED L+L+ASE+AR  GIP+I+ A+N GAR+GLAEE K IF +AW+D  DP KGF+YLYLTP DY Q+   N+V C+ IEDEGE+RY I D+IGK+  +GVENLR SGMIAGE SLAY++ VTIS+V+ RA+GIGAYLVRLG RVIQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM  NGVSH  V D+ +G+  +L+WLS+IP     P+P+    P+  DPI+R + + P K  +  DPR ++ G     + G + SG FD  S++EI+  WA++VVTGRARLGGIP+ VI  ETR V  ++PADPAN  +E + +Q AGQVWFP SAYKTAQ +RDFN+E LPL IFANWRGFSGGM DMY+Q+LKFG+YIVD L+ Y QP+ +YIPP  ELRGG+WVVLD TIN   +EM+AD + S GG+LEPEG VEIK+R+KDL+KTI+R+DP+C  +  +L      +   +K L   L AR + LLP+YHQ+A+ FA LHDTPG M  KG++S ++ W  +R  FY +LRR LLE               ++ ++I     E NH                               H  ++L+RWFVE +GA K+YLW  + VV  WLE      K+     I + +   +RD+ L  I+ LV+ +P++ M+ +  + Q L   +   +  +LST  + A
Sbjct: 1350 SPLCQRMGAMVAFRRFEEFTRNFDEVISCFANVQTDTLLFSKACTSLYSEED----SKSLREEPIHILNVAIQCADHMEDEALVPVFRAFVQSKKHILVDYGLRRITFLVAQEREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRNFDLTAVPCANHKMHLYLGAAKVKEGLEVTDHRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNNTSV-RTDCNHIFLNFVPTVIM-DPLKIEESVRDMVMRYGSRLWKLRVLQAEVKINIRQTTSDSAIPIRLFITNESGYYLDISLYREVTDSRSGNIMFHSFGN-KQGSLHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWG--SPE---KYPK-DILTYTELVLDSQGQLVEMNRLPGCNEVGMVAFKMRFKTPEYPE-GRDAVVIGNDITFQIGSFGIGEDFLYLRASEMARTEGIPQIYLAANSGARMGLAEEIKQIFQVAWVDPEDPHKGFRYLYLTPQDYTQISSQNSVHCKHIEDEGESRYVIVDVIGKDANLGVENLRGSGMIAGEASLAYEKTVTISMVTCRALGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHTNGVSHVTVPDDFEGVCTILEWLSFIPKDNRSPVPI--TTPS--DPIDREIEFTPTK--APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQVIRDFNKERLPLMIFANWRGFSGGMKDMYEQMLKFGAYIVDGLRLYEQPILIYIPPCAELRGGSWVVLDSTINPLCIEMYADKE-SRGGVLEPEGTVEIKFRKKDLVKTIRRIDPVCKKLVGQLGKAQLPDKD-RKELEGQLKAREELLLPIYHQVAVQFADLHDTPGHMLEKGIISDVLEWKTARTFFYWRLRRLLLE--------------AQVKQEILRASPELNH------------------------------EHTQSMLRRWFVETEGAVKAYLWDSNQVVVQWLEQHWS-AKDGLRSTIRENINYLKRDSVLKTIQSLVQEHPEVIMDCVAYLSQHLTPAERIQVAQLLSTTESPA 2446          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Mouse
Match: Acaca (acetyl-Coenzyme A carboxylase alpha [Source:MGI Symbol;Acc:MGI:108451])

HSP 1 Score: 273.863 bits (699), Expect = 6.427e-82
Identity = 133/239 (55.65%), Postives = 166/239 (69.46%), Query Frame = 2
Query:  218 VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKAS 934
             VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQDLY +  V D ++ L+ A ++G+P+MIKAS
Sbjct:  100 TVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKAS 312          
BLAST of Acetyl-CoA carboxylase 1 vs. UniProt/SwissProt
Match: sp|P11029|ACAC_CHICK (Acetyl-CoA carboxylase OS=Gallus gallus OX=9031 GN=ACAC PE=1 SV=1)

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 634/1117 (56.76%), Postives = 819/1117 (73.32%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            VAS  EFV   GGNR I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPW+G+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L  A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR +Y   P     I+F N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +I++KVQ +  D  L  +C A+H+ +     S S +   +ER Q+  +  L N VDV LI++  KY +++ +  P +Y +IMN++ VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QY VEDG HVF+   +A +EVMK+ M L    SGCIHY+KRPGA+LD GC +A L LDD   +++AE  TG+      TA    KL+++F   +  L  +++GYCLPEPYF+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R
Sbjct:  102 VASPAEFVTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWNGSGLRVDWQENDLQKRIL--------------------------NVPQELYEKGYVKDADDGLRAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPASIATSVVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVMYGVSPWGDGSIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQQNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSFRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGRKYVLKVTRQSPNSYVVIMNSSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCFAEIEVMKMVMTLTAGESGCIHYVKRPGAVLDPGCVIAKLQLDDPSRVQQAELHTGTLPQIQSTALRGEKLHRIFHYVLDNLVNVMNGYCLPEPYFSSKVKGWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSDMNAVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELINILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNR 1191          

HSP 2 Score: 1213.36 bits (3138), Expect = 0.000e+0
Identity = 618/1165 (53.05%), Postives = 813/1165 (69.79%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCS-----TNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  F     ++      TF +  + S        +EEPIHI NVA + D  V+DD    +  +F   KK V IE GIRR+TFL+     FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  TGQI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  T+YVYD P++  Q+L  +W   N    L  P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L TPEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ A+N GARIGLAEE +++F++AW D  DP KG+KYLYLTP DY+++  LN+V CE +ED GE+RYKITDIIGKEDG+G+ENLR SGMIAGE+SLAY+ I+TI+LV+ RA+GIGAYLVRLG R IQVENSHIILTG  ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P     P+P+      + DPI+R + ++P K  +  DPR ++ G  + +  G++ SG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA+ DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV +YIPP  ELRGG+W V+DPTIN  +MEM+AD + S GGILEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +   +K L S L  R + L+P+YHQ+A+ FA LHDTPGRM  KG ++ ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+YLW  +  +  WLE Q+ + +      + + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1219 TPPCQRMGGMVSFRTFEDFVRIFDEVMSCFCDSPPQSP-----TFPEAGHASLYDEDKAAREEPIHILNVAIKTDGDVDDDGLAAMFREFTQSKKSVLIEHGIRRLTFLVAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTGQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTSYVYDIPEMFRQSLIKLWDSMNEHAFLPTPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKTPEYPE-GRDIIVIGNDITYRIGSFGPQEDVLFLRASELARTHGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPDDPYKGYKYLYLTPQDYKKVSALNSVHCEHVEDNGESRYKITDIIGKEDGLGIENLRGSGMIAGESSLAYESIITINLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGCGALNKVLGREVYTSNNQLGGIQIMHNNGVTHGTVCDDFEGVYTILLWLSYMPKSVYSPVPIL----KVKDPIDRTIDFVPTK--TPYDPRWMLAGRPNPSQKGQWQSGFFDNGSFLEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAINDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLIYIPPQAELRGGSWAVIDPTINPRHMEMYADRE-SRGGILEPEGTVEIKFRRKDLVKTMRRVDPVYMRL-AERLGTPELSAADRKDLESKLKEREEFLIPIYHQVAMQFADLHDTPGRMQEKGAITDILDWKTSRTFFYWRLRRLLLE------------------------------DVVKKKIHDAN--PELTDGQIQA-----------MLRRWFVEVEGTVKAYLWDSNKDLVEWLEKQL-MEEEGVRSVVDENIKYISRDYILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEIVRILSTMDSPS 2322          
BLAST of Acetyl-CoA carboxylase 1 vs. UniProt/SwissProt
Match: sp|Q5SWU9|ACACA_MOUSE (Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1)

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 837/1157 (72.34%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQDLY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL RIK+IR +Y   P     I+F N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF +N IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ +++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  101 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFASNLN-----HYGMTHVASVSDVLLDNAF 1225          

HSP 2 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 822/1180 (69.66%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDEIM  F     ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   +E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ A+N GARIGLAEE +++F++AW+D  DP KG+KYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+G ENLR SGMIAGE+SLAYDE++TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+  +QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S G +LEPEG VEIK+R+KDL+KT++R+DP+ + +   L + +   T+ +K L S L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +  WLE Q+   ++     I + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1226 TPPCQRMGGMVSFRTFEDFVRIFDEIMGCFCDSPPQSP-----TFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPD-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEVITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTINPRHMEMYADRE-SRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTE-RKELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE-EDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPS 2344          
BLAST of Acetyl-CoA carboxylase 1 vs. UniProt/SwissProt
Match: sp|Q13085|ACACA_HUMAN (Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2)

HSP 1 Score: 1293.87 bits (3347), Expect = 0.000e+0
Identity = 640/1157 (55.32%), Postives = 839/1157 (72.52%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +  Q +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P   + I+F +    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF MN IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSV+ SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ K++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  102 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNSF 1226          

HSP 2 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 614/1180 (52.03%), Postives = 821/1180 (69.58%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  FS    ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   ++ GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L +P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M   +PEYPE GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ ++N GARIGLAEE +++F++AW+D  DP KG++YLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+GIG ENLR SGMIAGE+SLAY+EI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H  V D+ +G+  +L WLSY+P   +  +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+   QPV VYIPP  ELRGG+WVV+D +IN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +T  +K L + L  R + L+P+YHQ+A+ FA LHDTPGRM  KGV+S ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +A WLE Q+   ++  H  I + ++C  RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1227 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPE-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPL-LNS---KDPIDRIIEFVPTK--TPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSTAERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE-EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPS 2345          
BLAST of Acetyl-CoA carboxylase 1 vs. UniProt/SwissProt
Match: sp|Q28559|ACACA_SHEEP (Acetyl-CoA carboxylase 1 OS=Ovis aries OX=9940 GN=ACACA PE=2 SV=1)

HSP 1 Score: 1288.86 bits (3334), Expect = 0.000e+0
Identity = 638/1157 (55.14%), Postives = 834/1157 (72.08%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +    +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P     I+F N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF +N IDTGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++  K  +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSVL SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ +++  V   M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L   +  L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  102 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIARRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLCVDWHENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLARMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLSAHTLLNTVDVELIYEGEKIVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAAESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVEGLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNAF 1226          

HSP 2 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 615/1180 (52.12%), Postives = 819/1180 (69.41%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  F     ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   +E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L  P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ A+N GARIGLAEE +++F++AW+D  DP KG+KYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+G ENLR SGMIAGE+SLAYDEI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L WLSY+P      +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+  +QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     + + +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +  WLE Q+   ++     I + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1227 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDSLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSSQAFLPPPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVYSSVPL-LNS---KDPIDRVIEFVPTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSARERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE-EDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPS 2345          
BLAST of Acetyl-CoA carboxylase 1 vs. UniProt/SwissProt
Match: sp|Q9TTS3|ACACA_BOVIN (Acetyl-CoA carboxylase 1 OS=Bos taurus OX=9913 GN=ACACA PE=2 SV=1)

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 637/1157 (55.06%), Postives = 834/1157 (72.08%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR W+YE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG+GL +    +   K +L                          ++PQ+LY +  V D ++ L+ A ++G+P+MIKASEGGGGKGIRK +++++F +LF QVQ EVPGSPIF+M+ A+ +RHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A   VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPL+RIK+IR +Y   P     I+F N    P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF +N I TGWLD +I++KVQ +  D  L  +C A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMN + VE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPSVL SPS GKL+QY VEDG HVF+   YA +EVMK+ M L    SGCIHY+KRPGA LD GC +A + LD+   +++AE  TGS      TA    KL++VF   +  L  +++GYCLP+P+F+ +++  V + M  LRDP LPL+ELQ++M+ +SGRIP NVE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+   + N ++N IFSH  V  KN L+ +LID L      L  +L + L   T L+K+ N+KV+LR+RQVLIA+  P+YE+R NQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y ++   S+++      F
Sbjct:  102 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLCVDWHENDFSKRIL--------------------------NVPQELYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLARMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIGTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLTAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDVSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAAESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTRKNLLVTMLIDQLCGRGPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRLNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMTHVASVSDVLLDNAF 1226          

HSP 2 Score: 1182.55 bits (3058), Expect = 0.000e+0
Identity = 615/1180 (52.12%), Postives = 818/1180 (69.32%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTN-----IKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD--VNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMG M +F+T ++F  +FDE+M  F     ++      TF +  + S        ++EPIHI NVA + D  +EDD    +  +F  + K   +E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  IP  N +MHLYL  AKV  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  + +  RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTY+YD P++  Q+L  +W   + +  L  P +  ++LTY EL+LDD   +V + ++PG N IGMVAW+M L +PEYP+ GR+II+I ND+TY++GSF   ED+LFL+ASELAR  GIPRI+ A+N GARIGLAEE +++F++AW+D  DP KG+KYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+G ENLR SGMIAGE+SLAYDEI+TISLV+ RA+GIGAYLVRLG R IQVENSH+ILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  +L WLSY+P      +P+ LN+    DPI+R + ++P K  +  DPR ++ G       G++LSG FD  S+ EI+  WA++VV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KT QA++DFNREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+  +QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD + S G +LEPEG VEIK+R KDL+KT++R+DP+ + + +E L     +   +K L S L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR  FY +LRR LLE                              D VKK+    N  P    G I +           +L+RWFVE +G  K+Y+W ++  +  WLE Q+   ++     I + ++   RD  L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM + +
Sbjct: 1227 TPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSP-----TFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDSLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGD-KQGPLHGMLINTPYVTKDQLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSSQAFLPPPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPD-GRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVYSSVPL-LNS---KDPIDRVIEFVPTK--APYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTINPRHMEMYADRE-SRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHL-AERLGTPELSVAERKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLE------------------------------DLVKKKI--HNANPELTDGQIQA-----------MLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE-EDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPS 2345          
BLAST of Acetyl-CoA carboxylase 1 vs. TrEMBL
Match: A0A2D0QDC1 (acetyl-CoA carboxylase 1 isoform X4 OS=Ictalurus punctatus OX=7998 GN=acaca PE=4 SV=1)

HSP 1 Score: 2509.95 bits (6504), Expect = 0.000e+0
Identity = 1289/2441 (52.81%), Postives = 1687/2441 (69.11%), Query Frame = 2
Query:  128 DLDINSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYR----PASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDM-----HSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS-----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            D  ++S+    S   +V+Q    R  ++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+    +   + ++                          ++P +LY Q CV D    L+ A ++G+P+M+KASEGGGGKGIRK +S+++F +LF QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F   +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFSF E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VD  LI++ +KY +++ +  P +Y LIMNN+SVE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L    SGCIHY+KR GA+L+ GC +A L LDD   +++AE  TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+PKL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHM+  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+LPS+HP+R N+ T+ R    P  +DN  +                R+ S            + +T S D+      + ND                         L+  M F +      M    S  D+      +PPCQRMGAM +F++  EF    ++++  FS     S       N V+  ++    + +I +EPIHI NVA + D  ++DD    +  +F   KK +  E GIRR+TFL+     FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL+ +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWR+ L TPEYP  GR+I++ISND+T+K+GSF   ED+LF +ASE+AR+ GIPR++ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL+WLSY+P   + P+P+     A  DPI+R V ++P K  +  DPR ++ G    N  G +++G FD  S+ EI+  WA+SVV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++D NREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     N   +K L   L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR+ FY +LRR LLE                              D VKK+    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM A
Sbjct:   61 DGPLHSMRPSMSGLHLVKQGRDRRRADLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEWSEADQKRRII--------------------------NVPSELYEQGCVQDVEAGLKAAEKVGYPVMVKASEGGGGKGIRKVNSADDFPNLFRQVQTEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFENMERCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRMLYAVQPWGDSPIDFEALSTAPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSFGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTILGLVSGALHVADVNFRNSVSNFLHSLERGQVLAAHTLLNTVDTELIYEGVKYALKVTRQSPNSYVLIMNNSSVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNRTCVFEKENDPSLLRSPSAGKLIQYTVEDGGHVFTGQCYAEIEVMKMVMTLTAAESGCIHYVKRAGAVLEPGCVIAKLQLDDPSRVQQAELHTGALPSVQAVALRGEKLHRVFHNTLDHLVHIMNGYCLPEPFFSPKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMRAVVMDLLRQYLKVEVQFQHGHYDKCVFTLREENKGDMANVLNYIFSHAQVTKKNSLVTMLIDQLCGRDPTLTDELMGILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPSSHPNRGNIPTLNRKLSVPLLLDNRTK-----------ARAAKRRASDA----------STATTSYDAATASAAASND-------------------------LSDRMSFSSNLNHYGMVHVASVSDVLLDTSFTPPCQRMGAMVSFRSFQEFTRNINDVLSCFSDSPPTSPSFPEGGNPVLYVEED---NKSILDEPIHILNVAIKTDSDIDDDSLASMFREFTQSKKSMLFEHGIRRLTFLVAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGAEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDLPEMFRQALKKLWQSMDTYAHLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRITLRTPEYP-AGRDIVVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRVYIAANSGARIGLAEEIRHMFHVAWQDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVCDDFEGVYTLLQWLSYMPKNTSSPVPLL----AAKDPIDRQVEFVPTK--APYDPRWMLAGRASPNPKGAWVNGFFDHGSFMEIMQPWAQSVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDLNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELNVSERKELEGKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVLEWRTSRQFFYWRLRRLLLE------------------------------DTVKKKIQQANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLEKQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDA 2369          
BLAST of Acetyl-CoA carboxylase 1 vs. TrEMBL
Match: A0A2D0QAQ5 (acetyl-CoA carboxylase 1 isoform X3 OS=Ictalurus punctatus OX=7998 GN=acaca PE=4 SV=1)

HSP 1 Score: 2503.01 bits (6486), Expect = 0.000e+0
Identity = 1289/2448 (52.66%), Postives = 1687/2448 (68.91%), Query Frame = 2
Query:  128 DLDINSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYR----PASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDM-----HSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS-----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            D  ++S+    S   +V+Q    R  ++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+    +   + ++                          ++P +LY Q CV D    L+ A ++G+P+M+KASEGGGGKGIRK +S+++F +LF QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F   +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFSF E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VD  LI++ +KY +++ +  P +Y LIMNN+SVE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L    SGCIHY+KR GA+L+ GC +A L LDD   +++AE  TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+PKL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHM+  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+LPS+HP+R N+ T+ R    P  +DN  +                R+ S            + +T S D+      + ND                         L+  M F +      M    S  D+      +PPCQRMGAM +F++  EF    ++++  FS     S       N V+  ++    + +I +EPIHI NVA + D  ++DD    +  +F   KK +  E GIRR+TFL+     FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL+ +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWR+ L TPEYP  GR+I++ISND+T+K+GSF   ED+LF +ASE+AR+ GIPR++ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL+WLSY+P   + P+P+     A  DPI+R V ++P K  +  DPR ++ G    N  G +++G FD  S+ EI+  WA+SVV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++D NREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     N   +K L   L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR+ FY +LRR LLE                              D VKK+    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM A
Sbjct:   61 DGPLHSMRPSMSGLHLVKQGRDRRRADLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEWSEADQKRRII--------------------------NVPSELYEQGCVQDVEAGLKAAEKVGYPVMVKASEGGGGKGIRKVNSADDFPNLFRQVQTEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFENMERCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRMLYAVQPWGDSPIDFEALSTAPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSFGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTILGLVSGALHVADVNFRNSVSNFLHSLERGQVLAAHTLLNTVDTELIYEGVKYALKVTRQSPNSYVLIMNNSSVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNRTCVFEKENDPSLLRSPSAGKLIQYTVEDGGHVFTGQCYAEIEVMKMVMTLTAAESGCIHYVKRAGAVLEPGCVIAKLQLDDPSRVQQAELHTGALPSVQAVALRGEKLHRVFHNTLDHLVHIMNGYCLPEPFFSPKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMRAVVMDLLRQYLKVEVQFQHGHYDKCVFTLREENKGDMANVLNYIFSHAQVTKKNSLVTMLIDQLCGRDPTLTDELMGILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPSSHPNRGNIPTLNRKLSVPLLLDNRTK-----------ARAAKRRASDA----------STATTSYDAATASAAASND-------------------------LSDRMSFSSNLNHYGMVHVASVSDVLLDTSFTPPCQRMGAMVSFRSFQEFTRNINDVLSCFSDSPPTSPSFPEGGNPVLYVEED---NKSILDEPIHILNVAIKTDSDIDDDSLASMFREFTQSKKSMLFEHGIRRLTFLVAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGAEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGPNDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDLPEMFRQALKKLWQSMDTYAHLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRITLRTPEYP-AGRDIVVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRVYIAANSGARIGLAEEIRHMFHVAWQDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVCDDFEGVYTLLQWLSYMPKNTSSPVPLL----AAKDPIDRQVEFVPTK--APYDPRWMLAGRASPNPKGAWVNGFFDHGSFMEIMQPWAQSVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDLNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELNVSERKELEGKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVLEWRTSRQFFYWRLRRLLLE------------------------------DTVKKKIQQANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLEKQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDA 2376          
BLAST of Acetyl-CoA carboxylase 1 vs. TrEMBL
Match: A0A2D0Q9K1 (acetyl-CoA carboxylase 1 isoform X2 OS=Ictalurus punctatus OX=7998 GN=acaca PE=4 SV=1)

HSP 1 Score: 2499.93 bits (6478), Expect = 0.000e+0
Identity = 1282/2423 (52.91%), Postives = 1673/2423 (69.05%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYR----PASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDM-----HSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS-----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+    +   + ++                          ++P +LY Q CV D    L+ A ++G+P+M+KASEGGGGKGIRK +S+++F +LF QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F   +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFSF E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VD  LI++ +KY +++ +  P +Y LIMNN+SVE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L    SGCIHY+KR GA+L+ GC +A L LDD   +++AE  TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+PKL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHM+  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+LPS+HP+R N+ T+ R    P  +DN  +                R+ S            + +T S D+      + ND                         L+  M F +      M    S  D+      +PPCQRMGAM +F++  EF    ++++  FS     S       N V+  ++    + +I +EPIHI NVA + D  ++DD    +  +F   KK +  E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL+ +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWR+ L TPEYP  GR+I++ISND+T+K+GSF   ED+LF +ASE+AR+ GIPR++ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL+WLSY+P   + P+P+     A  DPI+R V ++P K  +  DPR ++ G    N  G +++G FD  S+ EI+  WA+SVV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++D NREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     N   +K L   L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR+ FY +LRR LLE                              D VKK+    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM A
Sbjct:   94 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEWSEADQKRRII--------------------------NVPSELYEQGCVQDVEAGLKAAEKVGYPVMVKASEGGGGKGIRKVNSADDFPNLFRQVQTEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFENMERCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRMLYAVQPWGDSPIDFEALSTAPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSFGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTILGLVSGALHVADVNFRNSVSNFLHSLERGQVLAAHTLLNTVDTELIYEGVKYALKVTRQSPNSYVLIMNNSSVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNRTCVFEKENDPSLLRSPSAGKLIQYTVEDGGHVFTGQCYAEIEVMKMVMTLTAAESGCIHYVKRAGAVLEPGCVIAKLQLDDPSRVQQAELHTGALPSVQAVALRGEKLHRVFHNTLDHLVHIMNGYCLPEPFFSPKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMRAVVMDLLRQYLKVEVQFQHGHYDKCVFTLREENKGDMANVLNYIFSHAQVTKKNSLVTMLIDQLCGRDPTLTDELMGILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPSSHPNRGNIPTLNRKLSVPLLLDNRTK-----------ARAAKRRASDA----------STATTSYDAATASAAASND-------------------------LSDRMSFSSNLNHYGMVHVASVSDVLLDTSFTPPCQRMGAMVSFRSFQEFTRNINDVLSCFSDSPPTSPSFPEGGNPVLYVEED---NKSILDEPIHILNVAIKTDSDIDDDSLASMFREFTQSKKSMLFEHGIRRLTFLVAQKDFRKQINCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGAEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDLPEMFRQALKKLWQSMDTYAHLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRITLRTPEYP-AGRDIVVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRVYIAANSGARIGLAEEIRHMFHVAWQDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVCDDFEGVYTLLQWLSYMPKNTSSPVPLL----AAKDPIDRQVEFVPTK--APYDPRWMLAGRASPNPKGAWVNGFFDHGSFMEIMQPWAQSVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDLNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELNVSERKELEGKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVLEWRTSRQFFYWRLRRLLLE------------------------------DTVKKKIQQANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLEKQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDA 2384          
BLAST of Acetyl-CoA carboxylase 1 vs. TrEMBL
Match: A0A2D0QCC9 (acetyl-CoA carboxylase 1 isoform X1 OS=Ictalurus punctatus OX=7998 GN=acaca PE=4 SV=1)

HSP 1 Score: 2492.23 bits (6458), Expect = 0.000e+0
Identity = 1282/2430 (52.76%), Postives = 1673/2430 (68.85%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYR----PASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDM-----HSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS-----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDM--ELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTA 7381
            VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K+ I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+    +   + ++                          ++P +LY Q CV D    L+ A ++G+P+M+KASEGGGGKGIRK +S+++F +LF QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE ME+ A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLPA+QLQIAMGIPLHRIK+IR LY   P   + I+F   +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFSF E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +     S S +   +ER Q+  +  L N VD  LI++ +KY +++ +  P +Y LIMNN+SVE +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L    SGCIHY+KR GA+L+ GC +A L LDD   +++AE  TG+  +    A    KL++VF   +  L  I++GYCLPEP+F+PKL++ V + M  LRDP LPL+ELQ++M+ +SGRIP  VE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+++SE++ + M TQ I  LV KY  G+RGHM+  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   IVEF+F+LPS+HP+R N+ T+ R    P  +DN  +                R+ S            + +T S D+      + ND                         L+  M F +      M    S  D+      +PPCQRMGAM +F++  EF    ++++  FS     S       N V+  ++    + +I +EPIHI NVA + D  ++DD    +  +F   KK +  E GIRR+TFL+                    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD P++  QAL+ +W   +    L    +  ELLT+ EL+LD    +V++ ++PG N IGMVAWR+ L TPEYP  GR+I++ISND+T+K+GSF   ED+LF +ASE+AR+ GIPR++ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL+WLSY+P   + P+P+     A  DPI+R V ++P K  +  DPR ++ G    N  G +++G FD  S+ EI+  WA+SVV GRARLGGIP+ V+  ETR V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++D NREGLPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     N   +K L   L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR+ FY +LRR LLE                              D VKK+    N+        ++ G +        +L+RWFVE +GA K+YLW  +  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM A
Sbjct:   94 VASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGTGLTVEWSEADQKRRII--------------------------NVPSELYEQGCVQDVEAGLKAAEKVGYPVMVKASEGGGGKGIRKVNSADDFPNLFRQVQTEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFENMERCAVKLAKMVGYVSAGTVEYLYS-QDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRMLYAVQPWGDSPIDFEALSTAPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSFGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTILGLVSGALHVADVNFRNSVSNFLHSLERGQVLAAHTLLNTVDTELIYEGVKYALKVTRQSPNSYVLIMNNSSVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNRTCVFEKENDPSLLRSPSAGKLIQYTVEDGGHVFTGQCYAEIEVMKMVMTLTAAESGCIHYVKRAGAVLEPGCVIAKLQLDDPSRVQQAELHTGALPSVQAVALRGEKLHRVFHNTLDHLVHIMNGYCLPEPFFSPKLKEWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPAVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQKYRSGIRGHMRAVVMDLLRQYLKVEVQFQHGHYDKCVFTLREENKGDMANVLNYIFSHAQVTKKNSLVTMLIDQLCGRDPTLTDELMGILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPSSHPNRGNIPTLNRKLSVPLLLDNRTK-----------ARAAKRRASDA----------STATTSYDAATASAAASND-------------------------LSDRMSFSSNLNHYGMVHVASVSDVLLDTSFTPPCQRMGAMVSFRSFQEFTRNINDVLSCFSDSPPTSPSFPEGGNPVLYVEED---NKSILDEPIHILNVAIKTDSDIDDDSLASMFREFTQSKKSMLFEHGIRRLTFLVAQKDFRKQINCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGAEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGPNDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDLPEMFRQALKKLWQSMDTYAHLPKCPLPSELLTFTELVLDSQGQLVQMNRLPGGNEIGMVAWRITLRTPEYP-AGRDIVVISNDITHKIGSFGPQEDVLFQQASEMARESGIPRVYIAANSGARIGLAEEIRHMFHVAWQDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVCDDFEGVYTLLQWLSYMPKNTSSPVPLL----AAKDPIDRQVEFVPTK--APYDPRWMLAGRASPNPKGAWVNGFFDHGSFMEIMQPWAQSVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDLNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRVDPVYMGL-AERLGTPELNVSERKELEGKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDVLEWRTSRQFFYWRLRRLLLE------------------------------DTVKKKIQQANSE-------LTDGQVQA------MLRRWFVEAEGAVKAYLWDSNEDVVEWLEKQL-AEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDA 2391          
BLAST of Acetyl-CoA carboxylase 1 vs. TrEMBL
Match: A0A2I4B3H1 (acetyl-CoA carboxylase 1 isoform X2 OS=Austrofundulus limnaeus OX=52670 GN=acaca PE=4 SV=1)

HSP 1 Score: 2489.92 bits (6452), Expect = 0.000e+0
Identity = 1293/2446 (52.86%), Postives = 1698/2446 (69.42%), Query Frame = 2
Query:  128 DLDINSISKEKSETKIVRQ-ESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASV--AKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQ-NIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMH-SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS-----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQ-------IQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSE-----YNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVN--GEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            D  I+++    S   +V+Q    R I++ R   VAS  EFV   GGN+ I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L KH I F+GPP +AMW LGDK+AS+I+AQ+  IPTLPWSG GLT+                            T  N +K   ++P +LY   C+ D ++ L+ A +IG+P+M+KASEGGGGKGIRK + +++F +LF QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYL+  +   F+FLELNPRLQVEHPCTE+V D+NLPA+ LQIAMGIPLHRIK+IR LY   P     I+F + +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++ +KY +++ +  P +Y +IMNN+  E +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GKL+QYTVEDG HVF+   YA +EVMK+ M L    SGCIHY+KR GA L+ GC +A L LDD   I++AE +TG+   S QT ++   KL++VF   +  L  I+ GYCLPEP+F+ KL++ V + M  +RDP LPL+ELQE+M+ +SGRIP  VE++IK++M+ YASN+TSVL QFP  +I +IL +   +L+K+SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DK V  L E+   +  N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+                          NRK  T  P   K+L              V D+ +      P++ ++T+   S D  +FS    ++      +  N++D L  LD   +PPCQRMGAM +F+T  EF    ++++  FS     S       N V+  ++    + +I+EEP+HI NVA + D  ++DD    +  +F   KK +  E GIRR+TFL+     FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQ       I F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL+ +W       Y P+  L +   ELLT+ EL+LD    +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LFL+ASE+AR+  IPRI+ A+N GARIGLAEE +++F++AW D  DP KGFKYLYLTP DY+++  LN+V CE +EDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+T++LV+ RA+G GAYLVRLG R IQV+NSHIILTGA ALNKVLG +VYTSN+QLGG+QIM NNGV+H+ V D+ +G+  LL+WLSY+P   + P+P+        DPI+R V ++P K  +  DPR ++ G  + N  G + SG FD  S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++D NREGLPL +FANWRGFSGGM DMYDQ++KFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R+KDL+KT++R+DP+ + + +E L     +   +K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR+ FY +LRR LLE                              D V K+  + N+        ++ G I        +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM  +A
Sbjct:   70 DGPIHNLRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLQKHGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGAGLTVEW--------------------------TEDNQKKKIINVPPELYDCGCIQDVDDGLKAAEKIGYPVMVKASEGGGGKGIRKVNCADDFPNLFRQVQTEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSAGTVEYLFS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPAAHLQIAMGIPLHRIKDIRMLYGVQPWGDCLIDFESLSNTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQQNSIDTGWLDRLISEKMQAERPDTMLGIVSGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNNSVAEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSLLRSPSAGKLIQYTVEDGGHVFAGQCYAEIEVMKMVMTLTAAESGCIHYVKRAGAALEPGCVIAKLQLDDPSRIQQAELYTGTL-PSVQTVALRGEKLHRVFHNTLDHLVHIMHGYCLPEPFFSAKLKEWVERLMKTMRDPSLPLLELQEIMTSVSGRIPPAVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNKKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLKVEIQFQNGHYDKXVFALREENKGDMVNVVNYIFSHAKVTKKNLLVTMLIDQLCGRDPTLTDELMTILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTL--------------------------NRKMPTPVPDNKKALKRNLQLSKAQDL-KVHDTQDSEFKDDPEK-KSTSDGESFDRMSFS---SNLNHYGMVHMANVSDVL--LDTSFTPPCQRMGAMVSFRTFQEFTRNINDVLSCFSDSPPTSPMFPEGGNPVLYGEED---NKSIQEEPVHILNVAIKTDSDIDDDSLAAMFREFTQSKKSLLFEHGIRRLTFLVAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGPKDRQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALKKLWHSSQAYAYLPKCPLPS---ELLTFTELVLDAQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDVLFLRASEMARECSIPRIYIAANSGARIGLAEEIRHMFHVAWQDPTDPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGXGAYLVRLGQRTIQVDNSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTLLQWLSYMPKCMSSPVPILCAK----DPIDRAVEFVPTK--TPYDPRWMLAGRPNQNPKGSWQSGFFDHSSFMEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDLNREGLPLIVFANWRGFSGGMKDMYDQVIKFGAYIVDGLREYKQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRKKDLVKTMRRIDPVYM-VLAERLGTPELSPADRKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWQTSRQFFYWRLRRLLLE------------------------------DTVTKKIQAANSE-------LTDGQIQA------MLRRWFVEAEGTVKAYLWDNNEEVVGWLERQL-AEEEGARSIIDENIKYIRRDHLLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMETSA 2392          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Cavefish
Match: acacb (acetyl-CoA carboxylase beta [Source:ZFIN;Acc:ZDB-GENE-060526-132])

HSP 1 Score: 1160.98 bits (3002), Expect = 0.000e+0
Identity = 606/1180 (51.36%), Postives = 804/1180 (68.14%), Query Frame = 2
Query: 3908 LDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSS-IQEENDQNTVVTFQDPPYCSTNI----KEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGT------------FPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGV--TDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNI-LSTMTAAA 7387
            L+  SPPCQRMGAM AF+  ++F+  FDE++  F+  + E    +      D       +     E PIHI NV+ +     +DD      SDF   KK V  E GIRR+TFL+    T            FP++FTFRA+++FKEDRIYR+LEPALAFQLE+NRMRN+DL+ +P  N +MHLYL  A+V EG EVTDYRFF+R+I+RH+DLVTKEASFEY+ NE ER LLE+LD LE+A ++    RT+CNHIFLNF PT+ + D  ++EE VR M+M YG RLWKLRV QAELKM +R++  G  IP+R+++ NE GY L+IS+YKEV D TTGQI F+S+  GK G LHGM++  PY TKD LQ KRFQA    TTYVYD+P+L  QAL  +W   +      +   ++L   EL+LD    +V++ ++PG N +GMVA+RMK+ TPEYPE GREII+I ND+TYK+GSF   ED LFL+ASEL+R  GIPRI+ ++N GARIGLAEE +N F +AW D  DP KG KYLYLTP DY ++   N+V C  +E+EGE+RY ITDIIGK++G+GVENLR SGMIAGE+S AY+EI+TIS+V+ RA+GIGAYLVRLG RVIQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  +L+WLSY+P  K+ P+PV        DP++R + ++P K  +  DPR ++ G     V G + SG FD  ++ E++  WA++VV GRARLGGIP+ VI  ETR V  ++PADPAN  +E + VQ AGQVWFP SAYKTAQA++DF RE LPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ + QPV VYIPPH ELRGG+WVV+DPTIN +YME++AD + S GG+LE EG VEIK+R+KDL+KT++R+DP   S  +E LS    + + +  L + L AR + LLP+YHQ+A+ F  LHDTPGRM  KGV++ ++ W ++R  FY +LRR LLE    S +        + + D++NG                                    H  ++L+RWF+E +G  K+YLW ++  V  WLE  +   ++     I + ++  +RD TL  I+ LV  NP++ ++ I+ + Q +  +Q + ++++  STM  AA
Sbjct: 1140 LNSLSPPCQRMGAMVAFQCFEDFKRCFDEVISCFAEPLCESALFSEASGLYDEESSKVRLIRHSAENPIHIINVSIKTADTEDDDALVTAFSDFSQSKKAVLYEYGIRRITFLVAQKVTYVFCFFVFLQREFPKFFTFRARDEFKEDRIYRNLEPALAFQLELNRMRNFDLKAVPCANHKMHLYLGAARVEEGAEVTDYRFFIRAIVRHSDLVTKEASFEYLQNEGERLLLEALDELEVAFSN-TPTRTDCNHIFLNFVPTVIM-DPIKIEENVRSMIMHYGRRLWKLRVLQAELKMGIRLNPTGDTIPIRLFITNESGYYLDISLYKEVTDSTTGQIMFQSY-TGKHGPLHGMIINTPYVTKDLLQAKRFQAQTLGTTYVYDFPELFRQALFKVWGADD------SYPKDVLMCSELVLDSQGRLVQLNRLPGDNEMGMVAFRMKMKTPEYPE-GREIIVICNDITYKIGSFGPQEDELFLRASELSRAEGIPRIYISANSGARIGLAEEVQNKFQVAWHDASDPYKGIKYLYLTPQDYTRISSTNSVHCRHVEEEGESRYIITDIIGKDEGLGVENLRGSGMIAGESSQAYEEIITISMVTCRAIGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVPDDFEGVFTILQWLSYMPKNKHSPVPVMPPT----DPVDREIEFVPTK--APYDPRWMLCGRPHPSVKGAWQSGFFDHGTFMEVMSTWAQTVVVGRARLGGIPLGVIAVETRTVEVTVPADPANLDSEAKIVQQAGQVWFPDSAYKTAQAIKDFERERLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDALREFHQPVLVYIPPHAELRGGSWVVIDPTINPEYMELYADRE-SRGGVLEAEGTVEIKFRKKDLLKTMRRIDPD-YSRLTEQLSSAELSVKERSGLEAQLRAREEFLLPIYHQVAVQFVDLHDTPGRMQEKGVITDILDWKNARMFFYWRLRRLLLEEVVKSEI-------IEANRDLNNG------------------------------------HIQSMLRRWFIETEGTVKAYLWDNNKAVVEWLEKHLS-PQDGIRSAIRENIKYLKRDYTLKHIRSLVEANPEVALDCIMHMAQNITPSQRAKVSHLEPSTMHHAA 2257          

HSP 2 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 486/873 (55.67%), Postives = 626/873 (71.71%), Query Frame = 2
Query:  962 KASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKT---GPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            K   +E+F S F QVQ EVPGSPIF+M+ A+HARH EVQILAD+YG AISLFGRDCS+QRRHQKI+EEAP        FEQME+ A+ +A++VGYVSAGTVEYL+  +   F FLELNPRLQVEHPCTE++ D+NLPA+QLQI MGIPLHRIKEIR LY E P     INF +P   P P GHVIA RITSENPDEGFKPS G ++ELNF+S+++VWGYFSV + GG+HEF+DSQFGHCFS+ E RE+A  NMV+ +KE+SIRGDFRTTVEYLIK+LE+ESF  NDIDTGWLD++I++KVQ +  D  L  +C A+H+ +    +S S +   +ER Q+  +  L N VDV LI++ +KY +++ +     P  Y +IMN + +E +VH+L DG LL++Y  +SYTTY+KEEI  YR+ + N T  FEKE DP+VL SPS GKL+QY V+DG HV +   YA +EVMK+ M L    SGCIH++KRPGA+L  GC VA + LDD  SI   E  T           V  KL+QVF   ++ LE+++DGYCLPEPY+  ++ K V   M  LRDP LPL+ELQE+M+ +SGRIP  VE+AI++ M+ YASN+TSVLSQFP  +I +IL +   +L ++++++ + M TQ I  LV +Y  G+RG+MK  + +L  +Y  VE+ FQ+  +DKCV  L EQ K     ++  IFSH  V+ KN LI LLID L   +  L  D+   L  FT L+K ENSKV+L SRQ LIA+  P+YEVRHNQVESIFLSAID Y HQF P+NL++LI+SET +FD++  FFYH N +V  AALEVYVRR YIAYEL  +   QL++G   V F+F+LPS+HP+R
Sbjct:  250 KVDCAEDFPSFFRQVQAEVPGSPIFIMQLAQHARHQEVQILADEYGNAISLFGRDCSIQRRHQKIIEEAPPTNVSPATFEQMERFAVRMAKMVGYVSAGTVEYLFS-EDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIGMGIPLHRIKEIRVLYGEAPWGDTPINFESPECAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGATGGLHEFADSQFGHCFSWGENREEAISNMVVAMKELSIRGDFRTTVEYLIKLLETESFRSNDIDTGWLDHLIAEKVQAERPDTMLGVVCGALHVADASFRKSMSDFLHSLERGQVLPAASLVNTVDVDLIYEGIKYSLKVRQDINYPPTTYVIIMNGSDIEIDVHRLSDGGLLLSYSGSSYTTYMKEEIDSYRITVGNKTCVFEKERDPTVLRSPSAGKLLQYIVDDGGHVTAGHPYAEIEVMKMVMTLVVHESGCIHFVKRPGAVLAPGCIVAHMDLDDPSSIHPVELNTLPLPAQEPLPMVGEKLHQVFHSVLENLEKVMDGYCLPEPYYGCRVNKWVGTLMTTLRDPSLPLLELQEIMTSVSGRIPVTVEKAIRKVMAQYASNITSVLSQFPSQRIANILDSHAATLQRKADREVFFMNTQSIVQLVQRYRSGIRGYMKTVVLDLLKRYLQVERQFQQATYDKCVINLREQYKPDMTPVLEYIFSHAQVSKKNMLIALLIDQLCGRDPTLPDDVMVILNEFTQLSKMENSKVALCSRQALIASHLPSYEVRHNQVESIFLSAIDMYCHQFCPDNLKKLIMSETSIFDVLPSFFYHSNRVVCMAALEVYVRRGYIAYELNSLQHHQLQDGTCAVHFQFMLPSSHPNR 1121          

HSP 3 Score: 213.386 bits (542), Expect = 1.405e-54
Identity = 104/177 (58.76%), Postives = 127/177 (71.75%), Query Frame = 2
Query:  179 RQESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGN 706
            R    R +++PR   VAS  EFV   GG+R I+K+LIANNGIAAVKC+RSIR W+YE F+++  IRFV MVTPED  ANA              G N  NYANV++I+D+A R  V AVWAGWGHASENPKLPE+L+K  I F+GP  +AMW LGDKVAS+I+AQ+  IPTLPWSG+
Sbjct:   55 RGREQRRMDVPRDFTVASPAEFVKRFGGSRVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERTIRFVVMVTPEDLKANA--------------GPNNNNYANVEMIVDIAKRIPVQAVWAGWGHASENPKLPELLHKAGISFLGPSSKAMWALGDKVASSIVAQTAGIPTLPWSGS 217          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Cavefish
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:103043051])

HSP 1 Score: 202.601 bits (514), Expect = 1.958e-53
Identity = 162/553 (29.29%), Postives = 254/553 (45.93%), Query Frame = 2
Query:  269 IKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMG--IPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEEL-NFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAA 1906
            I+K+LIAN G  A + +R+ +            +R V + +  D + ++ ++ M+D+   +    +Q +Y  ++ +L+VA ++   AV  G+G  SEN +  E+  +  IIFIGPP  A+  +G K  S  I  +  +            PI                     ++GY           +   D   QA           A +IG+P+MIKA  GGGGKG+R A S   F       + E   S     + + KF E+ RH+EVQ+  DQ+G A+ LF RDCSVQRRHQKI+EEAP      EV  ++ +AA+  A+ V YV AGTVE++ D     F+F+E+N RLQVEHP +E++T  +L   QL++A G  IP         L +ED  L                GH    RI +E+P+  F P  G ++ L N +++        V     +    D        + E R  A + +   L++ +I G   T +++L+ +     F   ++ T ++     Q     ++ PT    C A
Sbjct:   35 IEKVLIANRGEIACRVMRTAKKMG---------VRSVAVYS--DADRHSMHVAMADEAYHIGAAQSQQSYLCMEKVLEVAKKSSAQAVHPGYGFLSENTEFAELCKQEGIIFIGPPSSAIRDMGIKSTSKHIMSAAGV------------PI---------------------IEGYHG---------EDQSDKKLQA----------EAARIGYPVMIKAVRGGGGKGMRIAHSEAEFHEQLESARREARKSFNDDVMLVEKFVENPRHVEVQVFGDQHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRRKLGEAAVRAAKAVNYVGAGTVEFIMD-SQHNFYFMEMNTRLQVEHPVSEMITGTDLVEWQLRVAAGEKIP---------LSQEDIVL---------------RGHSFEARIYAEDPNNDFMPGAGHLQHLSNPQADEHTRIETGVRDGDEVSAHYDPMIAKLVVWGEDRPAALKKLRYCLRQYNIVG-LNTNIDFLLNLSGHPEFEAGNVHTSFIPQHHDQLFPA-AVPPTGEEACQA 497          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Cavefish
Match: ENSAMXT00000048164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000562.1:3805:10079:-1 gene:ENSAMXG00000032884.1 transcript:ENSAMXT00000048164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 1.234e-51
Identity = 91/144 (63.19%), Postives = 109/144 (75.69%), Query Frame = 2
Query:  179 RQESLRAINMPRP-VVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKH-NIIF 604
            R    R +++PR   VAS  EFV   GG+R I+K+LIANNGIAAVKC+RSIR W+YE F+++  IRFV MVTPED  ANAEYIKM+D    VPGG N  NYANV++I+D+A R  V AVWAGWGHASENPKLPE+L+K  N IF
Sbjct:   25 RGREQRRMDVPRDFTVASPAEFVKRFGGSRVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERTIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVEMIVDIAKRIPVQAVWAGWGHASENPKLPELLHKSWNFIF 168          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Cavefish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 186.808 bits (473), Expect = 3.020e-48
Identity = 158/530 (29.81%), Postives = 244/530 (46.04%), Query Frame = 2
Query:  275 KILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFK-PSPGIM----EELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWL 1837
            KILIAN G  A + I++ +    +T           +    D +++A ++KM+D+   V       +Y N+D I++   +T   AV  G+G  SEN +    L    + FIGP   A+  +GDK+ S +IA++  + T+P                                                     +   V +  EA++ A +IG+P+MIKAS GGGGKG+R A + E  +  F     E   S     + + K+ ++ RH+E+Q+LAD++G A+ L  R+CS+QRR+QK++EEAP           M + A++LA+ V Y SAGTVE+L D K + F+FLE+N RLQVEHP TE +T ++L    +++A G  L   +E                 + P      NG  I  R+ +E+P + F  PS G +    E LN    R   G   +     I  + D       ++  TR +A + M   L    IRG     +  L +I+    FI  DI T +L
Sbjct:   48 KILIANRGEIACRVIKTCKKMGIKT-----------VAVHSDVDSSAVHVKMADEAFCVGPAPTSKSYLNMDAIMEAIRQTGAQAVHPGYGFLSENKEFARRLAADGVSFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPG----------------------------------------------------FDGVVKNAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPVTRRAMGEQAVSLAKAVKYSSAGTVEFLVDSK-KNFYFLEMNTRLQVEHPITECITGLDLVQQMIRVAKGYKLQHKQE-----------------DIPI-----NGWAIESRVYAEDPYKSFGLPSIGRLSQYEEPLNLPGVRVDSG---IQEGSDISIYYDPMISKLVTYGSTRAEALKKMEDALDNYVIRG-VTHNIPLLREIIVHPRFISGDISTNFL 487          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Cavefish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 181.03 bits (458), Expect = 1.043e-46
Identity = 155/527 (29.41%), Postives = 241/527 (45.73%), Query Frame = 2
Query:  284 IANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFK-PSPGIM----EELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWL 1837
            IAN G  A + I++ +    +T           +    D +++A ++KM+D+   V       +Y N+D I++   +T   AV  G+G  SEN +    L    + FIGP   A+  +GDK+ S +IA++  + T+P                                                     +   V +  EA++ A +IG+P+MIKAS GGGGKG+R A + E  +  F     E   S     + + K+ ++ RH+E+Q+LAD++G A+ L  R+CS+QRR+QK++EEAP           M + A++LA+ V Y SAGTVE+L D K + F+FLE+N RLQVEHP TE +T ++L    +++A G  L          +ED  +               NG  I  R+ +E+P + F  PS G +    E LN    R   G   +     I  + D       ++  TR +A + M   L    IRG     +  L +I+    FI  DI T +L
Sbjct:    1 IANRGEIACRVIKTCKKMGIKT-----------VAVHSDVDSSAVHVKMADEAFCVGPAPTSKSYLNMDAIMEAIRQTGAQAVHPGYGFLSENKEFARRLAADGVSFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPG----------------------------------------------------FDGVVKNAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPVTRRAMGEQAVSLAKAVKYSSAGTVEFLVDSK-KNFYFLEMNTRLQVEHPITECITGLDLVQQMIRVAKGYKLQH-------KQEDIPI---------------NGWAIESRVYAEDPYKSFGLPSIGRLSQYEEPLNLPGVRVDSG---IQEGSDISIYYDPMISKLVTYGSTRAEALKKMEDALDNYVIRG-VTHNIPLLREIIVHPRFISGDISTNFL 437          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001516.1 (pep scaffold:Pmarinus_7.0:GL477673:133580:241371:-1 gene:ENSPMAG00000001304.1 transcript:ENSPMAT00000001516.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 660/1235 (53.44%), Postives = 864/1235 (69.96%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIF--IGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTS-NQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQ---EGHHDKCVSILLE-QKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFP---FAMKSLIHTPSTDSLDSCYD-----VPDSPNDN-VVLKPKRCR--ATNKSPSLDNDNFSLLNGSMEFET 3868
            VAS  EFV   GGNR I+K+LIANNGIAAVKC+RSIR WAYE F+++ AIRFV MVTPED  ANAEYIKM+D    VPGG+N  NYANV+LILD+A R  V AVWAGWGHASENPKLPE+L+K++I F  IGPP +AMW LGDK+AS+I+AQ+ NIPTLPWSG G               +S N      E D      N       +P ++Y + CV+D  E L+ A  IGFP+MIKASEGGGGKGIRK++++E F +LF QVQ EVPGSP+F+MK A HARHLEVQILAD YG AISLFGRDCS+QRRHQKI+EEAP  VA   VF+QME+ A+ LA++VGYVSAGTVEYLY  +   F FLELNPRLQVEHPCTE+V D+NLPA+QLQI+MGIPL+RIK+IR LY E P     I+F  P + P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+KVQ +  + TL  +  A+H+ +     S S +   +ER Q+  +  LTN V+V LI++ +KY +++ +  P  Y + MNN+ +E +VH++ DG LL++Y  +S+TTY+KEE+  YR+ I N T  FEKE DPS+L +PS GKL+QY VEDG HVF    YA +EVMK+ M +    SGC+HY+KRPGA+L+ GC VA L LDD   +K+AE +T              KL+QVF   +  L  +++GYCLPEP+F+ K++  V Q M  LRDP LPL+ELQ+LM+ +SGR+P +VE+AI+++M+ YASN+TSVL QFP  +I +IL +   +L ++SE++ + M TQ I  LV +Y  G+RGHMK  + +L  +Y  VE  FQ   +GH+DKCV  L E  K     +++ IFSH +VA KN L+++LID L   +  L ++L   L   T L+K+ NSKVSLR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF PENL++LI+SET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  +   Q  +G  IVEF+F+LPS+HP+R ++ T+ R +   N+     ++  ++   S+T       F      M +++   S +     ++       DSP D+ + L+P R    A   S S+  D   +LN +++ ++
Sbjct:   27 VASPAEFVTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIARRIPVQAVWAGWGHASENPKLPELLHKNDIAFMGIGPPSQAMWSLGDKIASSIVAQTANIPTLPWSGFG-------------TFQSWN------EADRKGKVIN-------VPPEIYERGCVNDAEEGLKAAQTIGFPVMIKASEGGGGKGIRKSTNAEEFANLFRQVQAEVPGSPVFVMKLANHARHLEVQILADAYGNAISLFGRDCSIQRRHQKIIEEAPATVAHAHVFQQMEQCAVRLAKMVGYVSAGTVEYLYS-QDGSFHFLELNPRLQVEHPCTEMVADVNLPAAQLQISMGIPLYRIKDIRILYGEPPWGDAPIDFEIPPRTPSPRGHVIAARITSENPDEGFKPSAGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFHENTIDTGWLDRLISEKVQAERPNTTLGIVSGALHVADGSFRSSMSNFLHSLERGQVLPAHTLTNSVNVELIYEGMKYTLKVTRQSPSTYVVTMNNSHMEVDVHRMSDGGLLLSYDGSSHTTYMKEEVDRYRLTIGNKTCVFEKENDPSILRAPSAGKLIQYMVEDGGHVFVGQCYAEIEVMKMVMSMVVNESGCVHYVKRPGAVLEPGCVVAKLQLDDPTRVKQAELYTDVLPPQLMPLLHGEKLHQVFHLVLDTLYHVMNGYCLPEPFFSTKMKGWVEQLMKTLRDPSLPLLELQDLMTSVSGRVPPSVEKAIRKEMAQYASNITSVLCQFPSQQIANILDSHAATLQRKSEREVFFMNTQTIVQLVQRYRSGIRGHMKSVVLDLLRQYLRVETQFQNDGQGHYDKCVIALRENHKGDMTTVVHYIFSHAHVAKKNALVIMLIDQLFGRDPTLTEELAAILSELTQLSKTTNSKVSLRARQVLIASNLPSYELRHNQVESIFLSAIDMYGHQFCPENLQKLIISETSIFDVLPNFFYHSNQIVRMAALEVYVRRAYIAYELNSLQHQQFIDGTCIVEFQFMLPSSHPNRGSIPTLNRMSFPSNL-----HHAGLTRAVSVTEVLLDNTFTPPCQRMGAMVAFHSFEDFVRDFEEVMKHFSDSPPDSPIFLEPGRSTLYAEEDSKSVRQDPIHILNVAIKIDS 1229          

HSP 2 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 372/641 (58.03%), Postives = 483/641 (75.35%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSS------IQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGT-----------------FPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKV 5773
            +PPCQRMGAM AF + ++F   F+E+M HFS       I  E  ++T+   +D    S +++++PIHI NVA + D   EDD+   +L DF   KK++ I+RGIRR+TFL+                      FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN++L  +P  N +MHLYL  A+V +G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NE ER LLE++D LE+A  +  A RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G+ IP+R++L NE GY L+IS+YKEV D  T QI F+++G+ K G LHGML+  PY TKD LQ KRFQA +  TTYVYDYP++I QAL  +W  Y   L       ++LTY EL+LD  + +VE+ ++PG N IGMVAW+M L TPEYP+ GR +++I+ND+T+++GSF   ED+LF +AS+LAR  G+PRI+ A+N GAR+GLAEE +++F+IAW+D  DP K FKYLYLTP DY+++  LN+V CE IEDEGE+RYKITDIIGKE+G+GVE+LR SGMIAGE+S AY+EI+TISLVS RA+GIGAYLVRLG RVIQV+NSHIILTGAAALNKV
Sbjct: 1157 TPPCQRMGAMVAFHSFEDFVRDFEEVMKHFSDSPPDSPIFLEPGRSTLYAEED----SKSVRQDPIHILNVAIKIDSDTEDDELVTVLRDFTQSKKRILIDRGIRRLTFLVAQKEKDFRKHYDYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFELHALPCANHKMHLYLGTARVEQGIEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN-TAARTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDLRTSQIMFQAYGD-KPGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDYPEMIRQALLKLWDAYGNGL----AHKDVLTYTELVLDSQDQLVEMNRLPGGNEIGMVAWKMWLRTPEYPQ-GRTVVVIANDLTHRIGSFGPQEDLLFQQASQLARTDGVPRIYIAANSGARLGLAEEIRHMFHIAWVDPSDPYKSFKYLYLTPQDYKKVSALNSVHCEHIEDEGESRYKITDIIGKEEGLGVESLRGSGMIAGESSQAYEEIITISLVSCRAIGIGAYLVRLGQRVIQVDNSHIILTGAAALNKV 1785          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005117.1 (pep scaffold:Pmarinus_7.0:GL476781:703:17658:1 gene:ENSPMAG00000004651.1 transcript:ENSPMAT00000005117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 352.058 bits (902), Expect = 3.545e-107
Identity = 208/546 (38.10%), Postives = 304/546 (55.68%), Query Frame = 2
Query: 5771 VLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNG--EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKT-----IKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            VLG +VY+SN+QLGG+QIM NNGV+HA+V D+ +G+  +L+WLSYIP      +P+    P   DP+ R V ++P K  +  DPR ++ G    +   E+ SG FD  S+ EIL  WA++VV GRARLGGIP+ V+  ETR+V   IPADPANP +E Q V    + W     +        +  +  P  +         G+ DMYDQ+LKFG+YIVD L+ Y QPV VYIPPH ELRGG+WVV+DPTIN  +MEM+ADP+ S  G+  P G   + + + ++I +      KR     +    EL      + + +K L+  L  R + LLP+YHQ+A+ FA LHDTPGRM  KG +  +I W  SR  FY +LRR LLE DA                            G ++   +  N    P    S+G      H  ++L+RWFVE +G  K+YLW ++  V  WLE  +   +      I + ++  +RD+ +  I+ LV+ NP++ M+ I+ + Q +   Q ++++ IL+++ + A
Sbjct:    1 VLGREVYSSNNQLGGIQIMHNNGVTHAIVPDDFEGVYTILQWLSYIPKDNQSMVPI--TTPV--DPVEREVEFVPSK--APYDPRWMLAGRPHPSNSEEWQSGFFDHGSFMEILQPWAQTVVVGRARLGGIPLGVVAVETRSVELGIPADPANPESEAQLVASRYKYWGGGGGWGKDSDFIFYYCKKNPASLHTRLSQVLVGLRDMYDQVLKFGAYIVDGLREYRQPVLVYIPPHAELRGGSWVVIDPTINSRHMEMYADPE-SRYGVWSPSGNQRLSFLKSEVIFSNAKIYFKRF--FFMRATPEL------SAESRKLLVMKLKEREEFLLPIYHQVAVRFADLHDTPGRMQEKGAIMDIIEWRTSRSFFYWRLRRLLLE-DA----------------------------GKRRVLAA--NPALGPSVSPSAGNSPGPGHVQSMLRRWFVETEGTVKAYLWDNNQAVVQWLEKHLK-PEEGVRSVIEENIKYIKRDHVMQQIRNLVQENPEVAMDCIVHMTQHMTPAQRAEVSRILASVNSGA 499          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005541.1 (pep scaffold:Pmarinus_7.0:GL482516:46:21192:-1 gene:ENSPMAG00000005028.1 transcript:ENSPMAT00000005541.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 279.641 bits (714), Expect = 1.906e-81
Identity = 149/294 (50.68%), Postives = 204/294 (69.39%), Query Frame = 2
Query: 3917 HSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWL 4798
            ++PPCQRMGAM AF  +D+  + FDE++  FS+   E    T        +  +  +   +H F+++  E   +  +     L  + L ++ +  + GIRR+TFL++    FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  +   N RM LYL  A+V EG EVTD+RFFVR+I+RH+DLVTKEASFEY+ NE ER LLE++D LE+A  +  A RT+ NHIFLNF PT+ + D  ++EE+VR MVMRYGSRLWKLRV QAELK+ +R +  G  IP+R++L
Sbjct:  276 YTPPCQRMGAMLAFDNLDQLAQNFDEVLQCFSNWPSEGSSLTDAGCSTLYHDDSKSRISNVHSFSISLGERRWLASNPLLPNLLSYFLFQRSMLRDHGIRRLTFLVSQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLRAMHCANHRMQLYLGSARVEEGAEVTDHRFFVRAIMRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFDNT-AVRTDANHIFLNFVPTVIM-DPCKIEESVRSMVMRYGSRLWKLRVLQAELKINIRQTPTGHAIPIRLFL 567          

HSP 2 Score: 256.914 bits (655), Expect = 1.077e-73
Identity = 128/253 (50.59%), Postives = 178/253 (70.36%), Query Frame = 2
Query: 2813 KILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLE-QKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRN 3568
            +I + L +   +L ++++++ + M  Q I  LV +Y  G RGHMK  + +L  +Y  VE  FQ+GH+DKCV  L E  K    +++ +IFSH  VA KN L+ +LID L   +  L ++L + L   T LNK+ N++V+LR+RQVLIA   P+YE+RHNQVESIFLSAID YGHQF PENL++LI+SET +FD++ +FFYH N +V  AA EVYVRRAYIAYEL  +   QLK+ + IVEF+F+LPS+HP+R+
Sbjct:    2 QIANTLDSHAATLQRKADREVFFMNVQGILVLVQRYRSGTRGHMKTVLLDLLREYLKVETQFQQGHYDKCVIALRETHKGDMTSVLKLIFSHAQVAKKNILVTMLIDQLCGRDPTLTEELTNILNELTQLNKTTNARVALRARQVLIACHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLIMSETSIFDVLPNFFYHSNQVVRMAASEVYVRRAYIAYELNSLQHHQLKDSSCIVEFQFMLPSSHPNRS 254          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005537.1 (pep scaffold:Pmarinus_7.0:GL482516:46:21192:-1 gene:ENSPMAG00000005028.1 transcript:ENSPMAT00000005537.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.003 bits (676), Expect = 4.468e-76
Identity = 149/310 (48.06%), Postives = 202/310 (65.16%), Query Frame = 2
Query: 3917 HSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKI-LSDFCLRKKKVFIERGIRRVTFLMTSAG---------------TFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWL 4798
            ++PPCQRMGAM AF  +D+  + FDE++  FS+   E    T        +  +  +   +H F+++  E  + E      I  +      + +  + GIRR+TFL++                   FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL  +   N RM LYL  A+V EG EVTD+RFFVR+I+RH+DLVTKEASFEY+ NE ER LLE++D LE+A  +  A RT+ NHIFLNF PT+ + D  ++EE+VR MVMRYGSRLWKLRV QAELK+ +R +  G  IP+R++L
Sbjct:  288 YTPPCQRMGAMLAFDNLDQLAQNFDEVLQCFSNWPSEGSSLTDAGCSTLYHDDSKSRISNVHSFSISLGERCLTEPISVAAIYWTSLHPHARSMLRDHGIRRLTFLVSQKRLSENVNLGIFKSFQREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLRAMHCANHRMQLYLGSARVEEGAEVTDHRFFVRAIMRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFDNT-AVRTDANHIFLNFVPTVIM-DPCKIEESVRSMVMRYGSRLWKLRVLQAELKINIRQTPTGHAIPIRLFL 595          

HSP 2 Score: 258.84 bits (660), Expect = 5.024e-74
Identity = 133/288 (46.18%), Postives = 188/288 (65.28%), Query Frame = 2
Query: 2813 KILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLE-QKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFS 3673
            +I + L +   +L ++++++ + M  Q I  LV +Y  G RGHMK  + +L  +Y  VE  FQ+GH+DKCV  L E  K    +++ +IFSH  VA KN L+ +LID L   +  L ++L + L   T LNK+ N++V+LR+RQVLIA   P+YE+RHNQVESIFLSAID YGHQF PENL++LI+SET +FD++ +FFYH N +V  AA+ VYVRRAYIAYEL  +   QLK+ + IVEF+F+LPS+HP+R+       A   N    TD    +     IT+  ++
Sbjct:    2 QIANTLDSHAATLQRKADREVFFMNVQGILVLVQRYRSGTRGHMKTVLLDLLREYLKVETQFQQGHYDKCVIALRETHKGDMTSVLKLIFSHAQVAKKNILVTMLIDQLCGRDPTLTEELTNILNELTQLNKTTNARVALRARQVLIACHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLIMSETSIFDVLPNFFYHSNQVVRMAAIRVYVRRAYIAYELNSLQHHQLKDSSCIVEFQFMLPSSHPNRSSALNKMSAIAANQSHYTDVIRTVGSQEVITDASYT 289          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003643.1 (pep scaffold:Pmarinus_7.0:GL479165:7567:28556:1 gene:ENSPMAG00000003333.1 transcript:ENSPMAT00000003643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.476 bits (563), Expect = 1.613e-65
Identity = 112/213 (52.58%), Postives = 148/213 (69.48%), Query Frame = 2
Query: 5756 AALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTD-VNGE-YLSGLFDKDSWQEILDQWARSVVTGRA---RLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMD 6379
            +A  +VLG +VYTSN+QLGG+QIM NNGVSH    D+ +G+  +L+WLSY+P     P+P+  +     DPI+R V +MP K  +  DPR ++ G     N E + SG FD  S+ EI+  WA++VV GRA   RLGGIP+ V+  ETR V  +IPADPAN  +E + +Q AGQVWFP SAYKT+QA++DF+RE LPL +FANWRGFSGGM +
Sbjct:    1 SARTQVLGREVYTSNNQLGGIQIMYNNGVSHTTAEDDFQGVYTILQWLSYMPKDSRSPVPILHSK----DPIDREVDFMPTK--APYDPRWMLAGRPHPTNKETWQSGFFDHGSFMEIMRPWAQTVVVGRAKQRRLGGIPVGVVAVETRTVELAIPADPANLDSEAKIIQQAGQVWFPDSAYKTSQAIKDFSREHLPLMVFANWRGFSGGMKE 207          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Yeast
Match: ACC1 (Acetyl-CoA carboxylase, biotin containing enzyme; catalyzes carboxylation of cytosolic acetyl-CoA to form malonyl-CoA and regulates histone acetylation by regulating the availablity of acetyl-CoA; required for de novo biosynthesis of long-chain fatty acids; ACC1 has a paralog, HFA1, that arose from the whole genome duplication [Source:SGD;Acc:S000005299])

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 497/1136 (43.75%), Postives = 684/1136 (60.21%), Query Frame = 2
Query:  230 INEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILY--KHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQ-------KPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYT-SNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMN----IIFSHQNVAYKNKLILLLIDH---LVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDR--YGHQFRPEN-------LERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAF--IVEFRFLLPST 3553
            + +FV + GG+  I KILIANNGIAAVK IRS+R WAYETF D   ++FV M TPED  ANAEYI+M+D+   VPGG+N  NYANVDLI+D+A R  VDAVWAGWGHASENP LPE L   K  +IFIGPP  AM  LGDK++STI+AQS  +P +PWSG G+                     H  E  G  +          +  D+Y + C + P + L++A +IGFP+MIKASEGGGGKGIR+    E+F +L+ Q  NE+PGSPIF+MK A  ARHLEVQ+LADQYG  ISLFGRDCSVQRRHQKI+EEAPV +A  E F +MEKAA+ L ++VGYVSAGTVEYLY     KF+FLELNPRLQVEHP TE+V+ +NLPA+QLQIAMGIP+HRI +IR LY  +P   ++I+F   TQ       +P P GH  A RITSE+P++GFKPS G + ELNF+S+ +VWGYFSV + G IH FSDSQFGH F+F E R+ +R++MV+ LKE+SIRGDFRTTVEYLIK+LE+E F  N I TGWLD +I+ K+  +  DPTLA +C A          +   Y   +++ Q+     L  +  V  IH+  +Y+  + K+G   Y L +N +  +  + +L DG LLI  G  S+T Y KEE+   R+ +D+ T   E E DP+ L +PS GKLV++ VE+G H+     YA +EVMK+ M L +  +G +  +K+PG+ + AG  +A +TLDD   +K A  F G      +      K    F   V  LE IL GY          +  ++ Q +  LR+P+LP  E +  +S +  R+P  ++    +QM    +      + FP  + L  L +      + +       + +P+  +  KY+ G+  H      +   +YY VEKLF  G + +  +I+L+ +D+N   ++     + SH  V+ KN LIL ++ H   L +  S +    +  L +   L     +KV+L++R++LI    P+ + R  Q+E I  S++ +  YG    P+        L+ LI S  VVFD++  F  H +P+V +AA +VY+RRAY AY    +   ++  G    IVE++F LPS 
Sbjct:   46 LRDFVKSHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTV------------------HVDEKTGLVS----------VDDDIYQKGCCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHELNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDLITHKMTAEKPDPTLAVICGAATKAFLASEEARHKYIESLQKGQVLSKDLLQTMFPVDFIHEGKRYKFTVAKSGNDRYTLFINGSKCDIILRQLSDGGLLIAIGGKSHTIYWKEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIVQLLKQPGSTIVAGDIMAIMTLDDPSKVKHALPFEGMLPDFGSPVIEGTKPAYKFKSLVSTLENILKGYD-----NQVIMNASLQQLIEVLRNPKLPYSEWKLHISALHSRLPAKLD----EQMEELVARSLRRGAVFPARQ-LSKLIDMAVKNPEYNPDKLLGAVVEPLADIAHKYSNGLEAHEHSIFVHFLEEYYEVEKLFN-GPNVREENIILKLRDENPKDLDKVALTVLSHSKVSAKNNLILAILKHYQPLCKLSSKVSAIFSTPLQHIVELESKATAKVALQAREILIQGALPSVKERTEQIEHILKSSVVKVAYGSS-NPKRSEPDLNILKDLIDSNYVVFDVLLQFLTHQDPVVTAAAAQVYIRRAYRAY---TIGDIRVHEGVTVPIVEWKFQLPSA 1138          

HSP 2 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 414/895 (46.26%), Postives = 574/895 (64.13%), Query Frame = 2
Query: 4187 KKVFIERGIRRVTFLMT-SAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGL---NNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNG-EYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNR-EGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADS 6853
            K+  I   IRR+TF+     G++P+Y+TF   N + E+   RH+EPALAFQLE+ R+ N++++ I   NR +H+Y A +K S      D RFF R IIR   +    +  EY+T+EA R + + LD LE+     D   ++ NHIF+NF     +     +E      + R+G RL +LRV+ AE++++++    G  +P+R  + N  GY ++  MY EV     G+  F+S G  K G +H   +  PY  K+ LQ KR++A    TTYVYD+P+L  QA    W  ++ ++ L +   +     ELI D+N ++ EV++ PG N IGMVA+++ + TPEYP  GR+ ++++ND+T+K+GSF   ED  F K +E ARK GIPRI+ A+N GARIG+AEE   +F +AW D  +P+KGF+YLYLT    + +      N+V+ E     GE R+ I  IIG EDG+GVE LR SG+IAG TS AY +I TI+LV+ R+VGIGAYLVRLG R IQVE   IILTGA A+NK+LG +VYTSN QLGG QIM NNGVSH    D+L G+E +++W+SY+P+ +N P+P+        D  +RPV +  P N    D R +I G    +G EY  GLFDK S+ E L  WA+ VV GRARLGGIP+ VI  ETR V   IPADPANP++    +Q  GQVW P SA+KTAQA+ DFN  E LP+ I ANWRGFSGG  DM++++LK+GS+IVD L  Y QP+ +YIPP GELRGG+WVV+DPTIN D MEM+AD   +  G+LEP+G+V IK+R + L+ T+ RLD     ++S+ LS  S   ++ + +   L  R ++LLP+Y QI++ FA LHD   RM AKGV+S  + W ++
Sbjct: 1250 KQELINASIRRITFMFGFKDGSYPKYYTFNGPN-YNENETIRHIEPALAFQLELGRLSNFNIKPIFTDNRNIHVYEAVSKTSP----LDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEVT----DTSNSDLNHIFINFIAVFDISP-EDVEAAFGGFLERFGKRLLRLRVSSAEIRIIIKDPQTGAPVPLRALINNVSGYVIKTEMYTEV-KNAKGEWVFKSLG--KPGSMHLRPIATPYPVKEWLQPKRYKAHLMGTTYVYDFPELFRQASSSQWKNFSADVKLTD---DFFISNELIEDENGELTEVEREPGANAIGMVAFKITVKTPEYPR-GRQFVVVANDITFKIGSFGPQEDEFFNKVTEYARKRGIPRIYLAANSGARIGMAEEIVPLFQVAWNDAANPDKGFQYLYLTSEGMETLKKFDKENSVLTERTVINGEERFVIKTIIGSEDGLGVECLRGSGLIAGATSRAYHDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKMLGREVYTSNLQLGGTQIMYNNGVSHLTAVDDLAGVEKIVEWMSYVPAKRNMPVPILETK----DTWDRPVDFT-PTNDETYDVRWMIEGRETESGFEY--GLFDKGSFFETLSGWAKGVVVGRARLGGIPLGVIGVETRTVENLIPADPANPNSAETLIQEPGQVWHPNSAFKTAQAINDFNNGEQLPMMILANWRGFSGGQRDMFNEVLKYGSFIVDALVDYKQPIIIYIPPTGELRGGSWVVVDPTINADQMEMYADVN-ARAGVLEPQGMVGIKFRREKLLDTMNRLDDKYRELRSQ-LSNKSLAPEVHQQISKQLADRERELLPIYGQISLQFADLHDRSSRMVAKGVISKELEWTEA 2118          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Yeast
Match: HFA1 (Mitochondrial acetyl-coenzyme A carboxylase; catalyzes production of malonyl-CoA in mitochondrial fatty acid biosynthesis; relocalizes from mitochondrion to cytoplasm upon DNA replication stress; genetic and comparative analysis suggests that translation begins at a non-canonical (Ile) start codon at -372 relative to the annotated start codon [Source:SGD;Acc:S000004820])

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 473/1192 (39.68%), Postives = 679/1192 (56.96%), Query Frame = 2
Query:  317 IRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILY--KHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDS-IDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSF-YTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGH--HDKCVSILLEQKDKN--QNIMNIIFSHQNVAYKNKLILLLI---DHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIF-LSAIDRYGHQFRPENL-------ERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNV----------VLKPKRCRATN 3805
            +RSIR WAYETF D+  I+FV M TP+D +AN+EYI+M+D+   VPGG+N  NYAN+DLILDVA +T VDAVWAGWGHASENP LPE+L   +  I+FIGPP  AM  LGDK++STI+AQS  IP +PWSG+ +   I   +   +V                            +P D+Y + C S P +ALE+A  IGFP+MIKASEGGGGKGIR+  + ++F +L+ Q  NE PGSP+F+MK    ARHLEVQ+LADQYG  I+LFGRDCS+QRRHQKI+EEAPV +   E F++ME+AAI L ++VGYVSAGTVEYLY  K  KF+FLELNPRLQVEHP TE+++ +NLPA+QLQIAMGIP+H I +IR+LY  DPT  + I+F N  ++P P GH I+ RITSE+P+EGFKPS G + ELNF+S+ +VWGYFSV + G IH FSDSQFGH F+    R+ A++NMVL LK+ SIRG+F+T +EYLI++LE+  F  N+I TGWLD +I + + +DS +DPTLA +C A         +  + Y  L+ R Q+     L     V  I D  +Y   + ++    + L +N +  E  V KL   CLLI+     +T Y K++I G R+ ID+NTI  E E +P+ ++SP+ GKLV+Y V  G HVF+   YA +E+MK+ M L   + G I  +++PG+I++AG  +A LTLD       +  + G            ++ N      +  LE IL+GY     +    ++ T+ + +  LRD RLP  E    +S +  R+P        +Q++    N+      FP +K LH L      L + +      +  QP+  +  +Y++G+  H       L  KYY VEK+F E H  H++   + L +KD    + I+ I  SH NV  KNKL+  ++   + L ++ S +       + +  +L      +V++++R VL+    P  + R   ++++  L   D         N+         LI S  +    +  FF H +  + S A E+Y R AY  Y+L  +   ++  GA  +   +   S    RN         + N D  +D + ++S+ PS + +  +  F   +          +LD  Y+    P + +          +L P R R+ N
Sbjct:    1 MRSIRKWAYETFNDEKIIQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDT-IHIDNKTNFV---------------------------SVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKN-LKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLDDLILKNLSSDSKLDPTLAIICGAAMKAYVFTEKVRNKYLELLRRGQVPPKDFLKTKFPVDFIFDNNRYLFNVAQSSEEQFILSINKSQCEVNVQKLSSDCLLISVDGKCHTVYWKDDIRGTRLSIDSNTIFLEAELNPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIELLRQPGSIIEAGDVIAKLTLDSPSKANESSLYRGELPVLGPPLIEGSRPNHKLRVLINRLENILNGY-----HENSGIETTLKELIKILRDGRLPYSEWDSQISTVRNRLP--------RQLNEGLGNLVKKSVSFP-AKELHKLMK--RYLEENTNDHVVYVALQPLLKISERYSEGLANHECEIFLKLIKKYYAVEKIF-ENHDIHEERNLLNLRRKDLTNLKKILCISLSHANVVAKNKLVTAILHEYEPLCQDSSKMSLKFRAVIHDLASLESKWAKEVAVKARSVLLRGIFPPIKKRKEHIKTLLQLHIKDTGAENIHSRNIYSCMRDFGNLIHSNLIQLQDLFFFFGHQDTALSSIASEIYARYAYGNYQLKSI---KIHKGAPDLLMSWQFSSL---RNY--------LVNSDGESDEFTKLSKPPSTSGKSSANSFGLLVNMRALESLEKTLDEVYEQIHIPEERLSSGENSLIVNILSPIRYRSEN 1132          

HSP 2 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 395/924 (42.75%), Postives = 566/924 (61.26%), Query Frame = 2
Query: 4202 ERG-----IRRVTFLMTSAGT-FPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIR---HADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGL---NNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNR-EGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSEL----LSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDK 6922
            ERG     + R+TF   +A     ++++F     + E    R+++P+    LE+ +M NY +  +P  +  + ++   +K +      D RFFVR II    + D  T E + +   N         +  +   L   D   ++ NHIFL+F   L +P + RLEE V  ++  + +RL++ R+   E+ + V   +  +  P+R+ ++N+ GY ++I  Y E + +    I        ++       L  PY  KD LQ KR++A    TTYVYD+P L +QA    W  Y P+  L +      +++ELI + N ++++V + PG+NNIGMVA+ + + TPEYPE GR +I+ISND+TY +GSF   ED+ F + +  AR+ GIPRI+ A+N GA++G+AEE   +F +AW D  DP KGF+YLYL P D Q +      N+V+ E     GE RY I  I+G E+G+GVE L+ SG+IAG TS AY +I TI+ V+ R+VGIG+YLVRLG R IQVE+  IILTGA+A+NKVLG+D+YTSN Q+GG QIM  NG++H   ++++K IE ++ WLSY+P+ ++   P+        D  +R V + P K +   + R LI G  D N  + SGLFDKDS+ E L  WA+ V+ GRARLGGIP+ VI  ET+ +   IPADPAN  +    V+ AGQVW+P SA+KTAQ + DFN  E LPL I ANWRGFSGG  DMY+++LK+GS+IVD L  Y QP+ +YIPP GELRGG+WVV+DPTIN + MEM+AD + S GG+LEP+G+V IKYR++ +I+T+ RLD     ++  L    LSL+ QN      L   L  R ++L+P+Y+QI+I FA LHD   RM  KGV+ + + W  SRR  Y +LRRRL E   I  + K
Sbjct: 1146 ERGLSKLKVNRITFAFIAANAPAVKFYSFDGTT-YDEISQIRNMDPSYEAPLELGKMSNYKIRSLPTYDSSIRIFEGISKFTP----LDKRFFVRKIINSFMYNDQKTTEENLKAEIN-------AQVVYMLEHLGAVDISNSDLNHIFLSFNTVLNIP-VHRLEEIVSTILKTHETRLFQERITDVEICISVECLETKKPAPLRLLISNKSGYVVKIETYYEKIGKNGNLILEPC---SEQSHYSQKSLSLPYSVKDWLQPKRYKAQFMGTTYVYDFPGLFHQAAIQQWKRYFPKHKLND---SFFSWVELI-EQNGNLIKVNREPGLNNIGMVAFEIMVQTPEYPE-GRNMIVISNDITYNIGSFGPREDLFFDRVTNYARERGIPRIYLAANSGAKLGIAEELIPLFRVAWNDPSDPTKGFQYLYLAPKDMQLLKDSGKGNSVVVEHKMVYGEERYIIKAIVGFEEGLGVECLQGSGLIAGATSKAYRDIFTITAVTCRSVGIGSYLVRLGQRTIQVEDKPIILTGASAINKVLGTDIYTSNLQIGGTQIMYKNGIAHLTASNDMKAIEKIMTWLSYVPAKRDMSPPLL----ETMDRWDRDVDFKPAKQVP-YEARWLIEGKWDSNNNFQSGLFDKDSFFETLSGWAKGVIVGRARLGGIPVGVIAVETKTIEEIIPADPANLDSSEFSVKEAGQVWYPNSAFKTAQTINDFNYGEQLPLIILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPILIYIPPFGELRGGSWVVIDPTINPEQMEMYADVE-SRGGVLEPDGVVSIKYRKEKMIETMIRLDSTYGHLRRTLTEKKLSLEKQN-----DLTKRLKIRERQLIPIYNQISIQFADLHDRSTRMLVKGVIRNELEWKKSRRFLYWRLRRRLNEGQVIKRLQK 2037          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Yeast
Match: DUR1,2 (Urea amidolyase; contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000412])

HSP 1 Score: 192.586 bits (488), Expect = 2.684e-49
Identity = 153/551 (27.77%), Postives = 259/551 (47.01%), Query Frame = 2
Query:  278 ILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNE----VPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSV--WGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIH 1912
            +LIAN G  AV+ I++++         +  IR V + +  D +  ++++  +D    + G +    Y +++ I+D A +T   A+  G+G  SEN    +      I F+GP  + +  LG K ++  IAQ   +            P+ P S                                           ++   EA + A ++ +P+M+K++ GGGG G++K  S E+ + +F  V+++       + +FL +F E+ARH+EVQ++ D +G+AI+L  RDCS+QRR+QK++EE P    PE+    + KAA +L  ++ Y  AGTVE++YD K  +F+FLE+N RLQVEHP TE+VT ++L    ++IA                 D   F+       + K   NG  +  R+ +ENP + F+PSPG++ ++ F     V  W    V     I    D          + R+ A   +   L+E  + G   T ++YL  I+ S+ F    + T  L+   S + +  +I+ TL     +I 
Sbjct:  636 VLIANRGEIAVRIIKTLK---------KLGIRSVAVYS--DPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGV------------PLVPGS-----------------------------------------LLITSVEEAKKVAAELEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAA---------------NDAPDFD-------STKVEVNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTW----VKKGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCI-TNIDYLKSIITSDFFAKAKVSTNILN---SYQYEPTAIEITLPGAHTSIQ 1092          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Yeast
Match: PYC2 (Pyruvate carboxylase isoform; cytoplasmic enzyme that converts pyruvate to oxaloacetate; differentially regulated than isoform Pyc1p; mutations in the human homolog are associated with lactic acidosis; PYC2 has a paralog, PYC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000422])

HSP 1 Score: 186.422 bits (472), Expect = 1.252e-47
Identity = 156/533 (29.27%), Postives = 253/533 (47.47%), Query Frame = 2
Query:  275 KILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDT------NANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSEN----FQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGG-IHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLD 1840
            KIL+AN G   ++  RS    A+E      ++R + + + ED        A+  Y+ + ++ +  P G+    Y  +D I+++A + KVD +  G+G  SEN +  + + K  I +IGPP E +  +GDKV++  +A   N+PT+P +            P++ V                                           EAL+   + G+P++IKA+ GGGG+G+R     ++    FQ    + +        F+ +F +  +H+EVQ+LAD +G  + LF RDCSVQRRHQK++E AP    P EV + +   A+ LA++ GY +AGT E+L D    + +F+E+NPR+QVEH  TE +T I++ ++Q+QIA G  L ++  +++                   K    G  I  RIT+E+P + F+P  G +E         V      +  G  I    DS    C     T E  R  M+  L E  IRG  +T + +L+ +L +  FI     T ++D
Sbjct:   22 KILVANRGEIPIRIFRS----AHEL-----SMRTIAIYSHEDRLSMHRLKADEAYV-IGEEGQYTPVGA----YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGT----------PGPIETV------------------------------------------QEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQD-------------------KITTRGFSIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFID 467          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Yeast
Match: PYC1 (Pyruvate carboxylase isoform; cytoplasmic enzyme that converts pyruvate to oxaloacetate; differentially regulated than isoform Pyc2p; mutations in the human homolog are associated with lactic acidosis; PYC1 has a paralog, PYC2, that arose from the whole genome duplication [Source:SGD;Acc:S000003030])

HSP 1 Score: 164.851 bits (416), Expect = 4.696e-41
Identity = 155/531 (29.19%), Postives = 248/531 (46.70%), Query Frame = 2
Query:  275 KILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYN----YANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSEN----FQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGG-IHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLD 1840
            KIL+AN G   ++  R+    + +T         V + + ED  +   + + +D+   + G   QY     Y  +D I+ +A + +VD +  G+G  SEN +  + + K  I +IGPP E +  +GDKV++  +A   N+PT+P +            P++ V                                           EAL+   + G+P++IKA+ GGGG+G+R     ++    FQ    + +        F+ +F +  +H+EVQ+LAD +G  + LF RDCSVQRRHQK++E AP    P EV + +   A+ LA+  GY +AGT E+L D    + +F+E+NPR+QVEH  TE +T I++ A+Q+QIA G  L ++     L+++  T                 G  I  RIT+E+P + F+P  G +E         V      +  G  I    DS    C     T E  R  M+  L E  IRG  +T + +L+ +L +  FI     T ++D
Sbjct:   21 KILVANRGEIPIRIFRTAHELSMQT---------VAIYSHEDRLST--HKQKADEAYVI-GEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGT----------PGPIETV------------------------------------------EEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLG----LFQDKITT---------------RGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFID 466          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Nematostella
Match: EDO43747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ3])

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 607/1119 (54.24%), Postives = 793/1119 (70.87%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTS--NQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNI---IFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPD 3562
            V +  EFV   GG R I+K+LIANNGIAAVKC+RSIR WAYE   ++ AI+F+ MVTPED  ANAEYIKM+D    VPGGSN  NYANVDLILDVA R  V AVWAGWGHASENPKLP++L K+NI FIGPP EAMW LGDK+ASTIIAQ+  IPTLPWSG+GL I                     LE  G  T          +P +LY QA +++  + L+ A  IG+P+MIKASEGGGGKGIRKA++ + F + F QVQ EVP SPIF+MK AEH+RHLEVQ+L D+YG A+SLFGRDCSVQRRHQKI+EEAP  VA  E   +ME+ AI LA++VGYVSAGTVEYLY+    K+FFLELNPRLQVEHPCTE + D+NLPA+QLQ+AMG+PLHRIK+IR LY +     + I F  P    +P GHVIA RIT+ENPDEGFKPS G ++ELNF+S + VWGYFSV++ GG+HE++DSQFGH F++ E RE AR N+VL LKE+SIRGDFRTTVEYLIK+LE +SF  N   T WLD +I+++ QT+  +P L  +  AIH+ +  + + F+ Y+  +ER QI     L N VDV LI++  KY +   + GP ++ L+MN + VE E H+L DG LL+++   S+T+Y+KE+I  YR+ I   T  F+K+ DP+VL +PS GKL+ Y VEDG HVF    YA +EVMK+ M L  T SGC+HY+K  GA+LD G  VATL LDD   + +A+ +TG+F  S  N      KL+QV+    + L+ ++DGYC+ EPY TP+L++ V   +  LR+P LPL+EL+E++S I+GRIP +VE AIK+ ++ YASN+TS+LSQFP  +I +++    ++L+K+ E+D + + TQ I  LV +Y  GVRGH+K  +  L  KY   E LF EG+ +KCV ILL  + K++++ ++   +FSH NV+ KNKL + LID L   E GL  +L+  L   T+LN+ E++KV+LR+RQ L+A+Q P+YE RHNQ+ES+FLSA+D  G QF PE+L++LI SET +FD++  FFYH N  V  AALEVYVRR+Y AYELT ++   L    FIVEF+F LPS+HP+
Sbjct:    1 VVTPAEFVRKFGGTRVIEKVLIANNGIAAVKCMRSIRRWAYELIGNEKAIKFITMVTPEDLRANAEYIKMADHYSLVPGGSNNNNYANVDLILDVAKRIPVQAVWAGWGHASENPKLPDLLSKNNITFIGPPAEAMWSLGDKIASTIIAQTVGIPTLPWSGSGLVI---------------ENHTEVLEQGGVLT----------VPDELYDQASMNEVTDGLKIARSIGYPVMIKASEGGGGKGIRKANNDDEFTNFFRQVQIEVPSSPIFIMKVAEHSRHLEVQLLVDEYGNAVSLFGRDCSVQRRHQKIIEEAPAAVAKPETLRKMEEDAINLAKVVGYVSAGTVEYLYNPDDDKYFFLELNPRLQVEHPCTEFIADVNLPAAQLQVAMGVPLHRIKDIRVLYGKSAYGSDNIVFEPPPPYKKPKGHVIATRITAENPDEGFKPSSGTVQELNFRSMKDVWGYFSVAASGGLHEYADSQFGHLFAWGEDREDARRNIVLALKEISIRGDFRTTVEYLIKLLEKDSFKSNRFSTNWLDSLIAEREQTEKPEPILGVIAGAIHVADATITKRFANYRDALERGQILPEDCLGNSVDVELIYEGYKYCLTATRLGPNSFFLLMNGSFVEIETHRLSDGGLLLSFEGHSHTSYMKEQIDSYRMTIGGMTWVFQKQNDPTVLRAPSAGKLIGYLVEDGGHVFQGETYAEIEVMKMVMPLTVTESGCLHYVKGGGAVLDPGTKVATLELDDPSRVTQAQLYTGTFPVSETNSIQKGMKLHQVYQIAKENLQNVMDGYCVDEPYLTPRLEENVDVLLKSLRNPALPLLELKEMISSIAGRIPLSVEDAIKRHLANYASNLTSLLSQFPSQQIANVVDAHASTLTKREERDAFFLNTQGIVQLVQRYRNGVRGHLKAVVLALLRKYLQSEILFNEGNFEKCV-ILLRAQSKSKDLSSVVSTVFSHVNVSKKNKLAITLIDRLCGYEPGLSDELHSILQELTHLNRQEHAKVALRARQALLASQQPSYERRHNQIESLFLSAVDIMGSQFSPESLQKLIYSETAIFDVLPSFFYHKNEAVRKAALEVYVRRSYQAYELTTLYHEMLNENVFIVEFQFSLPSSHPN 1093          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Nematostella
Match: EDO44779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUP0])

HSP 1 Score: 198.749 bits (504), Expect = 1.597e-52
Identity = 153/556 (27.52%), Postives = 252/556 (45.32%), Query Frame = 2
Query:  194 RAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLP-WSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMG--IPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNF-KSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWL 1837
            R +N+ R     ++  +I Q  + PI KIL+AN G  A + + + R    +T           +    + +A + ++ ++D+   +    +  +Y  +  I++VA +T   A+  G+G  SE+P+  ++  + NIIFIGPP  A+  +G K  S  I     +P +  + G                 +S  R +   E  GY                                      P+M+KA  GGGGKG+R  +S + F  +    +NE   S     + + KF E  RH+EVQ+  D+ G  + L+ RDCSVQRRHQKI+EEAP     +EV   + +AA+  A+ VGY  AGTVE++ D  +Q F+F+E+N RLQ +HP TE++T ++L   QL+IA G  +PL          K+D                  +GH    R+ +E+P   F P  G +  L   +  + +     V     +  + D        ++ETR  A   +  +LK+ ++ G   T + +L  + +  SF   D+ T ++
Sbjct:   13 RWMNLSR---NPLHHLLIRQKSSVPISKILVANRGEIACRVMHTARRMGVQT-----------VAVYSNADAKSLHVSLADEAYRIGPAPSSESYLKMHKIMEVAKKTGAQAIHPGYGFLSESPEFADLCQEENIIFIGPPASAIRDMGIKSTSKSIMSDAGVPIIQGYHGED---------------QSVERLQQEAERIGY--------------------------------------PVMLKAVRGGGGKGMRIVNSPDEFHEMLESAKNESIKSFNDDSMLVEKFVETPRHVEVQVFGDRQGNVVYLYERDCSVQRRHQKIIEEAPAPGVSDEVRRSIGEAAVRAAKAVGYFGAGTVEFIMD-SSQNFYFMEMNTRLQAKHPITEMITGLDLVEWQLKIAAGEDLPL----------KQDEVQL--------------HGHAFEARVYAEDPSSDFLPGAGPLLHLTTPQETQHIRIDTGVRQGDQVSTYYDPMIAKLVVWSETRPSALRLLKESLKKYNVVG-LETNISFLTSLCDHNSFQAGDVHTDFI 475          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Nematostella
Match: EDO48484 (Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc:A7RIZ1])

HSP 1 Score: 191.045 bits (484), Expect = 1.235e-48
Identity = 146/531 (27.50%), Postives = 241/531 (45.39%), Query Frame = 2
Query:  269 IKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYN-YANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGG---IHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWL 1837
            IKKIL+AN G  A++  R+           +  IR V + + +D  AN  + + +D+   V  G      Y N+  I+ +A   + DA+  G+G  SE         K  +IFIGP  + +  +GDK+ +  +A ++ +P +P + N    PI+ +   K   E                                                + G P++ KA+ GGGG+G+R     E+ +  F    NE   +     +F+ KF E  RH+EVQ++ D YG  + LF RDCSVQRRHQK++E AP     + + + + + A+ L + VGY +AGTVE+L D +    +F+E+N RLQVEH  TE +T ++L  +Q+ +A G  L  +  +++  K                     G  I  R+T+E+P   F P  G +E   F+S   +      SS      I    DS      + A +  +A   +  +L+E  +RG  +T  E++  +L+ + F+   + T ++
Sbjct:   50 IKKILVANRGEIAIRVFRA---------ATEAGIRTVAIYSEQD--ANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKERECDAIHPGYGFLSERADFAHACTKSGVIFIGPSPQVVHMMGDKLEARKMAINSGVPVVPGTEN----PIRTAEEAKQFCE------------------------------------------------EHGLPVITKAAYGGGGRGMRVIWKMEDLEEFFNLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPHLDDAIRQTLTEDAVRLCKAVGYSNAGTVEFLLD-QEGNHYFIEVNARLQVEHTVTEEITGVDLVRAQIGVAEGKTLGELGLVQDNIK-------------------ITGAAIQARVTTEDPANNFTPDTGRIEV--FRSGEGMGIRLDGSSAFAGAVISPHYDSLLTKVIAHANSHREAATKLHRSLREFRVRG-VKTNTEFIRNVLQHKDFLDGHVTTDFI 494          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Nematostella
Match: EDO48483 (Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc:A7RIZ0])

HSP 1 Score: 181.03 bits (458), Expect = 1.206e-45
Identity = 145/527 (27.51%), Postives = 236/527 (44.78%), Query Frame = 2
Query:  281 LIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYN-YANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGG---IHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWL 1837
            ++AN G  A++  R+           +  IR V + + +D  AN  + + +D+   V  G      Y N+  I+ +A   + DA+  G+G  SE         K  IIFIGP  + +  +GDK+ +  +A    +P +P    G   PI+ +   +        Q H                                           G P++ KA+ GGGG+G+R   + ++ +  F    NE   +     +F+ KF E  RH+EVQ++ D YG  + LF RDCSVQRRHQK++E AP  +  E + + + + A+ L + VGY +AGTVE+L D +    +F+E+N RLQVEH  TE +T I+L  +Q+ +A G  L  +  +++  K                     G  I  R+T+E+P   F P  G +E   F+S   +      SS      I    DS      + A +  +A   +   L E  IRG  +T   +L+ +L+ +SF+   ++T ++
Sbjct:    1 MVANRGEIAIRVFRA---------ATEAGIRTVAIYSEQD--ANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKDKECDAIHPGYGFLSERADFARACTKSGIIFIGPSPQVVHMMGDKLEARKVAVEAGVPVVP----GTAEPIRNAEDARAFC-----QEH-------------------------------------------GLPVITKAAYGGGGRGMRVIWNLDDVEKYFTLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPLLDENIRQTLTEDAVRLCKAVGYSNAGTVEFLLD-QEGNHYFIEVNARLQVEHTVTEEITGIDLVRAQIGVAEGKTLGELGLVQDNIK-------------------ITGAAIQARVTTEDPANNFTPDTGRIEV--FRSGEGMGIRLDGSSAFAGAVISPHYDSLLTKVIAHASSHREAATKLHRALTEYRIRG-VKTNTSFLMNVLKHDSFLNGTVNTDFI 441          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Nematostella
Match: EDO25388 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWM2])

HSP 1 Score: 156.377 bits (394), Expect = 3.161e-41
Identity = 124/406 (30.54%), Postives = 195/406 (48.03%), Query Frame = 2
Query:  404 NANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSV 1609
            +A + ++K +D+   +    ++ +Y  +  I+  A  T  DA+  G+G  SEN K  +I  +H I FIG   E +  +GDK  +     +  +P +P S              + V+E+                               ++ C     E + +AT  G+P+M+KAS GGGGKG+R     EN +  +   + E   +     +++ K  E  RH+E+QI+ D  G+A  L  RDCS+QRRHQK+ EE P     +E+ E+M KAA+  A+ + Y  AGT+E+L D K + F+F+E+N R+QVEHP TE V D +L   Q+ +A G+P+                 +  N+        P  H I  RI +E+P  GF+PSPG +  L+      V
Sbjct:    4 DAESLHVKFADEAVCIGPPPSKDSYLKMSNIIAAAEITNADAIHPGYGFLSENAKFSKICEEHGIKFIGASPEMIDRMGDKANAKSTMIAAGVPCVPGS--------------EGVIET-------------------------------FEEC-----EKIAKAT--GYPVMLKASAGGGGKGMRGVFKPENLKDAWDSARQESKAAFGNDDMYMEKLIEEPRHIEIQIVGDSTGRACHLSERDCSIQRRHQKLTEETPSPFMTDELREKMGKAAVKAAEYIKYEGAGTIEFLVD-KHRNFYFMEMNTRIQVEHPITEQVIDFDLIREQILVAAGVPI-----------------SGRNY-------LPKLHSIECRINAEDPFNGFRPSPGTITTLHAPGGHGV 332          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Medaka
Match: acacb (acetyl-CoA carboxylase beta [Source:NCBI gene;Acc:101171338])

HSP 1 Score: 1246.11 bits (3223), Expect = 0.000e+0
Identity = 614/1117 (54.97%), Postives = 800/1117 (71.62%), Query Frame = 2
Query:  221 VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQN-IMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR 3565
            VAS  EFV   GGNR I+K+LIANNGIAAVKC+RSIR W+YE F+++  IRFV MVTPED  ANAEYIKM+D    VPGGSN  NYANV+LI+D+A R  V  VWAGWGHASENPKLPE+L+K  I F+GP  +AMW LGDKVAS+I+AQS +IPTLPWSG+GL         V +  E   + +                    +P ++Y + CV D  + L  A +IG+P++IKASEGGGGKGIRK  +SE+F   F QVQ EVPGSPIF+M+ A+HARHLEVQILAD+YG AISLFGRDCS+QRRHQKI+EEAP  +A     EQME+ A+ +A++VGYVSAGTVEYLY  +   F FLELNPRLQVEHPCTE++ D+NLPA+QLQIAMGIPL RIK+IR LY E P     INF  P + P P GHVIAVRITSENPDEGFKPS G ++ELNF+S+++VWGYFSV + GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIKILE+ES+  N+IDTGWLD++I++KVQ +  D  L  +C A+H+ +    +S S Y   +ER Q+  +  L N V+V LI++ +KY +++ +  P  Y ++MN +++E +VH+L DG LL+ Y   S+TTY+KEE+  YR+ + N T  FEKE DP+VL SPS GKL+QY VEDG H+F+   YA +EVMK+ M L    SGCI+++KRPGA+L+ GC +A + LDD   +      T S        +V  KL+QVF   ++ L  ++DGYCL EPYF+ KL++ V   M  L+DP LPL+ELQE+M+ ++GRI  +VE+ I++ M+ YASN+TSVL QFP  +I +IL +   +L ++++++ + M TQ I  LV +Y  G+RG+MK  + +L  +Y  VE  FQ+ H+DKCV  L+E    N + +++ IFSH  V+ KN L+ +LID L   +  L  +L   L   T L+   NSKV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF PENL++LILSET +FD++ +FFYH N +V  AALEVYVRR YIAYEL  +   QL +G   V+F+F+LPS+HP+R
Sbjct:  181 VASPAEFVTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERTIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIAKRIPVQGVWAGWGHASENPKLPELLHKAGISFLGPSSKAMWALGDKVASSIVAQSADIPTLPWSGSGLK--------VDWTEEDQTQGK-----------------VISVPPEVYNEGCVRDVEDGLAGAERIGYPVVIKASEGGGGKGIRKVENSEDFPGFFRQVQTEVPGSPIFVMQLAQHARHLEVQILADEYGNAISLFGRDCSIQRRHQKIIEEAPATIAASSTLEQMEQYAVRMAKMVGYVSAGTVEYLYS-EDGSFHFLELNPRLQVEHPCTEMIGDVNLPAAQLQIAMGIPLSRIKDIRLLYGESPWGDTHINFEVPYRLPSPRGHVIAVRITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGATGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKILETESYRNNEIDTGWLDHLIAEKVQAERPDTMLGIVCGALHVADASFRKSMSDYLHSLERGQVLPAASLLNSVNVELIYEGVKYFLKVARQSPTTYVIMMNGSNIEIDVHRLSDGGLLLCYDGCSHTTYMKEEVDSYRITVGNKTCVFEKEKDPTVLRSPSAGKLLQYMVEDGGHIFAGETYAEIEVMKMVMTLTVEQSGCINFVKRPGAVLEPGCVMAHMDLDDPSKLN-----TASLPPQQPLPTVGEKLHQVFHSELENLINVMDGYCLEEPYFSSKLKEWVATLMKTLKDPSLPLLELQEIMTSVAGRITPSVEKEIRKVMAQYASNITSVLCQFPSQRIANILDSHAATLQRKADREVFFMNTQSIVQLVQRYRSGIRGYMKSVVLDLLKRYLKVETQFQQAHYDKCVMNLIELHKPNVSPVLDYIFSHSQVSKKNVLVTMLIDQLCGRDPTLADELMAILNELTQLSNEGNSKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETSIFDVLPNFFYHSNQVVCMAALEVYVRRGYIAYELNSIQHHQLLDGTCAVDFQFMLPSSHPNR 1266          

HSP 2 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 609/1154 (52.77%), Postives = 806/1154 (69.84%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGV--TDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTM 7375
            SPPCQRMGAM AF+  D+F+  FDE++  F+ I         +T +     S N +E PIHI NV+ +     +D+   K+ + F   KK V  E GIRR+TFL+     FP++FTFRA++ F+EDRIYRHLEPALAFQLE+NRMRN+DL+ +P  N +MHLYL  A+V EG EVTDYRFF+R+IIRH+DL+TKEASFEY+ NE ER LLE++D LE+A ++    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G  IP+R++L NE GY L+IS+YKEV D T+GQI F+S+G+ K+G LHGML+ +PY TKD LQ KRFQA    TTYVYD+P++  QAL  +W   +     E P  ++L   EL+LD    +V++ ++PG N++GMVA+RMK+ TPEYPE GR+II+I ND+TY +GSF   ED LFL+ASELAR  GIPRI+ A+N GARIGLAEE K++FN+AW+D  DP KGFKYLYLTP +Y ++   N++ C  +E+ GE+RY ITDIIG  DGIGVENLR SG IAGE+S AYDEI+TIS+V+ RA+GIGAYLVRLG RVIQVENSHIILTGA+ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  +L+WLSYI   K+   PV     A  DP++R + + P K  +  DPR ++ G     + G + SG FD  S+ EIL  WA++VV GRARLGGIP+ VI  ETR+V  +IPADPAN  +E + +Q AGQVWFP SA+KTAQA+ DFNRE LPL +FANWRGFSGGM DMYDQ+LKFG+YIVD L+ + QPV VYIPPH ELRGG+WVV+DPTIN  YME++AD + S GG+LE EG VEIK+R KDL+KT++RLD +   +  +L S +    Q  K L + L AR + LLP+YHQ+A+ F  LHDTPGRM  KGV++ ++ W + R  FY +LRR LLE      +        + + D+S+G                                    H  ++L+RWFVE +G  K+YLW ++  V  WLE  +   ++ +   I + ++  +R+N L  I+ LV  NPD+ M+ I+ + Q +  +Q ++++++L+TM
Sbjct: 1291 SPPCQRMGAMVAFQCFDDFKRNFDEVLSSFADI--------FLTTKSLVNLSQNTRENPIHIINVSIKSADTEDDEALVKVFAAFTQSKKAVLFEYGIRRITFLVAQKREFPKFFTFRARDGFQEDRIYRHLEPALAFQLELNRMRNFDLKAVPCENHKMHLYLGAARVEEGTEVTDYRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFSNTGV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGNAIPIRLFLTNESGYYLDISLYKEVTDSTSGQITFQSYGD-KQGPLHGMLINSPYVTKDLLQAKRFQAQTLGTTYVYDFPEMFRQALFKLWGPGD-----ETPK-DVLVCCELVLDLEGRLVQMNRLPGDNDVGMVAFRMKMKTPEYPE-GRDIIVICNDITYMIGSFGPQEDELFLRASELARAEGIPRIYIAANSGARIGLAEEIKHMFNVAWIDPADPYKGFKYLYLTPQNYTRISSTNSIHCHHVEEGGESRYIITDIIGNTDGIGVENLRGSGTIAGESSQAYDEIITISMVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVTDDFEGVFTILQWLSYI---KHCSAPVM----ATADPVDREIEFTPTK--APYDPRWMLAGRPHPSIKGAWQSGFFDHGSFMEILGSWAQTVVVGRARLGGIPLGVIAVETRSVEVTIPADPANLDSESKVLQQAGQVWFPDSAFKTAQAIGDFNRENLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDALRGFRQPVLVYIPPHAELRGGSWVVIDPTINPQYMELYADKE-SRGGVLEAEGTVEIKFRRKDLLKTMRRLDSVYAGLVEQLASPELPQKQ-SKELEAKLRAREEFLLPIYHQVAVQFVDLHDTPGRMQEKGVITDVLEWKNVRTFFYWRLRRLLLEQVVKYEI-------LQANRDLSDG------------------------------------HLQSMLRRWFVETEGTVKAYLWDNNQAVVEWLEKHLS-KEDGTRSAIRENIKYLKRENALKHIRSLVEANPDVAMDCIIHMSQYITPSQRANVSHLLATM 2371          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Medaka
Match: acaca (acetyl-CoA carboxylase [Source:NCBI gene;Acc:101155873])

HSP 1 Score: 1199.5 bits (3102), Expect = 0.000e+0
Identity = 624/1182 (52.79%), Postives = 824/1182 (69.71%), Query Frame = 2
Query: 3920 SPPCQRMGAMAAFKTMDEFEEVFDEIMDHFS-----SIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAG----------------TFPRY-FTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIW--SEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITG--VTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAA 7387
            +PPCQRMGAM +F++  EF     +++  FS     S    +  N V+  +D    + ++++EPIHI NVA + D  ++DD    +  +F   KK V  E GIRR+TFL+                    + P+  FT  +K  F+EDRIYRHLEPALAFQLE+NRMRN+ L  IP  N +MHLYL  A+V  G EVTDYRFFVR+IIRH+DLVTKEASFEY+ NEAER LLE++D LE+A  +    RT+CNHIFLNF PT+ + D +++EE+VR MVMRYGSRLWKLRV QAELK+ +R++  G++IP+R++L NE GY L+IS+YKEV D  TGQI F+++G+ K+G LHGML+  PY TKD LQ KRFQA +  TTYVYD+P++  QAL+ IW  SE   +L    P  ELLT+ EL+LD  + +V++ ++PG N IGMVAWRM L TPEYP  GREII+ISND+T+K+GSF   ED+LFL+ASE+AR+  IPRI+ A+N GARIGLAEE +++F++AW D  DP KGF YLYLTP D++++  LN+V CE IEDEGE+RYKITDIIGKE+G+GVENLR SGMIAGE+SLAY+EI+T++LV+ RA+GIGAYLVRLG R IQVENSHIILTGA ALNKVLG +VYTSN+QLGGVQIM NNGV+H  V D+ +G+  LL+WLSY+P  K+ P+P+     +  DPI+RP+ ++P K  +  DPR ++ G       G + SG FD  S+ EI+  WA+SVV GRARLGGIP  V+  ETR+V  SIPADPAN  +E + +Q AGQVWFP SA+KTAQA++D NREGLPL +F+NWRGFSGGM DMYDQ+LKFG+YIVD L+ Y QPV VYIPP  ELRGG+WVV+DPTIN  +MEM+AD   S GG+LEPEG VEIK+R KDL+KT++R+DP+ +S+ +E L     +   +K L + L  R + LLP+YHQ+A+ FA LHDTPGRM  KGV++ ++ W  SR+ FY +LRR LLE                              D VKK+  + N+        ++ G I        +L+RWFVE +G  K+YLW ++  V  WLE Q+   +  +   I + ++  RRD+ L  I+ LV+ NP++ M+ I+ + Q ++  Q +++  ILSTM  ++
Sbjct:  969 TPPCQRMGAMVSFRSFQEFIRNITDVLSCFSETPPPSPTFPDGGNPVLYGEDD---NKSVQDEPIHILNVAIKTDSDMDDDGLAAMFREFTQSKKSVLFEHGIRRLTFLVAQKDFRKQINCEVDQRFHVISLPQSDFTVFSKQ-FEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNTTV-RTDCNHIFLNFVPTVIM-DPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQIMFQAYGD-KQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALKKIWHSSEAYADLPKSPPPSELLTFTELVLDAQDQMVQMNRLPGGNEIGMVAWRMTLRTPEYP-AGREIIVISNDITHKIGSFGPQEDMLFLRASEMARESSIPRIYIAANSGARIGLAEEIRHMFHVAWQDPSDPYKGFNYLYLTPQDFKKVSALNSVHCEHIEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHCTVCDDFEGVFTLLQWLSYMPKCKSSPVPIL----SAKDPIDRPIEFVPTK--TPYDPRWMLAGRPSQTPKGSWQSGFFDHGSFMEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKLIQQAGQVWFPDSAFKTAQAIKDLNREGLPLMVFSNWRGFSGGMKDMYDQVLKFGAYIVDGLREYKQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKD-SRGGVLEPEGTVEIKFRRKDLVKTMRRVDPVYMSL-AERLGTPELSPPDRKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWQTSRQFFYWRLRRLLLE------------------------------DTVKKKIQAANSE-------LTDGQIQA------MLRRWFVEAEGTVKAYLWDNNEEVVGWLEKQL-AEEEGARSIIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMETSS 2090          

HSP 2 Score: 1061.98 bits (2745), Expect = 0.000e+0
Identity = 532/963 (55.24%), Postives = 695/963 (72.17%), Query Frame = 2
Query:  803 TSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVA-KLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQ-KDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDR-NVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGF 3682
            T  N +K   ++P DLY   C  D    L+ A +IGFP+M+KASEGGGGKGIRK +++E+F +LF QVQ EVPGSPIF+M+ A+HARHLEVQILADQYG AISLFGRDCSVQRRHQKI+EEAP  +A  +VFE MEK A+ LA++VGYVSAGTVEYLY  +   F+FLELNPRLQVEHPCTE+V D+NLP +QLQIAMGIPLHRIK+IR LY   P     I+F   +  P P GHVIA RITSENPDEGFKPS G ++ELNF+SN++VWGYFSV++ GG+HEF+DSQFGHCFS+ E RE+A  NMV+ LKE+SIRGDFRTTVEYLIK+LE+ESF  N IDTGWLD +IS+K+Q +  D  L  +  A+H+ +  L  S S +   +ER Q+  +  L N VDV LI++  KY + + +  P +Y +IMN +  E +VH+L DG LL++Y  +SYTTY+KEE+  YR+ I N T  FEKE DPS+L SPS GK++QYTVEDG H+F+   YA +EVMK+ M L T+ SGCIHY+KR GA L+ GC +A L LDD   +++AE +TG+  +    A    KL++VF   +  L  +++GYCLPEP+F  KL++ V + M  +RDP LPL+ELQ++M+ +SGRIP  VE+AIK++M+ YASN+TSVL QFP  +I +IL +   +L+K+SE++ + M TQ I  LV KY  G+RGHMK  + +L  +Y  VE  FQ GH+DKCV  L E+ K    N++N IFSH  V  KN L+ +LID L   +  L  +L   L   T L+K+ N+KV+LR+RQVLIA+  P+YE+RHNQVESIFLSAID YGHQF  ENL++LILSET +FD++ +FFYH N +V  AALEVYVRRAYIAYEL  V   QLK+   +VEF+F+LP++HP+R N+ T+ R +   N++     +Y +    S+++    T F
Sbjct:   12 TENNQKKKVINVPPDLYELGCTQDVESGLKAAEKIGFPVMVKASEGGGGKGIRKVNTAEDFPNLFRQVQAEVPGSPIFVMQLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVRLAKMVGYVSAGTVEYLYS-QDGSFYFLELNPRLQVEHPCTEMVADVNLPTAQLQIAMGIPLHRIKDIRVLYGLQPWGDCPIDFEGLSNTPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGIVSGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGTKYVLTVTRQSPNSYVVIMNKSLAEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSLLRSPSAGKIIQYTVEDGGHLFAGQCYAEIEVMKMVMTLTTSESGCIHYVKRAGAALEPGCIIAKLQLDDPSRVQQAELYTGTLPSIQAVALRGEKLHRVFHSTLDHLVHVMNGYCLPEPFFGVKLKEWVERLMKTMRDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNKKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLKVEIQFQNGHYDKCVFALREENKGDMANVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELMTILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLN-----HYGMVHVASVSDVLLDTSF 968          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Medaka
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:101161876])

HSP 1 Score: 199.519 bits (506), Expect = 2.383e-52
Identity = 165/574 (28.75%), Postives = 256/574 (44.60%), Query Frame = 2
Query:  206 MPRPVVASINEFVINQGGN--RPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNF-KSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAA 1906
            +PR +  S     +  GG     I+K+LIAN G  A + +R+ +         +  +R V + +  D ++   ++ M+D+   +    +Q +Y +V+ +L+VA ++   AV  G+G  SEN +  E   +  IIFIGPP  A+  +G K  S                                       +H +   G P                 Y          L  A +IGFP+MIKA  GGGGKG+R A S  +F       + E   S     + + KF E  RH+EVQ+  D +G A+ LF RDCSVQRRHQKI+EEAP      EV +++ +AA+  A+ V YV AGTVE++ D +   F+F+E+N RLQVEHP TE++T  +L   QL++A G       E   L ++D  L                GH    RI +E+P+  F P  G +  L+   ++R       V     +    D        + E R  A + +   L++ +I G   T +++L+ +     F   ++ T ++    S    T    P+ A +C A
Sbjct:   17 LPRKLTWSRRSVRLASGGGGVERIEKVLIANRGEIACRVMRTAK---------KMGVRSVAVYSEADKSSM--HVAMADEAYHIGPPPSQQSYLSVEKVLEVAKKSGSHAVHPGYGFLSENTEFAEACKREGIIFIGPPSSAIRDMGIKSTS---------------------------------------KHIMSAAGVPIIGG-------------YHGEDQSNERLLAEAAKIGFPVMIKAVRGGGGKGMRIARSETDFLEQLESARREARKSFNDDVMLVEKFVEDPRHVEVQVFGDTHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRKKLGEAAVRAAKAVNYVGAGTVEFIVDAQ-HNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRVAAG-------ERLPLLQDDIIL---------------RGHSFEARIYAEDPNNEFLPGAGPLLHLSTPPADRHTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVG-LNTNIDFLLSLSGHPEFEAGNVSTSFIPQHYSDLFPTPRA-PSGATICQA 502          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Medaka
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:101161876])

HSP 1 Score: 193.356 bits (490), Expect = 1.965e-50
Identity = 162/556 (29.14%), Postives = 252/556 (45.32%), Query Frame = 2
Query:  254 GGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNF-KSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAA 1906
            GG   I+K+LIAN G  A + +R+ +         +  +R V + +  D ++   ++ M+D+   +    +Q +Y +V+ +L+VA ++   AV  G+G  SEN +  E   +  IIFIGP                                      PSS ++             +M    TS ++   A  +P    Y          L  A +IGFP+MIKA  GGGGKG+R A S  +F       + E   S     + + KF E  RH+EVQ+  D +G A+ LF RDCSVQRRHQKI+EEAP      EV +++ +AA+  A+ V YV AGTVE++ D +   F+F+E+N RLQVEHP TE++T  +L   QL++A G       E   L ++D  L                GH    RI +E+P+  F P  G +  L+   ++R       V     +    D        + E R  A + +   L++ +I G   T +++L+ +     F   ++ T ++    S    T    P+ A +C A
Sbjct:   17 GGVERIEKVLIANRGEIACRVMRTAK---------KMGVRSVAVYSEADKSSM--HVAMADEAYHIGPPPSQQSYLSVEKVLEVAKKSGSHAVHPGYGFLSENTEFAEACKREGIIFIGP--------------------------------------PSSAIR-------------DMGIKSTSKHIMSAA-GVPIIGGYHGEDQSNERLLAEAAKIGFPVMIKAVRGGGGKGMRIARSETDFLEQLESARREARKSFNDDVMLVEKFVEDPRHVEVQVFGDTHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRKKLGEAAVRAAKAVNYVGAGTVEFIVDAQ-HNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRVAAG-------ERLPLLQDDIIL---------------RGHSFEARIYAEDPNNEFLPGAGPLLHLSTPPADRHTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVG-LNTNIDFLLSLSGHPEFEAGNVSTSFIPQHYSDLFPTPRA-PSGATICQA 484          
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Medaka
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:101175100])

HSP 1 Score: 191.43 bits (485), Expect = 9.665e-50
Identity = 159/531 (29.94%), Postives = 245/531 (46.14%), Query Frame = 2
Query:  272 KKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGS----PIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFK-PSPGIM----EELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWL 1837
            +K+LIAN G  A + I++ +    +T           +    D ++NA ++KM+D+   V       +Y N+D IL+   RT   AV  G+G  SEN +  + L   ++ FIGP   A+  +GDK+ S +IA++  + T+P                                                     +   V    +A++ A QIG+P+MIKAS GGGGKG+R A + E  +  F     E   S     + + K+ +  RH+E+Q+LAD++G A+ L  R+CS+QRR+QK++EEAP           M + A+ LA+ V Y SAGTVE+L D + + F+FLE+N RLQVEHP TE +T ++L    +++A G  L   +E                 + P      NG  I  R+ +E+P + F  PS G +    E L+  + R   G   +     I  + D       +F  TR +A   M  +L    IRG     +  L +I+    FI  DI T +L
Sbjct:   50 QKLLIANRGEIACRVIKTCKRMGIQT-----------IAVHSDVDSNAVHVKMADEAVCVGPAPTSLSYLNMDAILNAVRRTGAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIQSKLIAKAAKVNTIPG----------------------------------------------------FDGVVKSAEDAVKIAQQIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDRPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPTTRRAMGEQAVQLAKAVQYSSAGTVEFLVDAQ-KNFYFLEMNTRLQVEHPITECITGLDLVEQMIRVAKGYRLQHKQE-----------------DIPI-----NGWAIESRVYAEDPFKSFGLPSIGRLSQYQEPLDLSNVRVDSG---IEEGSDISIYYDPMISKLVTFGATRAEALARMEESLDRYVIRG-VTHNIPLLREIITHPLFISGDISTNFL 490          
BLAST of Acetyl-CoA carboxylase 1 vs. Planmine SMEST
Match: SMESG000065082.1 (SMESG000065082.1)

HSP 1 Score: 5022.6 bits (13027), Expect = 0.000e+0
Identity = 2448/2450 (99.92%), Postives = 2449/2450 (99.96%), Query Frame = 2
Query:   71 MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 7420
            MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGS+EFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEE DQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL
Sbjct:    1 MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSIEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEETDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 2450          
BLAST of Acetyl-CoA carboxylase 1 vs. Planmine SMEST
Match: SMESG000065082.1 (SMESG000065082.1)

HSP 1 Score: 4997.57 bits (12962), Expect = 0.000e+0
Identity = 2436/2438 (99.92%), Postives = 2437/2438 (99.96%), Query Frame = 2
Query:  107 MPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 7420
            MPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGS+EFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEE DQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL
Sbjct:    1 MPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSIEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEETDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 2438          
BLAST of Acetyl-CoA carboxylase 1 vs. Planmine SMEST
Match: SMESG000065082.1 (SMESG000065082.1)

HSP 1 Score: 4970.99 bits (12893), Expect = 0.000e+0
Identity = 2428/2450 (99.10%), Postives = 2429/2450 (99.14%), Query Frame = 2
Query:   71 MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 7420
            MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRP                    SITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGS+EFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEE DQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL
Sbjct:    1 MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRP--------------------SITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSIEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEETDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 2430          
BLAST of Acetyl-CoA carboxylase 1 vs. Planmine SMEST
Match: SMESG000065082.1 (SMESG000065082.1)

HSP 1 Score: 4942.1 bits (12818), Expect = 0.000e+0
Identity = 2416/2438 (99.10%), Postives = 2417/2438 (99.14%), Query Frame = 2
Query:  107 MPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILXXXXXXXXXXXXXXQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFRXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 7420
            MPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRP                    SITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGS+EFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEE DQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL
Sbjct:    1 MPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPVVASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAIRFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTKVDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQSTNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLRKIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKASSSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFGRDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEYLYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIKEIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPGIMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENMVLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTDSIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVLIHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYTTYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVFSNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAVSIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRFLLPSTHPDRNVQTIYRP--------------------SITNRKFSTGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSLDNDNFSLLNGSIEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEETDQNTVVTFQDPPYCSTNIKEEPIHIFNVAFREDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALELALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQIQFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLINQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNIGMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELARKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPSDYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGETSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNKVLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVKNGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLSGLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPANPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGGMMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINEDYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSELLSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKGVLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGGEFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQGADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKKLVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL 2418          
BLAST of Acetyl-CoA carboxylase 1 vs. Planmine SMEST
Match: SMESG000056269.1 (SMESG000056269.1)

HSP 1 Score: 220.32 bits (560), Expect = 6.538e-58
Identity = 139/365 (38.08%), Postives = 195/365 (53.42%), Query Frame = 2
Query: 2465 AVSIKRAETFTG---SFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFTPKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIYASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKYTKGVRGHMKMAIENLFFKYYNVEKLFQ---EGHHDKCVSILLEQKDKNQNIMNIIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTN-LNKSENSKVSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILSETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAFIVEFRF 3538
             V I+  E +TG       S    S   LN V +KC+  L  IL GY LPE YF+  L K +      LRDP LP ++ Q L+   S  IP N+   + Q ++ Y SN +SV S+FP +KI  ++    +S+  Q+ + N   I +PI  L   ++ G+RG+ K  IE L  +Y  VE  FQ   +  H    S  +   D        +FSH  +  KN+LIL LI++L +   GLI DL   +    N L+    S+V  + R++LI  Q P+YEVR N++ESIFL++I+RY +      LE LI S T +FDI+ DFFYH        ALEVY+RRAY+ YE+    Q QL +G   V F+F
Sbjct:  123 TVDIQILENYTGPCSEIPFSADNTSTENLNSVLEKCISNLNNILRGYVLPESYFSSNLTKELDILFNILRDPLLPALQFQNLLDNSSCAIPVNLLNELHQVIAQYTSNYSSVFSRFPSTKIFSLVNKFLDSIGDQNTKYNMGSILRPIMELAEMFSSGMRGNAKYIIEGLLDEYRKVEVKFQNLEDITHVNTTSQPITVSD--------VFSHNCLQKKNELILNLIENLEKYLPGLINDLKPNIHKLLNSLSGRTYSRVIAKLREILITGQVPSYEVRKNEIESIFLNSINRYSNSLSTGRLESLIYSNTEMFDIISDFFYHKMVDFRKCALEVYIRRAYMDYEIKSFKQSQLCSGNLCVIFQF 479          

HSP 2 Score: 192.586 bits (488), Expect = 3.437e-49
Identity = 121/307 (39.41%), Postives = 185/307 (60.26%), Query Frame = 2
Query: 3884 NMADDLSKLDMHSPPCQRMGAMAAFKTMDEFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAF--RXXXXXXXXXXXKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTFRAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKAKVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTXXXXXXXXXXXXTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKLRVAQAELKMMVRI-SDQGQRIPMRMW 4795
            N  +D + +D +      +G M  F T++EF    D  M   + I E +DQ+  + +         ++ + I + NVA   +E +V  DDD  +ILS+FCL+      E  I R+TFL+ S     RYFTFR   +F+ED   R ++PAL+FQLEINR++NY+LE++PV+NRRM++YL K K+     V +YR FVR II H D+ +   + E++  EAE++LLE++DA+++A     +  T  NHIF  F   L++  +  LE  VR +V+++G RLW LR+ QAELKM V++ +D    IP+R+W
Sbjct:  631 NQLEDFTTMDTN------LGIMVIFHTIEEF----DRSMKCLTQILESSDQSDYLEYDYLDSIGDMLRMKKI-VVNVALCDQELIVKSDDDVVQILSNFCLKHLSYLCESNISRITFLLQSMDKSLRYFTFRKSTNFEEDIKVRQIDPALSFQLEINRLQNYNLERLPVLNRRMYVYLGKYKLPLATNV-EYRMFVRCIIHHNDIHSSTTNVEFLAKEAEKSLLEAMDAIDIAQNDGRSSLTLANHIFFYFNSILSINKMEELESVVRSIVLKFGRRLWNLRITQAELKMSVKLENDFVNVIPIRLW 925          
The following BLAST results are available for this feature:
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACACA0.000e+055.32acetyl-CoA carboxylase alpha [Source:HGNC Symbol;A... [more]
ACACA0.000e+055.32acetyl-CoA carboxylase alpha [Source:HGNC Symbol;A... [more]
ACACA0.000e+055.32acetyl-CoA carboxylase alpha [Source:HGNC Symbol;A... [more]
ACACA0.000e+055.32acetyl-CoA carboxylase alpha [Source:HGNC Symbol;A... [more]
ACACA0.000e+055.32acetyl-CoA carboxylase alpha [Source:HGNC Symbol;A... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pod-20.000e+043.53pep chromosome:WBcel235:II:1143908:1152699:1 gene:... [more]
pod-21.486e-18041.90pep chromosome:WBcel235:II:1143908:1152665:1 gene:... [more]
pod-21.486e-18041.90pep chromosome:WBcel235:II:1143908:1152699:1 gene:... [more]
pod-27.798e-18041.90pep chromosome:WBcel235:II:1136801:1152665:1 gene:... [more]
pod-27.798e-18041.90pep chromosome:WBcel235:II:1136781:1152701:1 gene:... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACC7.478e-756.56gene:FBgn0033246 transcript:FBtr0088871[more]
ACC7.490e-756.56gene:FBgn0033246 transcript:FBtr0339124[more]
ACC7.490e-756.56gene:FBgn0033246 transcript:FBtr0339125[more]
ACC7.490e-756.56gene:FBgn0033246 transcript:FBtr0088872[more]
ACC7.490e-756.56gene:FBgn0033246 transcript:FBtr0113053[more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acaca0.000e+052.84acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-... [more]
acaca0.000e+052.73acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-... [more]
acaca0.000e+052.58acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-... [more]
acaca0.000e+052.62acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-... [more]
acaca0.000e+056.63acetyl-CoA carboxylase alpha [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cntn50.000e+052.14contactin 5 [Source:Xenbase;Acc:XB-GENE-953061][more]
cntn50.000e+052.13contactin 5 [Source:Xenbase;Acc:XB-GENE-953061][more]
cntn50.000e+056.76contactin 5 [Source:Xenbase;Acc:XB-GENE-953061][more]
cntn50.000e+056.76contactin 5 [Source:Xenbase;Acc:XB-GENE-953061][more]
cntn50.000e+056.76contactin 5 [Source:Xenbase;Acc:XB-GENE-953061][more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acaca0.000e+055.32acetyl-Coenzyme A carboxylase alpha [Source:MGI Sy... [more]
Acaca0.000e+055.32acetyl-Coenzyme A carboxylase alpha [Source:MGI Sy... [more]
Acacb0.000e+056.58acetyl-Coenzyme A carboxylase beta [Source:MGI Sym... [more]
Acacb0.000e+056.58acetyl-Coenzyme A carboxylase beta [Source:MGI Sym... [more]
Acaca6.427e-8255.65acetyl-Coenzyme A carboxylase alpha [Source:MGI Sy... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11029|ACAC_CHICK0.000e+056.76Acetyl-CoA carboxylase OS=Gallus gallus OX=9031 GN... [more]
sp|Q5SWU9|ACACA_MOUSE0.000e+055.32Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 ... [more]
sp|Q13085|ACACA_HUMAN0.000e+055.32Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 G... [more]
sp|Q28559|ACACA_SHEEP0.000e+055.14Acetyl-CoA carboxylase 1 OS=Ovis aries OX=9940 GN=... [more]
sp|Q9TTS3|ACACA_BOVIN0.000e+055.06Acetyl-CoA carboxylase 1 OS=Bos taurus OX=9913 GN=... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D0QDC10.000e+052.81acetyl-CoA carboxylase 1 isoform X4 OS=Ictalurus p... [more]
A0A2D0QAQ50.000e+052.66acetyl-CoA carboxylase 1 isoform X3 OS=Ictalurus p... [more]
A0A2D0Q9K10.000e+052.91acetyl-CoA carboxylase 1 isoform X2 OS=Ictalurus p... [more]
A0A2D0QCC90.000e+052.76acetyl-CoA carboxylase 1 isoform X1 OS=Ictalurus p... [more]
A0A2I4B3H10.000e+052.86acetyl-CoA carboxylase 1 isoform X2 OS=Austrofundu... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acacb1.405e-5451.36acetyl-CoA carboxylase beta [Source:ZFIN;Acc:ZDB-G... [more]
mccc11.958e-5329.29methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
ENSAMXT00000048164.11.234e-5163.19pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
pcca3.020e-4829.81propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
pcca1.043e-4629.41propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001516.10.000e+053.44pep scaffold:Pmarinus_7.0:GL477673:133580:241371:-... [more]
ENSPMAT00000005117.13.545e-10738.10pep scaffold:Pmarinus_7.0:GL476781:703:17658:1 gen... [more]
ENSPMAT00000005541.11.906e-8150.68pep scaffold:Pmarinus_7.0:GL482516:46:21192:-1 gen... [more]
ENSPMAT00000005537.14.468e-7648.06pep scaffold:Pmarinus_7.0:GL482516:46:21192:-1 gen... [more]
ENSPMAT00000003643.11.613e-6552.58pep scaffold:Pmarinus_7.0:GL479165:7567:28556:1 ge... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACC10.000e+043.75Acetyl-CoA carboxylase, biotin containing enzyme; ... [more]
HFA10.000e+039.68Mitochondrial acetyl-coenzyme A carboxylase; catal... [more]
DUR1,22.684e-4927.77Urea amidolyase; contains both urea carboxylase an... [more]
PYC21.252e-4729.27Pyruvate carboxylase isoform; cytoplasmic enzyme t... [more]
PYC14.696e-4129.19Pyruvate carboxylase isoform; cytoplasmic enzyme t... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437470.000e+054.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447791.597e-5227.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484841.235e-4827.50Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO484831.206e-4527.51Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO253883.161e-4130.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acacb0.000e+054.97acetyl-CoA carboxylase beta [Source:NCBI gene;Acc:... [more]
acaca0.000e+052.79acetyl-CoA carboxylase [Source:NCBI gene;Acc:10115... [more]
mccc12.383e-5228.75methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
mccc11.965e-5029.14methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
pcca9.665e-5029.94propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
back to top
BLAST of Acetyl-CoA carboxylase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065082.10.000e+099.92SMESG000065082.1[more]
SMESG000065082.10.000e+099.92SMESG000065082.1[more]
SMESG000065082.10.000e+099.10SMESG000065082.1[more]
SMESG000065082.10.000e+099.10SMESG000065082.1[more]
SMESG000056269.16.538e-5838.08SMESG000056269.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017347 ID=SMED30017347|Name=Acetyl-CoA carboxylase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=7478bp
GGCCATCATAACTTAAGCTTGAACATTATTTGCAACATAATGAATTTCAA
ATTGTAATTTTCAATAACTAATGTTTTTAAATTACAAAATGCATAATTCT
CAGAGCATGCCAAATAAAATTAAAGATGATCTTGATATAAACTCTATCTC
AAAAGAAAAAAGTGAAACAAAGATTGTTCGTCAAGAAAGTTTGCGTGCTA
TTAATATGCCTAGACCTGTAGTAGCCTCGATAAATGAGTTTGTCATAAAT
CAAGGAGGAAACCGCCCCATTAAAAAGATTTTGATTGCTAACAATGGCAT
AGCTGCAGTGAAATGTATAAGATCTATTCGAAGTTGGGCTTATGAAACAT
TTAAGGACCAACATGCAATCCGGTTTGTATGCATGGTAACTCCAGAAGAC
ACAAATGCTAATGCTGAGTATATAAAAATGTCAGATAAAATCGAAACGGT
GCCCGGAGGATCTAATCAATACAATTACGCCAATGTCGATTTGATACTCG
ATGTTGCCCTCCGCACTAAAGTTGATGCAGTTTGGGCAGGATGGGGTCAT
GCTTCTGAGAATCCGAAATTGCCGGAAATCCTTTACAAACACAATATAAT
ATTCATAGGTCCACCACATGAAGCCATGTGGTGCCTAGGAGACAAGGTAG
CATCGACAATTATTGCACAGAGCACCAATATCCCAACATTGCCATGGAGT
GGTAACGGACTAACTATTCCTATCCAGCCTTCTAGTCCTGTAAAATATGT
CTTAGAATCTCCAAATAGACAGCGTCATTCATTGGAAATGGATGGATATC
CCACATCATATAATTTACGTAAAATCGCCCCTGACATTCCTCAAGATCTT
TATTATCAAGCTTGCGTATCAGATCCAAATGAAGCCTTAGAAAGAGCCAC
CCAAATAGGATTTCCTATTATGATTAAGGCTTCAGAAGGAGGTGGAGGAA
AAGGTATTCGTAAAGCATCAAGCTCGGAAAATTTCCAAAGCTTATTTATC
CAAGTTCAAAATGAAGTTCCAGGTTCCCCTATATTCCTAATGAAATTTGC
TGAGCATGCCCGGCATTTGGAAGTTCAAATCCTAGCCGATCAATATGGCC
AGGCAATTAGTTTATTCGGAAGGGATTGTTCTGTTCAGCGCAGGCATCAG
AAAATTCTAGAGGAAGCTCCTGTAATTGTGGCTCCTGAAGAGGTCTTTGA
ACAAATGGAAAAGGCTGCAATTACACTTGCTCAAATAGTTGGTTACGTCA
GTGCTGGTACTGTCGAATATCTTTATGATATAAAAACCCAAAAATTTTTC
TTTCTTGAACTCAATCCTCGCCTTCAAGTAGAACACCCCTGTACTGAAGT
TGTTACTGATATAAATTTACCGGCATCTCAGTTGCAGATTGCAATGGGCA
TTCCATTACATAGAATTAAAGAAATTCGTGAATTATATAAAGAAGACCCT
ACACTTTTTAATAAAATAAATTTTAATAATCCTACACAAAAACCACGACC
GAATGGACATGTAATAGCGGTTAGAATAACATCAGAGAATCCAGACGAAG
GCTTTAAACCGAGTCCAGGAATTATGGAAGAACTTAATTTCAAAAGTAAT
CGTTCCGTTTGGGGATACTTTAGTGTTAGTTCTGTTGGAGGAATACACGA
ATTTTCAGATAGCCAATTTGGGCATTGCTTTTCTTTTGCCGAAACCAGGG
AAAAAGCAAGAGAAAATATGGTTCTTACACTCAAAGAAATGAGTATTCGT
GGAGACTTTAGAACAACAGTAGAGTACCTTATAAAAATATTAGAATCGGA
AAGTTTTATAATGAATGACATTGACACCGGTTGGTTGGACTATATGATTT
CGCAAAAGGTGCAGACCGACTCTATAGATCCTACTTTAGCGGCAATGTGC
GCTGCTATTCATATTGGAAATGATAAGTTGATGCGCAGCTTCAGTACTTA
TCAGATCCTCATTGAAAGACGTCAAATATCTAAAAGCCAAAAGCTGACGA
ATATTGTTGATGTAGTACTCATTCATGATTATTTGAAATATCAAATTCAG
ATTTGCAAAACTGGGCCGATTGCATATCATTTGATAATGAATAATGCATC
AGTTGAATCAGAAGTCCATAAATTACTAGATGGATGCTTGCTTATTACAT
ATGGCAACACGAGCTATACCACTTATCTCAAAGAAGAGATATATGGATAT
CGAGTGATAATCGACAATAATACCATTACATTTGAAAAGGAAACTGATCC
ATCTGTTTTAGTTTCCCCATCAACTGGGAAATTGGTGCAATATACAGTCG
AGGATGGCAGTCATGTATTTTCCAACAGTGTTTATGCACTTATGGAGGTC
ATGAAGCTGACTATGGAGCTACACACAACAGCATCTGGATGTATTCATTA
TATTAAACGTCCCGGCGCTATACTGGATGCCGGATGTCACGTTGCCACAT
TGACTCTCGATGACGCTGTCAGTATCAAAAGGGCGGAAACATTTACAGGG
TCATTTTATACGTCTAATCAGACTGCATCTGTTGCCAAGTTAAACCAGGT
GTTTGATAAGTGTGTTAAAGAATTAGAACAGATTCTTGATGGTTATTGTT
TACCAGAACCGTATTTTACACCGAAATTACAGAAAACAGTTTATCAATTT
ATGGCCTGTCTACGGGACCCCAGATTACCTCTAATAGAATTACAGGAGTT
AATGTCACAAATCTCAGGAAGAATTCCCACAAATGTTGAACGAGCAATAA
AACAACAAATGTCGATTTATGCTAGTAATGTTACATCAGTTCTCAGTCAG
TTTCCGGGGTCAAAGATTCTACATATTCTCACGAATTGTGGAAATAGTCT
TTCGAAGCAATCAGAACAGGATAATTATATGATGATTACACAGCCTATAT
TCTCTTTGGTAGGAAAATATACCAAAGGTGTTCGAGGTCACATGAAAATG
GCGATCGAAAATTTATTTTTTAAATATTATAATGTCGAGAAACTTTTCCA
GGAAGGTCATCATGATAAATGCGTTAGTATTTTGTTGGAGCAAAAGGATA
AAAATCAAAATATAATGAACATAATATTCTCCCATCAGAATGTAGCATAC
AAAAATAAATTAATTCTGCTACTCATTGACCATCTCGTGGAAAATGAATC
TGGCCTTATTAAGGATCTAAATGATGCATTAGTAAATTTTACGAATTTAA
ATAAATCGGAGAATTCCAAAGTATCGTTGCGGTCTCGACAAGTACTAATT
GCGGCTCAGAATCCTGCTTATGAAGTTAGACACAATCAGGTCGAGTCGAT
ATTCCTGTCGGCCATTGACAGATATGGGCATCAATTCCGGCCGGAAAATT
TGGAAAGACTCATTCTATCAGAAACTGTAGTTTTTGATATTGTATGTGAT
TTCTTCTATCACTGCAATCCGATGGTCATCAGTGCGGCATTAGAGGTCTA
CGTCAGACGAGCATATATTGCTTATGAATTGACATGCGTTCACCAGTGTC
AATTGAAAAATGGAGCATTCATTGTTGAATTTCGATTTTTGCTACCGAGT
ACTCATCCAGACAGGAATGTTCAAACGATTTACAGACCAGCGTCTATTGA
TAATATGGATCGAATAACTGATTATTATTATGAAATATCAGAGTTTCCAT
CTATCACGAATAGAAAATTTTCCACTGGGTTTCCTTTCGCCATGAAGTCG
TTAATTCACACGCCCAGTACTGATTCTCTTGACAGTTGCTACGATGTACC
CGATAGCCCAAATGATAATGTTGTATTGAAACCTAAACGCTGTCGTGCAA
CAAACAAGTCCCCAAGTTTGGATAACGACAACTTTTCATTGCTTAATGGA
TCAATGGAATTTGAGACATGCGGTTACAGAAATAATATGGCGGATGATTT
ATCTAAATTAGATATGCACTCTCCTCCTTGTCAACGAATGGGAGCAATGG
CGGCATTCAAAACCATGGACGAATTTGAGGAAGTTTTTGACGAAATAATG
GACCACTTCAGTTCAATACAAGAAGAAAATGATCAAAATACAGTTGTGAC
ATTTCAAGATCCTCCGTATTGTTCGACAAACATCAAAGAAGAACCGATTC
ATATTTTCAACGTAGCTTTTCGGGAAGATGTGGTTGTTGAAGATGATGAC
AATGAGAAAATTTTGTCAGATTTTTGTTTAAGAAAAAAGAAAGTATTTAT
TGAACGTGGTATTCGGAGGGTGACCTTCCTTATGACTTCTGCCGGTACAT
TCCCAAGATATTTCACTTTTAGAGCAAAAAATGATTTCAAGGAAGATCGA
ATTTATCGGCACTTAGAGCCAGCTTTGGCATTCCAATTGGAAATCAATAG
AATGAGAAATTACGACTTGGAACAAATTCCTGTTGTCAATCGACGGATGC
ATCTTTATTTGGCTAAAGCTAAAGTATCTGAAGGCCAAGAAGTTACGGAT
TACAGATTTTTTGTCCGTAGTATAATTAGACACGCAGATCTTGTTACTAA
AGAAGCGTCTTTTGAATATGTAACAAATGAAGCTGAAAGAACACTTCTCG
AGTCACTTGATGCTCTTGAACTAGCCTTGACACATCCTGACGCCCAAAGG
ACCAACTGCAATCATATATTTTTGAATTTTGCTCCGACTTTAACGTTACC
GGATTTAACTCGGTTGGAAGAAACAGTTCGAAGGATGGTCATGCGATATG
GTAGTCGCTTGTGGAAATTGAGAGTGGCTCAAGCTGAATTGAAAATGATG
GTTCGGATTAGTGATCAAGGTCAACGCATACCAATGCGAATGTGGCTTGC
TAATGAAGGTGGATATGATTTAGAAATTTCAATGTATAAAGAGGTATTGG
ATCAGACGACAGGCCAAATTCAATTCAGGTCGTTTGGGAATGGAAAAAAA
GGCAAATTACATGGAATGTTGTTGGAAGCTCCTTATCAAACTAAGGATCA
TTTACAGTTGAAAAGATTTCAAGCAATCAATTACAACACCACCTATGTAT
ATGATTATCCGAAACTGATTAATCAAGCTCTCGAAGGAATTTGGTCAGAA
TATAATCCTGAGCTCTTATTGGAAAATCCCGATATGGAATTGTTGACTTA
TATCGAGTTGATCCTTGATGACAACAACGATATTGTAGAAGTCCAGCAAA
TGCCTGGTGTGAATAATATTGGAATGGTGGCCTGGCGAATGAAACTAATA
ACTCCCGAATATCCAGAAACGGGCCGTGAGATAATTCTCATCAGTAACGA
TGTCACATACAAAATGGGTTCATTTTCAATAATGGAAGACATTTTATTCC
TCAAGGCGTCTGAACTAGCTAGAAAACTTGGTATTCCTCGCATATTCTTC
GCATCTAATTGCGGGGCAAGAATTGGATTAGCGGAAGAATTCAAAAATAT
ATTTAATATTGCCTGGCTCGATAAATTTGATCCTGAAAAAGGATTCAAAT
ATTTGTATTTGACACCGAGTGACTATCAGCAAATGATCGGGTTGAACAAT
GTGATATGTGAACTGATCGAGGACGAGGGCGAGAATCGATACAAGATCAC
CGACATTATAGGTAAAGAAGATGGAATCGGTGTTGAAAATTTAAGAGCCT
CAGGCATGATTGCAGGCGAAACATCTTTGGCATATGATGAAATAGTTACG
ATCAGCTTGGTGTCCAGTCGAGCTGTCGGTATAGGCGCCTATTTGGTAAG
ATTAGGTTCTCGGGTTATTCAGGTGGAAAATTCTCATATCATCTTAACCG
GGGCTGCGGCTTTAAACAAAGTACTTGGTAGCGACGTCTATACGAGCAAT
GATCAACTGGGCGGTGTACAAATTATGGCTAATAATGGAGTTTCACATGC
CGTGGTTGCCGATGAATTAAAAGGAATAGAATGTCTGTTGAAATGGTTAT
CGTACATTCCTTCTGTTAAAAATGGACCTTTGCCGGTTTTTTTAAATAAT
CCCGCACTTCCAGATCCGATTAACCGTCCTGTCACATATATGCCACCAAA
GAATATGTCAAATTCCGACCCGCGCCACCTCATCACGGGTGTGACAGATG
TTAATGGCGAATATTTATCTGGATTATTCGATAAAGATAGTTGGCAGGAA
ATTCTAGATCAATGGGCAAGATCAGTAGTAACTGGTCGAGCTAGATTAGG
AGGCATCCCCATCGCTGTAATTACCGCTGAAACTAGGAATGTTATATTTT
CCATTCCGGCAGATCCAGCAAATCCTCACACAGAGTTTCAGGAAGTTCAA
CACGCTGGACAAGTTTGGTTTCCTTGTTCAGCTTATAAAACTGCTCAAGC
AATGCGTGACTTTAATAGAGAAGGTTTGCCGTTGTTTATATTTGCTAATT
GGCGAGGCTTTTCTGGTGGAATGATGGATATGTATGATCAGATATTGAAA
TTCGGATCCTATATTGTTGATGAACTCAAAAGGTATACACAACCGGTCTT
TGTCTACATACCTCCTCACGGTGAGCTGCGTGGCGGAGCTTGGGTGGTGT
TAGATCCAACAATCAATGAGGATTACATGGAGATGTTTGCTGATCCTCAG
TATTCGGAAGGAGGGATATTGGAGCCTGAAGGTATTGTTGAAATAAAATA
TCGTGAGAAGGACCTAATTAAAACCATTAAAAGGCTTGATCCGATCTGCC
TGTCTATTCAAAGCGAACTTCTGTCACTGGACAGCCAAAACACGCAGATG
CAGAAATCTTTGCTAAGCGATTTGAATGCTCGCATCAAAAAGCTCTTACC
TCTGTATCATCAAATAGCAATCGCGTTTGCCACGCTTCACGACACGCCAG
GCCGCATGTTTGCAAAAGGAGTTCTCAGCTCACTGATTCCATGGGCTGAT
AGTAGGAGACAGTTCTATATGAAATTAAGACGCAGACTGCTCGAATGGGA
TGCGATTTCATTGGTTGACAAAATTGGCGGGTTTCCCACGAAAATAGATG
AGGATATCTCGAATGGTGGGGAATTCAATCACATTGACGGTGTCAAGAAA
GAGTTTGGATCTTTCAACAATAGGCCGCCTACTCCAAAAGGATTTATTAG
TTCAGGTGCAATAAGTAAACGAGTTCATTTTTTGAATTTATTGCAGCGCT
GGTTCGTTGAAGATCAGGGCGCCGACAAGAGCTATTTGTGGCAGGACGAT
TCAGTCGTTGCCAACTGGTTGGAAACACAAATCGATTTGTGCAAAAATAA
ATCACATGGATTTATTTACGACATTCTTCAGTGTTTCCGCCGAGATAACA
CACTATCGATTATAAAGAAACTTGTTCGAACTAATCCAGATATGACAATG
AATTTTATTCTTTCAATCATCCAAGAACTGAATCAGAATCAAATATCGGA
TCTAACAAATATTTTGTCTACCATGACAGCAGCAGCCGGTCTCAGCAAAC
ATCCGGAACAAAACAACCTCTAGCATTTGCAATGTAGCGACATATCACAA
CTTGATATATATATATATAAATGTAATT
back to top

protein sequence of SMED30017347-orf-1

>SMED30017347-orf-1 ID=SMED30017347-orf-1|Name=SMED30017347-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2451bp
MFLNYKMHNSQSMPNKIKDDLDINSISKEKSETKIVRQESLRAINMPRPV
VASINEFVINQGGNRPIKKILIANNGIAAVKCIRSIRSWAYETFKDQHAI
RFVCMVTPEDTNANAEYIKMSDKIETVPGGSNQYNYANVDLILDVALRTK
VDAVWAGWGHASENPKLPEILYKHNIIFIGPPHEAMWCLGDKVASTIIAQ
STNIPTLPWSGNGLTIPIQPSSPVKYVLESPNRQRHSLEMDGYPTSYNLR
KIAPDIPQDLYYQACVSDPNEALERATQIGFPIMIKASEGGGGKGIRKAS
SSENFQSLFIQVQNEVPGSPIFLMKFAEHARHLEVQILADQYGQAISLFG
RDCSVQRRHQKILEEAPVIVAPEEVFEQMEKAAITLAQIVGYVSAGTVEY
LYDIKTQKFFFLELNPRLQVEHPCTEVVTDINLPASQLQIAMGIPLHRIK
EIRELYKEDPTLFNKINFNNPTQKPRPNGHVIAVRITSENPDEGFKPSPG
IMEELNFKSNRSVWGYFSVSSVGGIHEFSDSQFGHCFSFAETREKARENM
VLTLKEMSIRGDFRTTVEYLIKILESESFIMNDIDTGWLDYMISQKVQTD
SIDPTLAAMCAAIHIGNDKLMRSFSTYQILIERRQISKSQKLTNIVDVVL
IHDYLKYQIQICKTGPIAYHLIMNNASVESEVHKLLDGCLLITYGNTSYT
TYLKEEIYGYRVIIDNNTITFEKETDPSVLVSPSTGKLVQYTVEDGSHVF
SNSVYALMEVMKLTMELHTTASGCIHYIKRPGAILDAGCHVATLTLDDAV
SIKRAETFTGSFYTSNQTASVAKLNQVFDKCVKELEQILDGYCLPEPYFT
PKLQKTVYQFMACLRDPRLPLIELQELMSQISGRIPTNVERAIKQQMSIY
ASNVTSVLSQFPGSKILHILTNCGNSLSKQSEQDNYMMITQPIFSLVGKY
TKGVRGHMKMAIENLFFKYYNVEKLFQEGHHDKCVSILLEQKDKNQNIMN
IIFSHQNVAYKNKLILLLIDHLVENESGLIKDLNDALVNFTNLNKSENSK
VSLRSRQVLIAAQNPAYEVRHNQVESIFLSAIDRYGHQFRPENLERLILS
ETVVFDIVCDFFYHCNPMVISAALEVYVRRAYIAYELTCVHQCQLKNGAF
IVEFRFLLPSTHPDRNVQTIYRPASIDNMDRITDYYYEISEFPSITNRKF
STGFPFAMKSLIHTPSTDSLDSCYDVPDSPNDNVVLKPKRCRATNKSPSL
DNDNFSLLNGSMEFETCGYRNNMADDLSKLDMHSPPCQRMGAMAAFKTMD
EFEEVFDEIMDHFSSIQEENDQNTVVTFQDPPYCSTNIKEEPIHIFNVAF
REDVVVEDDDNEKILSDFCLRKKKVFIERGIRRVTFLMTSAGTFPRYFTF
RAKNDFKEDRIYRHLEPALAFQLEINRMRNYDLEQIPVVNRRMHLYLAKA
KVSEGQEVTDYRFFVRSIIRHADLVTKEASFEYVTNEAERTLLESLDALE
LALTHPDAQRTNCNHIFLNFAPTLTLPDLTRLEETVRRMVMRYGSRLWKL
RVAQAELKMMVRISDQGQRIPMRMWLANEGGYDLEISMYKEVLDQTTGQI
QFRSFGNGKKGKLHGMLLEAPYQTKDHLQLKRFQAINYNTTYVYDYPKLI
NQALEGIWSEYNPELLLENPDMELLTYIELILDDNNDIVEVQQMPGVNNI
GMVAWRMKLITPEYPETGREIILISNDVTYKMGSFSIMEDILFLKASELA
RKLGIPRIFFASNCGARIGLAEEFKNIFNIAWLDKFDPEKGFKYLYLTPS
DYQQMIGLNNVICELIEDEGENRYKITDIIGKEDGIGVENLRASGMIAGE
TSLAYDEIVTISLVSSRAVGIGAYLVRLGSRVIQVENSHIILTGAAALNK
VLGSDVYTSNDQLGGVQIMANNGVSHAVVADELKGIECLLKWLSYIPSVK
NGPLPVFLNNPALPDPINRPVTYMPPKNMSNSDPRHLITGVTDVNGEYLS
GLFDKDSWQEILDQWARSVVTGRARLGGIPIAVITAETRNVIFSIPADPA
NPHTEFQEVQHAGQVWFPCSAYKTAQAMRDFNREGLPLFIFANWRGFSGG
MMDMYDQILKFGSYIVDELKRYTQPVFVYIPPHGELRGGAWVVLDPTINE
DYMEMFADPQYSEGGILEPEGIVEIKYREKDLIKTIKRLDPICLSIQSEL
LSLDSQNTQMQKSLLSDLNARIKKLLPLYHQIAIAFATLHDTPGRMFAKG
VLSSLIPWADSRRQFYMKLRRRLLEWDAISLVDKIGGFPTKIDEDISNGG
EFNHIDGVKKEFGSFNNRPPTPKGFISSGAISKRVHFLNLLQRWFVEDQG
ADKSYLWQDDSVVANWLETQIDLCKNKSHGFIYDILQCFRRDNTLSIIKK
LVRTNPDMTMNFILSIIQELNQNQISDLTNILSTMTAAAGLSKHPEQNNL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006084acetyl-CoA metabolic process
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0008152metabolic process
GO:0051289protein homotetramerization
GO:2001295malonyl-CoA biosynthetic process
GO:0006633fatty acid biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR034733AcCoA_carboxyl
IPR005482Biotin_COase_C
IPR013815ATP_grasp_subdomain_1
IPR029045ClpP/crotonase-like_dom_sf
IPR005479CbamoylP_synth_lsu-like_ATP-bd
IPR000089Biotin_lipoyl
IPR005481BC-like_N
IPR013537AcCoA_COase_cen
IPR000022Carboxyl_trans
IPR013816ATP_grasp_subdomain_2
IPR016185PreATP-grasp_dom_sf
IPR011761ATP-grasp
IPR011763COA_CT_C
IPR011764Biotin_carboxylation_dom
IPR011762COA_CT_N
IPR011054Rudment_hybrid_motif
IPR011053Single_hybrid_motif
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003824catalytic activity
GO:0003989acetyl-CoA carboxylase activity
GO:0046872metal ion binding
GO:0016874ligase activity
GO:0004075biotin carboxylase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034733Acetyl-CoA carboxylasePFAMPF01039Carboxyl_transcoord: 509..1066
e-value: 2.8E-147
score: 491.3
IPR013537Acetyl-CoA carboxylase, central domainPFAMPF08326ACC_centralcoord: 66..407
e-value: 4.7E-119
score: 398.7
NoneNo IPR availableGENE3DG3DSA:3.90.226.10coord: 414..740
e-value: 2.9E-141
score: 472.0
NoneNo IPR availableGENE3DG3DSA:2.40.460.10coord: 562..627
e-value: 2.9E-141
score: 472.0
NoneNo IPR availablePANTHERPTHR45728:SF1ACETYL-COA CARBOXYLASE 2coord: 1126..1230
NoneNo IPR availablePANTHERPTHR45728:SF1ACETYL-COA CARBOXYLASE 2coord: 75..1068
NoneNo IPR availablePANTHERPTHR45728FAMILY NOT NAMEDcoord: 1126..1230
coord: 75..1068
IPR011763Acetyl-coenzyme A carboxyltransferase, C-terminalPROSITEPS50989COA_CT_CTERcoord: 759..1077
score: 44.851
IPR011762Acetyl-coenzyme A carboxyltransferase, N-terminalPROSITEPS50980COA_CT_NTERcoord: 414..751
score: 46.001
IPR029045ClpP/crotonase-like domain superfamilySUPERFAMILYSSF52096ClpP/crotonasecoord: 755..1071
IPR029045ClpP/crotonase-like domain superfamilySUPERFAMILYSSF52096ClpP/crotonasecoord: 416..740