Dynactin 1b

Overview
NameDynactin 1b
Smed IDSMED30017339
Length (bp)3825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynactin 1b (SMED30017339) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynactin 1b (SMED30017339) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynactin 1b (SMED30017339) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynactin 1b (SMED30017339) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017339

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30017339SMESG000029463.1 dd_Smed_v4_4065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017339SMESG000029463.1 dd_Smed_v4_4065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017339SMESG000029463.1 dd_Smed_v4_4065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017339SMESG000022880.1 SMESG000029463.1 Contig40809newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017339SMESG000022880.1 SMESG000029463.1 Contig40809uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30017339SMESG000073271.1 SMESG000029463.1 OX_Smed_1.0.07524ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynactin 1b vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 485.337 bits (1248), Expect = 2.888e-149
Identity = 338/1002 (33.73%), Postives = 544/1002 (54.29%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL-------------------AKVDGDESTNTSAE-SKVRPSA----LRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQD---------------LPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-----EIRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+                   +KV   E T+T+A+ SK+ P+A     R+P   +  S       ++L  +      E+                 +P  +          P   KE      QV+DL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++       A  +      + N   L   +E+       +I    S+ P      +  IL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+A L +KEKE ++T +ALQ+DI+ LE
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEV---AAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLE 1020          
BLAST of Dynactin 1b vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 483.797 bits (1244), Expect = 8.640e-149
Identity = 378/1215 (31.11%), Postives = 621/1215 (51.11%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL-------------------AKVDGDESTNTSAESKVRPSALRKPMSI----KSRSXXXXXXXXXXTENAVTPKEEVQD------LPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-----EIRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISA-----------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP-ISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+                   +KV   E T+T+A++   P+   +P S      S S     + +    ++  P    Q       +P  +          P   KE      QV+DL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++       A  +      + N   L   +E+       +I    S+ P      +  IL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+A L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V   +   I                    L +I  +R  I  L+++N  L+          L PL +  +S   P +   +  + +     L     E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLPT---RPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEV---AAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLL-----ETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1225          
BLAST of Dynactin 1b vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 483.026 bits (1242), Expect = 1.229e-148
Identity = 378/1215 (31.11%), Postives = 621/1215 (51.11%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL-------------------AKVDGDESTNTSAESKVRPSALRKPMSI----KSRSXXXXXXXXXXTENAVTPKEEVQD------LPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-----EIRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISA-----------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP-ISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+                   +KV   E T+T+A++   P+   +P S      S S     + +    ++  P    Q       +P  +          P   KE      QV+DL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++       A  +      + N   L   +E+       +I    S+ P      +  IL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+A L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V   +   I                    L +I  +R  I  L+++N  L+          L PL +  +S   P +   +  + +     L     E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLPT---RPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEV---AAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLL-----ETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1208          
BLAST of Dynactin 1b vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 481.485 bits (1238), Expect = 5.908e-148
Identity = 381/1232 (30.93%), Postives = 625/1232 (50.73%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL-------------------AKVDGDESTNTSAE-SKVR-------PSA----LRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQD---------------LPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-----EIRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISA-----------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP-ISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+                   +KV   E T+T+A+ SK+R       P+A     R+P   +  S       ++L  +      E+                 +P  +          P   KE      QV+DL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++       A  +      + N   L   +E+       +I    S+ P      +  IL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+A L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V   +   I                    L +I  +R  I  L+++N  L+          L PL +  +S   P +   +  + +     L     E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEV---AAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLL-----ETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1228          
BLAST of Dynactin 1b vs. Ensembl Human
Match: DCTN1 (dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:2711])

HSP 1 Score: 481.485 bits (1238), Expect = 5.908e-148
Identity = 381/1232 (30.93%), Postives = 625/1232 (50.73%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL-------------------AKVDGDESTNTSAE-SKVR-------PSA----LRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQD---------------LPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-----EIRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISA-----------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP-ISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+                   +KV   E T+T+A+ SK+R       P+A     R+P   +  S       ++L  +      E+                 +P  +          P   KE      QV+DL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++       A  +      + N   L   +E+       +I    S+ P      +  IL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+A L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V   +   I                    L +I  +R  I  L+++N  L+          L PL +  +S   P +   +  + +     L     E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEV---AAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLL-----ETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1228          
BLAST of Dynactin 1b vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 238.039 bits (606), Expect = 1.471e-63
Identity = 224/846 (26.48%), Postives = 419/846 (49.53%), Query Frame = 2
Query:  470 EFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTL----ADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAK-NINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC--SKYAIEFMVKHNMEASESYEFL------------VRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYC----LELATVS-----DEDDAKSVNMSSLYK---YI---EKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            E++ N  QVK+LTEKL+  ++KR ED  K+ E +++  +++  EE +  + +K  E    L+K   D     E+   +++E   L     D +EM TI+KE+AEE+ +S ++++  L  K E +  E EILK E + G        V +  Q   ++ QN KL+DA+I +RDLN    ++ +K V E  +L++E  + ++  + L    + A+  I   +EQ+D+A+GA+ MV+ LT+KN  +EE +  LEE   ++EE  D++ ++ E     + DL  EI    + I ELN  +  + +  +D   TI KFR+ + +L +Q++D K Q  +  E       +  +++S + + +I   +  A  +E ++  ++V  +      L+ FLPD F + G +NDSI++++++ +L  K +   +   + F   P       V K +  +  A+  ++ YL ++    L   +  +    +    +L   + EMS +EK+VD  ++LL+K   DEN+SL+   R + YFQ  + +H+     D     +   +I    S  + YC  +   I + ++ ++ A E Y  L            V L+ + L L  N     + +LK       S  + +L   V  L  +  I+   C    L    +S     DE   K +  + L K   YI   + F  IR L  +L      +++ K+++    ++E  + ++     K+  P++  A + K    + E   +++E KD E+ + +  +K + +++S   +RL++ E +L+   K + + ++ LE+K+ Q  A   RK+ E D++ +ALQ ++  +E
Sbjct:  292 EYLRN--QVKELTEKLEAARVKRKEDHTKVMELDRVSFELRSSEEVRSRLIQKITE----LEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQ---VGNSVQMKQIEIQNDKLKDALIKLRDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVARVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFSLHIGG---DGFNAAHWVSEICASLSAGLAYCRVNTQRISYFLQESITAGEVYNMLQTLNDEFAACESVILKAYRL-LPGNVSGSEQKILK-----LESEFTEDLLNSVVQLDKMVSILQEVCANGALSFGGISETEGFDEKRVKEMINAVLGKQDGYIAIDKTFDPIRALIKSL-----RDSLEKVNS----TLESAKMEHSAPEKKSFPPLLDRAHHRKQAAQEAEGLRWQMEKKDNEMLELRKQMKARIEDVSNYKLRLDMAESRLNSTDKAEGDKVKHLEEKINQMVADHRRKQIEYDESMDALQREMKEVE 1110          

HSP 2 Score: 72.7886 bits (177), Expect = 1.724e-12
Identity = 35/85 (41.18%), Postives = 50/85 (58.82%), Query Frame = 2
Query:   86 GTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRS 340
            G V F G T FA G W GV LD+  GKN+G+V    YF+C+ N G+FV+++ +   D  + +   A +    SA+RK  S+ SRS
Sbjct:   16 GRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAVELEDASKRSGLKAPAA---SAIRKDSSVMSRS 97          
BLAST of Dynactin 1b vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 237.654 bits (605), Expect = 2.024e-63
Identity = 224/846 (26.48%), Postives = 419/846 (49.53%), Query Frame = 2
Query:  470 EFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTL----ADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAK-NINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC--SKYAIEFMVKHNMEASESYEFL------------VRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYC----LELATVS-----DEDDAKSVNMSSLYK---YI---EKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            E++ N  QVK+LTEKL+  ++KR ED  K+ E +++  +++  EE +  + +K  E    L+K   D     E+   +++E   L     D +EM TI+KE+AEE+ +S ++++  L  K E +  E EILK E + G        V +  Q   ++ QN KL+DA+I +RDLN    ++ +K V E  +L++E  + ++  + L    + A+  I   +EQ+D+A+GA+ MV+ LT+KN  +EE +  LEE   ++EE  D++ ++ E     + DL  EI    + I ELN  +  + +  +D   TI KFR+ + +L +Q++D K Q  +  E       +  +++S + + +I   +  A  +E ++  ++V  +      L+ FLPD F + G +NDSI++++++ +L  K +   +   + F   P       V K +  +  A+  ++ YL ++    L   +  +    +    +L   + EMS +EK+VD  ++LL+K   DEN+SL+   R + YFQ  + +H+     D     +   +I    S  + YC  +   I + ++ ++ A E Y  L            V L+ + L L  N     + +LK       S  + +L   V  L  +  I+   C    L    +S     DE   K +  + L K   YI   + F  IR L  +L      +++ K+++    ++E  + ++     K+  P++  A + K    + E   +++E KD E+ + +  +K + +++S   +RL++ E +L+   K + + ++ LE+K+ Q  A   RK+ E D++ +ALQ ++  +E
Sbjct:  320 EYLRN--QVKELTEKLEAARVKRKEDHTKVMELDRVSFELRSSEEVRSRLIQKITE----LEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAAQ---VGNSVQMKQIEIQNDKLKDALIKLRDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVARVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFSLHIGG---DGFNAAHWVSEICASLSAGLAYCRVNTQRISYFLQESITAGEVYNMLQTLNDEFAACESVILKAYRL-LPGNVSGSEQKILK-----LESEFTEDLLNSVVQLDKMVSILQEVCANGALSFGGISETEGFDEKRVKEMINAVLGKQDGYIAIDKTFDPIRALIKSL-----RDSLEKVNS----TLESAKMEHSAPEKKSFPPLLDRAHHRKQAAQEAEGLRWQMEKKDNEMLELRKQMKARIEDVSNYKLRLDMAESRLNSTDKAEGDKVKHLEEKINQMVADHRRKQIEYDESMDALQREMKEVE 1138          

HSP 2 Score: 72.7886 bits (177), Expect = 1.706e-12
Identity = 35/85 (41.18%), Postives = 50/85 (58.82%), Query Frame = 2
Query:   86 GTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRS 340
            G V F G T FA G W GV LD+  GKN+G+V    YF+C+ N G+FV+++ +   D  + +   A +    SA+RK  S+ SRS
Sbjct:   16 GRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAVELEDASKRSGLKAPAA---SAIRKDSSVMSRS 97          
BLAST of Dynactin 1b vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 237.269 bits (604), Expect = 2.505e-63
Identity = 224/846 (26.48%), Postives = 419/846 (49.53%), Query Frame = 2
Query:  470 EFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTL----ADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAK-NINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC--SKYAIEFMVKHNMEASESYEFL------------VRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYC----LELATVS-----DEDDAKSVNMSSLYK---YI---EKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            E++ N  QVK+LTEKL+  ++KR ED  K+ E +++  +++  EE +  + +K  E    L+K   D     E+   +++E   L     D +EM TI+KE+AEE+ +S ++++  L  K E +  E EILK E + G        V +  Q   ++ QN KL+DA+I +RDLN    ++ +K V E  +L++E  + ++  + L    + A+  I   +EQ+D+A+GA+ MV+ LT+KN  +EE +  LEE   ++EE  D++ ++ E     + DL  EI    + I ELN  +  + +  +D   TI KFR+ + +L +Q++D K Q  +  E       +  +++S + + +I   +  A  +E ++  ++V  +      L+ FLPD F + G +NDSI++++++ +L  K +   +   + F   P       V K +  +  A+  ++ YL ++    L   +  +    +    +L   + EMS +EK+VD  ++LL+K   DEN+SL+   R + YFQ  + +H+     D     +   +I    S  + YC  +   I + ++ ++ A E Y  L            V L+ + L L  N     + +LK       S  + +L   V  L  +  I+   C    L    +S     DE   K +  + L K   YI   + F  IR L  +L      +++ K+++    ++E  + ++     K+  P++  A + K    + E   +++E KD E+ + +  +K + +++S   +RL++ E +L+   K + + ++ LE+K+ Q  A   RK+ E D++ +ALQ ++  +E
Sbjct:  295 EYLRN--QVKELTEKLEAARVKRKEDHTKVMELDRVSFELRSSEEVRSRLIQKITE----LEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAA---QVGNSVQMKQIEIQNDKLKDALIKLRDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVARVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFSLHIGG---DGFNAAHWVSEICASLSAGLAYCRVNTQRISYFLQESITAGEVYNMLQTLNDEFAACESVILKAYRL-LPGNVSGSEQKILK-----LESEFTEDLLNSVVQLDKMVSILQEVCANGALSFGGISETEGFDEKRVKEMINAVLGKQDGYIAIDKTFDPIRALIKSL-----RDSLEKVNS----TLESAKMEHSAPEKKSFPPLLDRAHHRKQAAQEAEGLRWQMEKKDNEMLELRKQMKARIEDVSNYKLRLDMAESRLNSTDKAEGDKVKHLEEKINQMVADHRRKQIEYDESMDALQREMKEVE 1113          

HSP 2 Score: 72.7886 bits (177), Expect = 1.640e-12
Identity = 35/85 (41.18%), Postives = 50/85 (58.82%), Query Frame = 2
Query:   86 GTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRS 340
            G V F G T FA G W GV LD+  GKN+G+V    YF+C+ N G+FV+++ +   D  + +   A +    SA+RK  S+ SRS
Sbjct:   16 GRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAVELEDASKRSGLKAPAA---SAIRKDSSVMSRS 97          
BLAST of Dynactin 1b vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 237.269 bits (604), Expect = 2.901e-63
Identity = 224/846 (26.48%), Postives = 419/846 (49.53%), Query Frame = 2
Query:  470 EFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTL----ADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAK-NINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC--SKYAIEFMVKHNMEASESYEFL------------VRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYC----LELATVS-----DEDDAKSVNMSSLYK---YI---EKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            E++ N  QVK+LTEKL+  ++KR ED  K+ E +++  +++  EE +  + +K  E    L+K   D     E+   +++E   L     D +EM TI+KE+AEE+ +S ++++  L  K E +  E EILK E + G        V +  Q   ++ QN KL+DA+I +RDLN    ++ +K V E  +L++E  + ++  + L    + A+  I   +EQ+D+A+GA+ MV+ LT+KN  +EE +  LEE   ++EE  D++ ++ E     + DL  EI    + I ELN  +  + +  +D   TI KFR+ + +L +Q++D K Q  +  E       +  +++S + + +I   +  A  +E ++  ++V  +      L+ FLPD F + G +NDSI++++++ +L  K +   +   + F   P       V K +  +  A+  ++ YL ++    L   +  +    +    +L   + EMS +EK+VD  ++LL+K   DEN+SL+   R + YFQ  + +H+     D     +   +I    S  + YC  +   I + ++ ++ A E Y  L            V L+ + L L  N     + +LK       S  + +L   V  L  +  I+   C    L    +S     DE   K +  + L K   YI   + F  IR L  +L      +++ K+++    ++E  + ++     K+  P++  A + K    + E   +++E KD E+ + +  +K + +++S   +RL++ E +L+   K + + ++ LE+K+ Q  A   RK+ E D++ +ALQ ++  +E
Sbjct:  267 EYLRN--QVKELTEKLEAARVKRKEDHTKVMELDRVSFELRSSEEVRSRLIQKITE----LEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAA---QVGNSVQMKQIEIQNDKLKDALIKLRDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVARVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFSLHIGG---DGFNAAHWVSEICASLSAGLAYCRVNTQRISYFLQESITAGEVYNMLQTLNDEFAACESVILKAYRL-LPGNVSGSEQKILK-----LESEFTEDLLNSVVQLDKMVSILQEVCANGALSFGGISETEGFDEKRVKEMINAVLGKQDGYIAIDKTFDPIRALIKSL-----RDSLEKVNS----TLESAKMEHSAPEKKSFPPLLDRAHHRKQAAQEAEGLRWQMEKKDNEMLELRKQMKARIEDVSNYKLRLDMAESRLNSTDKAEGDKVKHLEEKINQMVADHRRKQIEYDESMDALQREMKEVE 1085          

HSP 2 Score: 72.7886 bits (177), Expect = 1.686e-12
Identity = 35/85 (41.18%), Postives = 50/85 (58.82%), Query Frame = 2
Query:   86 GTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRS 340
            G V F G T FA G W GV LD+  GKN+G+V    YF+C+ N G+FV+++ +   D  + +   A +    SA+RK  S+ SRS
Sbjct:   16 GRVVFCGQTQFAEGDWVGVILDTATGKNNGTVQNVQYFECEPNFGVFVKSSAVELEDASKRSGLKAPAA---SAIRKDSSVMSRS 97          
BLAST of Dynactin 1b vs. Ensembl Celegans
Match: dnc-1 (DyNactin Complex component [Source:UniProtKB/TrEMBL;Acc:E2JKZ0])

HSP 1 Score: 235.343 bits (599), Expect = 4.762e-63
Identity = 225/847 (26.56%), Postives = 420/847 (49.59%), Query Frame = 2
Query:  470 EFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTL----ADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAK-NINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC--SKYAIEFMVKHNMEASESYEFL------------VRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYC----LELATVS-----DEDDAKSVNMSSLYK---YI---EKFMEIRNLSSTLPIFTNTETILKISANI-SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            E++ N  QVK+LTEKL+  ++KR ED  K+ E +++  +++  EE +  + +K  E    L+K   D     E+   +++E   L     D +EM TI+KE+AEE+ +S ++++  L  K E +  E EILK E + G        V +  Q   ++ QN KL+DA+I +RDLN    ++ +K V E  +L++E  + ++  + L    + A+  I   +EQ+D+A+GA+ MV+ LT+KN  +EE +  LEE   ++EE  D++ ++ E     + DL  EI    + I ELN  +  + +  +D   TI KFR+ + +L +Q++D K Q  +  E       +  +++S + + +I   +  A  +E ++  ++V  +      L+ FLPD F + G +NDSI++++++ +L  K +   +   + F   P       V K +  +  A+  ++ YL ++    L   +  +    +    +L   + EMS +EK+VD  ++LL+K   DEN+SL+   R + YFQ  + +H+  +  +    +++    +  G   + YC  +   I + ++ ++ A E Y  L            V L+ + L L  N     + +LK       S  + +L   V  L  +  I+   C    L    +S     DE   K +  + L K   YI   + F  IR L  +L      +++ K+++ + S  MEH          K+  P++  A + K    + E   +++E KD E+ + +  +K + +++S   +RL++ E +L+   K + + ++ LE+K+ Q  A   RK+ E D++ +ALQ ++  +E
Sbjct:   57 EYLRN--QVKELTEKLEAARVKRKEDHTKVMELDRVSFELRSSEEVRSRLIQKITE----LEKQIGDERIAKEQLQAWQDENKVLLSDHQDTMEMATIEKELAEERADSLQNDVLTLTEKLESMETELEILKEEMANGGGAA---QVGNSVQMKQIEIQNDKLKDALIKLRDLNAQATLDRQKAVDEAERLKTENSELIRVAENLKRQTEIAESKIAGFQEQIDAAMGAEAMVTQLTDKNFNMEERIMQLEETIEDMEEARDLDEQLAEVQKQQVKDLMKEIEQLKIHIHELNGRIRDEQKHAVDLSQTILKFRERMANLNSQIQDQKDQVLSLEEQLHGHISVDNDRASMVNQLQISANRNFAEDVERQVNAIEVEFARRQAGYLKAFLPDNFSRVGGENDSILLVVMLPRLAAKTKLFASLAAQCFPQVPGGMRREHVTKSHKGEQWAHVARVNYLANSINAALGKLESAIGETTVEVLIKLTETYGEMSTHEKTVDQYLELLKKSRFDENTSLDSFVRPLVYFQNMFSLHIGGDGFNAAHWVSEICASLSAG---LAYCRVNTQRISYFLQESITAGEVYNMLQTLNDEFAACESVILKAYRL-LPGNVSGSEQKILK-----LESEFTEDLLNSVVQLDKMVSILQEVCANGALSFGGISETEGFDEKRVKEMINAVLGKQDGYIAIDKTFDPIRALIKSL-----RDSLEKVNSTLESAKMEHS-----APEKKSFPPLLDRAHHRKQAAQEAEGLRWQMEKKDNEMLELRKQMKARIEDVSNYKLRLDMAESRLNSTDKAEGDKVKHLEEKINQMVADHRRKQIEYDESMDALQREMKEVE 875          
BLAST of Dynactin 1b vs. Ensembl Fly
Match: DCTN1-p150 (gene:FBgn0001108 transcript:FBtr0075756)

HSP 1 Score: 271.166 bits (692), Expect = 4.253e-74
Identity = 283/975 (29.03%), Postives = 494/975 (50.67%), Query Frame = 2
Query:  491 QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEIL---------KLEKSGGNDFLMQDSVN-DEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPT--ESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKM-NDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIR-------------KHLLKSPSLQFN----SGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYI-----EKFMEIRNLSSTLPIFTNTETILKISAN-----ISDSMEHGEYDY---------EGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE---------MXXXXXXXXXXXXXXXNFFDNINIS-----TSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSL---IKKMEYA 3217
            Q+ DLTEKL+TL+ +R+EDKE+L+E++K+K++ +QL+E +  I    A  Q+ L + KQ+    IE  + + +E   LADN+EM+T+DKEMAEEK ++ + E   L+S  E I      L         K E + GN     DS      +   L+ QN +L++ ++ +RDL+ + K + +K  KE+   +SE+ +  + +++L   +   +  + +L+EQVD+ALGA+EMV  L EK + LE+ VK LEE   +LE L +++ ++ E+N  L  DL+ E+   + A +E+ +   A  E I D + TI KFR+LV+ L +Q+ +L+ +  +N + S     + +   +  YK    E+K     I+ +L+++++SQ++ HVQML  F+P+ F   G D+DSI++ILLI +++FK + + +Q +ERF   P++    E+    +     A+  +L++ + +    L      L+SCQ  T  R GS   EM   EK VD +I+LL+   LDENS+ + +E+ + +F     V L  E     I+M  D V  +    ++I   S  AI  ++     A+     L+   QF   L  N  ++R             +H++KS   Q       GL+ N+ + ++ +   TK   S    ++T+  ++ A+       Y  +     E+  E  +   T     N +T+L   AN     I+  +   EYD          +  S     PI   A   K +L         LE+++ +++Q K+  K+K +ELSE  +R ++ EKKLS+   E +  +++ +QK E+T   L  KEKE ++T + LQSDI+ LE         ++      +++   + +   NI++S        I++   S  +        E++ L+   +  RN  +RL++Q       + +PL +P     P   R ++L   + +M++A
Sbjct:  235 QLADLTEKLETLKQRRNEDKERLREFDKMKIQFEQLQEFRTKIMGAQASLQKELLRAKQEAKDAIEAKEQHAQEMADLADNVEMITLDKEMAEEKADTLQLE---LESSKERIEELEVDLELLRSEMQNKAESAIGNISGGGDSPGLSTYEFKQLEQQNIRLKETLVRLRDLSAHDKHDIQKLSKELEMKRSEVTELERTKEKLSAKIDELEAIVADLQEQVDAALGAEEMVEQLAEKKMELEDKVKLLEEEIAQLEALEEVHEQLVESNHELELDLREELDLANGAKKEVLRERDAAIETIYDRDQTIVKFRELVQKLNDQLTELRDRNSSNEKESLQDPSLKMVTETIDYKQMFAESKAYTRAIDVQLRQIELSQANEHVQMLTAFMPESFMSRGGDHDSILVILLISRIVFKCDIVVSQTRERF--PPVDAITREAVTQGHAVQQYAFKCRLLHYVHSLQCALHQILYGLNSCQPDTLLRAGSSLPEMVAQEKIVDGIIELLKSNQLDENSTTDNIEKCVAFFNAMNSVLLAGEQLLNEIQMIRDCVASLGAACESI--LSDTAIAKVIIQEAGATSDSVLLI---QF---LNENMESVRQQVKLIKRRLPSDQHVIKSGLSQHKVEAMRGLAQNISRIMSAMHQATK--QSLAAIVSTIESDNAAEHTLPQEKYWALLTASCERIYEQDDRGPT----QNFKTLL-AQANSDLQLIAQHLLDKEYDIISAANNASNQQKSGAHSTPITQRAQLIKKQLEQKNVLAATLENREADVKQLKVAAKMKQNELSEMQIRKDLAEKKLSVLQNEYEHAVDKWKQKYEETSLQLQLKEKEFEETMDHLQSDIDALESEKSDLRDKLKLNSTTGKVQPGSESHSPHNISLSGNTSTAPGISNVSYSAPAGTAPVVAEEVELLKNAFNQERNQRLRLQAQDMRAKLSQFEPLHVP----QPQDQRITALESELTRMKHA 1185          

HSP 2 Score: 89.3521 bits (220), Expect = 1.987e-17
Identity = 42/92 (45.65%), Postives = 55/92 (59.78%), Query Frame = 2
Query:   41 DFKINDIVLYNGT-LKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAE--SKVRPSA 307
            + K+   V   G  L GTV ++G T FA G W GV LD PKGKN GS+ G+ YF+CD+N G+FVR TQL  ++    +  S E  S   P+A
Sbjct:    5 NLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCGMFVRPTQLRLLEAAPGSRRSIEDVSGATPTA 96          
BLAST of Dynactin 1b vs. Ensembl Fly
Match: CG9279 (gene:FBgn0036882 transcript:FBtr0074976)

HSP 1 Score: 183.341 bits (464), Expect = 2.276e-46
Identity = 161/577 (27.90%), Postives = 306/577 (53.03%), Query Frame = 2
Query:  482 NDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDS--------VNDEA-QCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELE--KCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVK---DLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNI---NDSTAYY---HKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMND-------FVKIMLGGSDAI 2131
            ++ +++ L E+LQ L+ ++SEDK KL E E++++  +QL E K  I  +    QR L + + +  +  +     + E   +A++IE+LT+DKEMAEE++E+ + E+++ + +N+E+SL+ EILK E+       ++ S         N  A + L L+  N +LR+ ++ +RD     K   ++  KE+    SE+   K +KE     VD    Q  +++LKEQVD++LGA+ MV+ L    L LE+ VK LE+  NELE L  +  ++ E+N  L +DL+ EI      ++ L +   A  E + D + TI KFRDLV+ LQ Q++   D     ++ S  +++Q +    +S   Y+     +K     +E +++ +++     H++ +  F+P++F   G ++D ++++LL++++  K+  +   I E+F      PT     ++      S   Y    + +YLL +  ++L+ ++  L+ C     +       ++   E+ +D  + LL+ G LDE+++ EP++R ++Y    +Q  +   PP  L+++ D        +++   G DA+
Sbjct:  368 DNPELRQLREELQLLRGQKSEDKLKLLELERMRIHNEQLMEFKSQIMAQQVLLQRELQRSRHELREAQDVSSKLKRELDEIAESIELLTLDKEMAEERMETLQMELEMAQERNDELSLDVEILKAEQEEQQGQRIEKSEKQIGSGVTNQSAGEFLRLEQYNQRLRETVVRLRDTLAEEKQIGQRTHKELETKHSEINELKSIKELLSRRVDNMEMQ--LMDLKEQVDASLGAEAMVTQLASLKLELEDRVKLLEDEVNELEALEQIQEQLIESNQELETDLREEIDKLSGHVKILEQQKNAAMESLYDRDVTIMKFRDLVRQLQEQLQLRADGTLSIEDFSSANESQQEDGSNQSQTDYQHIFSVSKAYGRALEQQIKTVELRLQRQHLEHVLAFVPEQFLLRGGEHDVVLVMLLLERMNEKLTIVCQAINEKF------PTACEFGRDAIFEGYSVQRYIFRSQCLYLLKSLQLVLQQFRHGLTHCDYELCTHAAIYRSDLDAQEQQLDEFVRLLKTGQLDEHTNCEPIQRVLHYVSGLHQNLM---PPQTLVELLDEQQLYEALIEVYEAGLDAV 933          

HSP 2 Score: 87.8113 bits (216), Expect = 5.621e-17
Identity = 36/72 (50.00%), Postives = 48/72 (66.67%), Query Frame = 2
Query:   41 DFKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            + K+   V   G  L+G V ++G T+FA+G+WYGV LD P GKN+GSV G  YFKC  N G+FVR  QL ++
Sbjct:    6 ELKLGQRVEVTGKNLQGKVAYVGRTNFAAGLWYGVVLDEPLGKNNGSVHGSIYFKCPTNCGLFVRAQQLVRI 77          
BLAST of Dynactin 1b vs. Ensembl Fly
Match: CG9279 (gene:FBgn0036882 transcript:FBtr0332758)

HSP 1 Score: 183.341 bits (464), Expect = 2.276e-46
Identity = 161/577 (27.90%), Postives = 306/577 (53.03%), Query Frame = 2
Query:  482 NDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDS--------VNDEA-QCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELE--KCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVK---DLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNI---NDSTAYY---HKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMND-------FVKIMLGGSDAI 2131
            ++ +++ L E+LQ L+ ++SEDK KL E E++++  +QL E K  I  +    QR L + + +  +  +     + E   +A++IE+LT+DKEMAEE++E+ + E+++ + +N+E+SL+ EILK E+       ++ S         N  A + L L+  N +LR+ ++ +RD     K   ++  KE+    SE+   K +KE     VD    Q  +++LKEQVD++LGA+ MV+ L    L LE+ VK LE+  NELE L  +  ++ E+N  L +DL+ EI      ++ L +   A  E + D + TI KFRDLV+ LQ Q++   D     ++ S  +++Q +    +S   Y+     +K     +E +++ +++     H++ +  F+P++F   G ++D ++++LL++++  K+  +   I E+F      PT     ++      S   Y    + +YLL +  ++L+ ++  L+ C     +       ++   E+ +D  + LL+ G LDE+++ EP++R ++Y    +Q  +   PP  L+++ D        +++   G DA+
Sbjct:  368 DNPELRQLREELQLLRGQKSEDKLKLLELERMRIHNEQLMEFKSQIMAQQVLLQRELQRSRHELREAQDVSSKLKRELDEIAESIELLTLDKEMAEERMETLQMELEMAQERNDELSLDVEILKAEQEEQQGQRIEKSEKQIGSGVTNQSAGEFLRLEQYNQRLRETVVRLRDTLAEEKQIGQRTHKELETKHSEINELKSIKELLSRRVDNMEMQ--LMDLKEQVDASLGAEAMVTQLASLKLELEDRVKLLEDEVNELEALEQIQEQLIESNQELETDLREEIDKLSGHVKILEQQKNAAMESLYDRDVTIMKFRDLVRQLQEQLQLRADGTLSIEDFSSANESQQEDGSNQSQTDYQHIFSVSKAYGRALEQQIKTVELRLQRQHLEHVLAFVPEQFLLRGGEHDVVLVMLLLERMNEKLTIVCQAINEKF------PTACEFGRDAIFEGYSVQRYIFRSQCLYLLKSLQLVLQQFRHGLTHCDYELCTHAAIYRSDLDAQEQQLDEFVRLLKTGQLDEHTNCEPIQRVLHYVSGLHQNLM---PPQTLVELLDEQQLYEALIEVYEAGLDAV 933          

HSP 2 Score: 87.8113 bits (216), Expect = 5.621e-17
Identity = 36/72 (50.00%), Postives = 48/72 (66.67%), Query Frame = 2
Query:   41 DFKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            + K+   V   G  L+G V ++G T+FA+G+WYGV LD P GKN+GSV G  YFKC  N G+FVR  QL ++
Sbjct:    6 ELKLGQRVEVTGKNLQGKVAYVGRTNFAAGLWYGVVLDEPLGKNNGSVHGSIYFKCPTNCGLFVRAQQLVRI 77          
BLAST of Dynactin 1b vs. Ensembl Fly
Match: CLIP-190 (gene:FBgn0020503 transcript:FBtr0301441)

HSP 1 Score: 99.7525 bits (247), Expect = 1.182e-20
Identity = 47/107 (43.93%), Postives = 55/107 (51.40%), Query Frame = 2
Query:   44 FKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQ---------------LAKVDGDESTNTSAESKVRPSALRKP 319
            F I   V   GT  G + FIG THFA+G W GV LD P GKNDG V+GK YF+C+   GIF R T+               LAK   D S   S  + +R S LR P
Sbjct:   31 FIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSGKRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSP 137          

HSP 2 Score: 70.8626 bits (172), Expect = 7.380e-12
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query:   50 INDIVLYN---GTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFV 229
            + D V+ +   G+  G + ++G T FA G W GV+LD P GKNDG+V    YF+C   +G+FV
Sbjct:  147 VGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFV 209          
BLAST of Dynactin 1b vs. Ensembl Fly
Match: CLIP-190 (gene:FBgn0020503 transcript:FBtr0332453)

HSP 1 Score: 99.7525 bits (247), Expect = 1.234e-20
Identity = 47/107 (43.93%), Postives = 55/107 (51.40%), Query Frame = 2
Query:   44 FKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQ---------------LAKVDGDESTNTSAESKVRPSALRKP 319
            F I   V   GT  G + FIG THFA+G W GV LD P GKNDG V+GK YF+C+   GIF R T+               LAK   D S   S  + +R S LR P
Sbjct:   56 FIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSGKRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSP 162          

HSP 2 Score: 70.8626 bits (172), Expect = 7.637e-12
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query:   50 INDIVLYN---GTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFV 229
            + D V+ +   G+  G + ++G T FA G W GV+LD P GKNDG+V    YF+C   +G+FV
Sbjct:  172 VGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFV 234          
BLAST of Dynactin 1b vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 473.781 bits (1218), Expect = 1.156e-145
Identity = 356/1140 (31.23%), Postives = 598/1140 (52.46%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESK----------------------VRPSALRKPMSIKSRSXXXXXXXXXXTENA-VTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGL---DLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKII----TSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE---------MXXXXXXXXXXXXXXXNFFDNI---NISTSKIADQVD-SGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLS 3298
             K+  +V   G   +GTV +IG T FASG W GV LD  KGKNDG+V GK YF C++NHGIFVR +Q+  +D   S+ TS E+                        RPS     +S    +     +   ++  A V P+      P                 KE  S   Q+KDL EKL+TL++KRSEDK KLKE EK K++++QL+E +  +QE+  + Q+ L + K++  + +E  D Y EE    AD IEM T+DKEMAEE+ ES + E + LK K EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K  SELE    ++++L  ++K A+++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q  +++E      Q A E     +K K  ETK  A  IE EL+K++VSQ++  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+      +G+     +  ++   L+Y L+     L  Y+  LS C +  + R+G L+ EM  +E+S+D+LIDLL K  LDE   +EPL ++I Y+Q  Y VHL ++P DC +++ D +K      D    C    +  +        E  E  V L+       D++   + IR+ +  +       +L+F+  +S  L      L+ +  ++     +    +A + +++   +V +  + +K +E+    + L+    +  +   ++     ++ +M+ GEYD E    +   P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL  + K+ DE +E+++ KL++    L +KEKE ++T +ALQ+DI+ LE         +  +    +    +  +   +I   N++   ++     SG  Q + + L   +I   R  I  L+++N RL+++        L PL +P        N  S ++K+   A      ++ L  ++    + +K++D++
Sbjct:   10 VKVGSVVEVIGKGQRGTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPDSGVAKLLKKEIQETPKTAKQTGRPSVGGSALSESVLAESESSSSTQMSLAAPVVPQPSTASTPAPA-----------TPSKEEESLRAQLKDLEEKLETLRMKRSEDKAKLKEMEKYKIQLEQLQEWRSKMQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLRSQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAE---QLQQPAAELFD--FKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALD----CMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQGLNPYECLRQSCSAVIATMNKMATAMQEGEYDSERPQ-RPPPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTSTKDADERVEKIQTKLDEALNTLKKKEKEFEETMDALQADIDQLESEKAELKQRISSQSRATEGLRGQPASGIASIVTGNVAGGMLSAPAGVSGVVQVVDSPLLKQQIDVQRIAIKQLKSENYRLKAERMRAQLSSLPPLQVP--------NMKSVMMKENTAAGALQRKTDVLLHNLMKMSAGLKVVDIT 1114          
BLAST of Dynactin 1b vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 473.781 bits (1218), Expect = 1.156e-145
Identity = 356/1140 (31.23%), Postives = 598/1140 (52.46%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESK----------------------VRPSALRKPMSIKSRSXXXXXXXXXXTENA-VTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGL---DLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKII----TSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE---------MXXXXXXXXXXXXXXXNFFDNI---NISTSKIADQVD-SGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLS 3298
             K+  +V   G   +GTV +IG T FASG W GV LD  KGKNDG+V GK YF C++NHGIFVR +Q+  +D   S+ TS E+                        RPS     +S    +     +   ++  A V P+      P                 KE  S   Q+KDL EKL+TL++KRSEDK KLKE EK K++++QL+E +  +QE+  + Q+ L + K++  + +E  D Y EE    AD IEM T+DKEMAEE+ ES + E + LK K EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K  SELE    ++++L  ++K A+++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q  +++E      Q A E     +K K  ETK  A  IE EL+K++VSQ++  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+      +G+     +  ++   L+Y L+     L  Y+  LS C +  + R+G L+ EM  +E+S+D+LIDLL K  LDE   +EPL ++I Y+Q  Y VHL ++P DC +++ D +K      D    C    +  +        E  E  V L+       D++   + IR+ +  +       +L+F+  +S  L      L+ +  ++     +    +A + +++   +V +  + +K +E+    + L+    +  +   ++     ++ +M+ GEYD E    +   P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL  + K+ DE +E+++ KL++    L +KEKE ++T +ALQ+DI+ LE         +  +    +    +  +   +I   N++   ++     SG  Q + + L   +I   R  I  L+++N RL+++        L PL +P        N  S ++K+   A      ++ L  ++    + +K++D++
Sbjct:   10 VKVGSVVEVIGKGQRGTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPDSGVAKLLKKEIQETPKTAKQTGRPSVGGSALSESVLAESESSSSTQMSLAAPVVPQPSTASTPAPA-----------TPSKEEESLRAQLKDLEEKLETLRMKRSEDKAKLKEMEKYKIQLEQLQEWRSKMQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLRSQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAE---QLQQPAAELFD--FKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALD----CMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQGLNPYECLRQSCSAVIATMNKMATAMQEGEYDSERPQ-RPPPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTSTKDADERVEKIQTKLDEALNTLKKKEKEFEETMDALQADIDQLESEKAELKQRISSQSRATEGLRGQPASGIASIVTGNVAGGMLSAPAGVSGVVQVVDSPLLKQQIDVQRIAIKQLKSENYRLKAERMRAQLSSLPPLQVP--------NMKSVMMKENTAAGALQRKTDVLLHNLMKMSAGLKVVDIT 1114          
BLAST of Dynactin 1b vs. Ensembl Zebrafish
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 464.151 bits (1193), Expect = 9.610e-142
Identity = 359/1173 (30.61%), Postives = 603/1173 (51.41%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESK----------------------VRPSALRKPMSIKSRSXXXXXXXXXXTENA-VTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGN------DFLMQDSVNDEAQCL---------------------------MLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGL---DLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKII----TSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE---------MXXXXXXXXXXXXXXXNFFDNI---NISTSKIADQVD-SGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLS 3298
             K+  +V   G   +GTV +IG T FASG W GV LD  KGKNDG+V GK YF C++NHGIFVR +Q+  +D   S+ TS E+                        RPS     +S    +     +   ++  A V P+      P                 KE  S   Q+KDL EKL+TL++KRSEDK KLKE EK K++++QL+E +  +QE+  + Q+ L + K++  + +E  D Y EE    AD IEM T+DKEMAEE+ ES + E + LK K EE++++ EILK  +E+ G N        +  D      +CL                            L+ QN +L++A++ MRDL+ + K E+ K  K++ K  SELE    ++++L  ++K A+++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q  +++E      Q A E     +K K  ETK  A  IE EL+K++VSQ++  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+      +G+     +  ++   L+Y L+     L  Y+  LS C +  + R+G L+ EM  +E+S+D+LIDLL K  LDE   +EPL ++I Y+Q  Y VHL ++P DC +++ D +K      D    C    +  +        E  E  V L+       D++   + IR+ +  +       +L+F+  +S  L      L+ +  ++     +    +A + +++   +V +  + +K +E+    + L+    +  +   ++     ++ +M+ GEYD E    +   P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL  + K+ DE +E+++ KL++    L +KEKE ++T +ALQ+DI+ LE         +  +    +    +  +   +I   N++   ++     SG  Q + + L   +I   R  I  L+++N RL+++        L PL +P        N  S ++K+   A      ++ L  ++    + +K++D++
Sbjct:   10 VKVGSVVEVIGKGQRGTVAYIGATLFASGKWVGVILDEAKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLMDDGGSSATSPETPDSGVAKLLKKEIQETPKTAKQTGRPSVGGSALSESVLAESESSSSTQMSLAAPVVPQPSTASTPAPA-----------TPSKEEESLRAQLKDLEEKLETLRMKRSEDKAKLKEMEKYKIQLEQLQEWRSKMQEQQNDLQKQLKEAKKEAREALEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQQETESLKEKLEELTMDMEILKHEIEEKGENMHTNIHRLITTDPSCWSFRCLTSMCVCSFVCVCVFSGSDGAASSYHVKQLEEQNARLKEALVRMRDLSSSEKQEHVKLQKQMEKKNSELETLRSQKEKLQEEMKLAEDTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLESINEMNDELQENARETELELREQLDLAGARVREAQKRVEAAQETLADYQQTINKYRELTTHLQEVNRELTNQQSSSAE---QLQQPAAELFD--FKIKFAETKAYAKAIEMELRKMEVSQANRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLTGGSLERAGLRGAAGEQLSFASGLVYSLTLLQATLHKYELALSVCGVDVYKRMGMLYSEMCVHERSLDFLIDLLHKDQLDETVQVEPLTKAIKYYQHLYSVHLCDQPEDCTVQLADHIKFTQSALD----CMGSEVGRLRAFLQAGQEGAELCVLLKDLDTSCGDIRQFCKKIRRRMPGTDAPGIPAALRFSEQVSEALADSRKQLARVVAVLQEVSAAGAQMMAPLQEQEGLSAVKIEDVAFKAVEQVYGTQGLNPYECLRQSCSAVIATMNKMATAMQEGEYDSERPQ-RPPPPVETRAAAVRAEMTDAEGLGNKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTSTKDADERVEKIQTKLDEALNTLKKKEKEFEETMDALQADIDQLESEKAELKQRISSQSRATEGLRGQPASGIASIVTGNVAGGMLSAPAGVSGVVQVVDSPLLKQQIDVQRIAIKQLKSENYRLKAERMRAQLSSLPPLQVP--------NMKSVMMKENTAAGALQRKTDVLLHNLMKMSAGLKVVDIT 1153          
BLAST of Dynactin 1b vs. Ensembl Zebrafish
Match: dctn1b (dynactin 1b [Source:ZFIN;Acc:ZDB-GENE-050419-28])

HSP 1 Score: 463.381 bits (1191), Expect = 2.131e-141
Identity = 370/1146 (32.29%), Postives = 603/1146 (52.62%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAES--------------------KV----RPSALRKPMSIKSRSXXXXXXXXXXTEN---AVTP------KEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGL---DLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKC---------VTDLSAITKIITSYCLEL-ATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQE------ISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANR----NSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP 3310
            +GTV +IG T FASG W GV LD PKGKNDG+V GK YF C +NHGIFVR +Q+  V+ D +  TS E+                    KV    RP   R  + +K  S        + +E    A TP         V  LP      +      P   KE  S    VKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK + +E++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K + K   EL+     +++L  ++K A+++I ELKEQVD++LGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R+L  +LQ   ++L  Q + NSE    Q Q A     EI+  K K  ETK  A  IE EL+K++V Q++  V +L  F+PD F K   D+D I+ +LLI +LI K E ++ Q +E+F L+     + G+   + +  ++   LIY L+     L  Y+  LS C +  + R+GSL+ E+S +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D ++      D    C    +  +        +   F V L+       D++   + IR+ +  + +    + LS     C         +  ++A+ + + +   +L A +S+ +   +V +  + +K  E+    + +++   +  +   ++     ++ +M+ GEYD +        P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T + L +KEKE ++T +ALQ+DI+ LE ++ ELK ++    K           S IA  V  G + E       +A L          +I+  R  I +L+N+N RL+++        L PL++P  L      R    +S+L +K          ++ L   +    + VK++D++ R P
Sbjct:   24 RGTVAYIGNTLFASGKWVGVILDEPKGKNDGTVQGKRYFLCQENHGIFVRQSQIQLVE-DGADTTSPETPEALTSKMLKREIIEGLKSNKVTTTRRPKQTRAGVGVKVGSGSASAGEMSSSEPSTPAQTPLAAPVIPSPVGALPSPGAPPI------PGPSKEEESLRALVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKSKMQEQQNELQKQLKEAKREAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKERVDELTMDLEILKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHGKQQKLMEKKNFELDALRCHKEKLQEEMKMAEKTIDELKEQVDASLGAEEMVEMLTERNLDLEEKVRELRETVADLEAINEMNDELQENARETELELREQLDLGAAGVREAEKRVEAAQETVADYQQTIQKYRELTANLQEVNRELMSQQEANSE---QQQQPA-----EIFDFKIKFAETKAYAKAIEMELRKMEVIQANRQVSLLISFMPDSFLKHRGDHDCILALLLIPRLICKSELISKQAQEKFELTESCSQKPGMRGAVGERLSFAAGLIYSLTLLQAALHKYEHALSQCSVDVYKRVGSLYSELSVHERSLDFLIDLLYKDLLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIRFTQSALD----CMAVEVGRLRAFIQTGQDEEAFCVLLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALSFGPQVCEALADSRRQLAWVNAVLQEVAAAAAQLIAPLSEHEGLPAVKLEDMAFKAAEQIYGSQGINAQECLRQSCSVVIATMNKMATAMQEGEYDSDRPQTGI-SPVEVRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQAILDETDSLLKKKEKEFEETMDALQADIDQLESEKVELKHRISSQSKMTIESLRGSQASGIASIVTCGITAEEQKGVCAAAGLQVIDSPLLTQQIEAQRLSIKHLKNENNRLKAERMRAQLASLPPLNVP-KLGWREGCRPEVLSSALYRK----------TDQLLDTLLQMSANVKVVDITGRSP 1132          
BLAST of Dynactin 1b vs. Ensembl Zebrafish
Match: dctn1b (dynactin 1b [Source:ZFIN;Acc:ZDB-GENE-050419-28])

HSP 1 Score: 461.455 bits (1186), Expect = 2.607e-141
Identity = 377/1195 (31.55%), Postives = 624/1195 (52.22%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQ---LAKVDGDESTNTSAESKV-RPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGL---DLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKC---------VTDLSAITKIITSYCLEL-ATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISA-----------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANR----NSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKL---QFEKLRKEKTDFINEDNLFSKI--DNASCP---LFKSKDQNLND--YIGSVNFHPISKPEEKI 3526
            +GTV +IG T FASG W GV LD PKGKNDG+V GK YF C +NHGIFVR +Q   L      + T      KV   SA    MS    S+             V P   V  LP      +      P   KE  S    VKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK + +E++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K + K   EL+     +++L  ++K A+++I ELKEQVD++LGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R+L  +LQ   ++L  Q + NSE    Q Q A     EI+  K K  ETK  A  IE EL+K++V Q++  V +L  F+PD F K   D+D I+ +LLI +LI K E ++ Q +E+F L+     + G+   + +  ++   LIY L+     L  Y+  LS C +  + R+GSL+ E+S +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D ++      D    C    +  +        +   F V L+       D++   + IR+ +  + +    + LS     C         +  ++A+ + + +   +L A +S+ +   +V +  + +K  E+    + +++   +  +   ++     ++ +M+ GEYD +        P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T + L +KEKE ++T +ALQ+DI+ LE ++ ELK ++    K           S IA  V  G +  + A              +I+  R  I +L+N+N RL+++        L PL++P  L      R    +S+L +K          ++ L   +    + VK++D++ R P       L    R++      ++L+ E  + +      +++  D A+ P     K+K++   D   +G V   P ++ +E++
Sbjct:   24 RGTVAYIGNTLFASGKWVGVILDEPKGKNDGTVQGKRYFLCQENHGIFVRQSQVLHLLSWSVFQQTRAGVGVKVGSGSASAGEMS----SSEPSTPAQTPLAAPVIPSP-VGALPSPGAPPI------PGPSKEEESLRALVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKSKMQEQQNELQKQLKEAKREAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKERVDELTMDLEILKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHGKQQKLMEKKNFELDALRCHKEKLQEEMKMAEKTIDELKEQVDASLGAEEMVEMLTERNLDLEEKVRELRETVADLEAINEMNDELQENARETELELREQLDLGAAGVREAEKRVEAAQETVADYQQTIQKYRELTANLQEVNRELMSQQEANSE---QQQQPA-----EIFDFKIKFAETKAYAKAIEMELRKMEVIQANRQVSLLISFMPDSFLKHRGDHDCILALLLIPRLICKSELISKQAQEKFELTESCSQKPGMRGAVGERLSFAAGLIYSLTLLQAALHKYEHALSQCSVDVYKRVGSLYSELSVHERSLDFLIDLLYKDLLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIRFTQSALD----CMAVEVGRLRAFIQTGQDEEAFCVLLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALSFGPQVCEALADSRRQLAWVNAVLQEVAAAAAQLIAPLSEHEGLPAVKLEDMAFKAAEQIYGSQGINAQECLRQSCSVVIATMNKMATAMQEGEYDSDRPQTGI-SPVEVRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQAILDETDSLLKKKEKEFEETMDALQADIDQLESEKVELKHRISSQSKMTIESLRGSQASGIASIVTCGITAGVCAAAGLQVIDSPLLTQQIEAQRLSIKHLKNENNRLKAERMRAQLASLPPLNVP-KLGWREGCRPEVLSSALYRK----------TDQLLDTLLQMSANVKVVDITGRSPVSPSAQLLEQTARLQSLNDTLDRLKDEVAEHVVTHRPGAQVSSDFATFPCTSFVKAKEEKRGDAVLVGRV-MMPCARGQEQV 1176          
BLAST of Dynactin 1b vs. Ensembl Xenopus
Match: ENSXETT00000028179.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 462.996 bits (1190), Expect = 4.422e-141
Identity = 377/1222 (30.85%), Postives = 640/1222 (52.37%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNTSAESKVRPSALRKPMSIKSRSXXXXX-------------------------XXXXXTENAVTP-KEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEK----SSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLS-------TNLD-----KCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIAD------------QVDSGSS----------QEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSA-VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCP----------LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+  + DG ++T+           L+K +S   +S+                             + +  +  A TP    +   P             P   KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ A+ QR L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE+ ++ EI K  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +EL+   +++++L  +    +++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+RDL   LQ          + N EL +NQ + +VEK    S E++  K K  ETK  A  IE EL+K++VSQ++ HV +L  F+PD F + G D+D I+++LLI +LI K E ++ Q +E+F LS     +SG+   + +  ++   L+Y L+     L  Y++ L  C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL ++  +C ++++D +K      D +         F+  H  + S  +  L++ L+    D++   + IR+ +  + +    + LS       T LD     KCV  ++   ++  +    +A + + +  +++ +  + +K  E+    +  +    +  +   ++     ++ +M+ GEYD E    K+  P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    KE D+ +E+++ KLE+T+  L +KEKE ++T +ALQ+DI+ LE ++ EL+++L    KR          S +A              V SG S          ++    L +I  LR  + +L+++N +L++         L  L +P  L+ P   +    +    Y      +S+ L  D    +SA  K++D++ +      ++ L    R+K   + + K K + + E    ++   A+ P            K+K++   D  YIG V  
Sbjct:   42 RGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPETPEPAASKGLKKDVSETPKSSKLPTRPSSSAASSGTAGASGSASASCGEISSSEPSTPAQTPLAAPIIPSPSSAILSPVAPLPGPGPTKEEENLRAQVKDLDEKLETLKMKRAEDKAKLKELEKSKLQLEQLQEWKSKMQEQQADVQRQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQQKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQ----------EVNREL-RNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQFCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCV--VAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKEADDRVEKIQTKLEETQTVLKKKEKEFEETMDALQADIDQLESEKAELRQRLNNQSKRTIEGLRGSPASGVASIVSGLAGEEEQRGVSSGQSLLNGSGPVQVKDSPLLLQQIDALRLSMKHLKHENNKLKAHQIKADLASLPALHVP-KLSLPKDRQREEALSGTLYRK----TSQLL--DALQQMSANAKVVDIAHKKAGSPAVHLLEQTARLKSLSDTIDKLKDEVMKE--TVAQCPGANVPTDFATFPSSDFIKAKEEKKEDTVYIGKVTL 1233          
BLAST of Dynactin 1b vs. Ensembl Xenopus
Match: ENSXETT00000011610.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 405.986 bits (1042), Expect = 3.542e-120
Identity = 333/1055 (31.56%), Postives = 574/1055 (54.41%), Query Frame = 2
Query:  491 QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEK----SSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLS-------TNLD-----KCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNF-------FDNINISTSKIADQVDSGSS----------QEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTP-NANRNSSLIKKMEYANLTITSSENLTRDIYSHLSA-VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCP----------LFKSKDQNLND--YIGSVNF 3496
            QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ A+ QR L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE+ ++ EI K  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +EL+   +++++L  +    +++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+RDL   LQ          + N EL +NQ + +VEK    S E++  K K  ETK  A  IE EL+K++VSQ++ HV +L  F+PD F + G D+D I+++LLI +LI K E ++ Q +E+F LS     +SG+   + +  ++   L+Y L+     L  Y++ L  C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL ++  +C ++++D +K      D +         F+  H  + S  +  L++ L+    D++   + IR+ +  + +    + LS       T LD     KCV  ++   ++  +    +A + + +  +++ +  + +K  E+    +  +    +  +   ++     ++ +M+ GEYD E    K+  P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    KE D+ +E+++ KLE+T+  L +KEKE ++T +ALQ+DI+ LE ++ EL+++L    KR            +    S +A  V SG S          ++    L +I  LR  + +L+++N +L++         L  L +P  L+ P +  R  +L        L   +S+ L  D    +SA  K++D++ +      ++ L    R+K   + + K K + + E    ++   A+ P            K+K++   D  YIG V  
Sbjct:  225 QVKDLDEKLETLKMKRAEDKAKLKELEKSKLQLEQLQEWKSKMQEQQADVQRQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQQKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQ----------EVNREL-RNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQFCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCV--VAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKEADDRVEKIQTKLEETQTVLKKKEKEFEETMDALQADIDQLESEKAELRQRLNNQSKRTIEGLRGSPASGVASIVSGLAGGVSSGQSLLNGSGPVQVKDSPLLLQQIDALRLSMKHLKHENNKLKAHQIKADLASLPALHVP-KLSLPKDRQREEAL-----SGTLYRKTSQLL--DALQQMSANAKVVDIAHKKAGSPAVHLLEQTARLKSLSDTIDKLKDEVMKE--TVAQCPGANVPTDFATFPSSDFIKAKEEKKEDTVYIGKVTL 1248          

HSP 2 Score: 91.2781 bits (225), Expect = 9.560e-18
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNTSAESKVRPSALRKPMSIKSRS 340
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+  + DG ++T+           L+K +S   +S
Sbjct:   42 RGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPETPEPAASKGLKKDVSETPKS 128          
BLAST of Dynactin 1b vs. Ensembl Xenopus
Match: ENSXETT00000000695.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 401.749 bits (1031), Expect = 5.537e-119
Identity = 326/1058 (30.81%), Postives = 569/1058 (53.78%), Query Frame = 2
Query:  491 QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEK----SSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLS-------TNLD-----KCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXX---XXXXXXXNFFDNINISTSKIADQVDSGSSQEISA------------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSA-VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCP----------LFKSKDQNLND--YIGSVNF 3496
            QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ A+ QR L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE+ ++ EI K  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +EL+   +++++L  +    +++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+RDL   LQ          + N EL +NQ + +VEK    S E++  K K  ETK  A  IE EL+K++VSQ++ HV +L  F+PD F + G D+D I+++LLI +LI K E ++ Q +E+F LS     +SG+   + +  ++   L+Y L+     L  Y++ L  C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL ++  +C ++++D +K      D +         F+  H  + S  +  L++ L+    D++   + IR+ +  + +    + LS       T LD     KCV  ++   ++  +    +A + + +  +++ +  + +K  E+    +  +    +  +   ++     ++ +M+ GEYD E    K+  P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    KE D+ +E+++ KLE+T+  L +KEKE ++T +ALQ+DI+ LE ++ EL+++     +        +     + I   +  G  Q +S+                   L +I  LR  + +L+++N +L++         L  L +P  L+ P   +    +    Y      +S+ L  D    +SA  K++D++ +      ++ L    R+K   + + K K + + E    ++   A+ P            K+K++   D  YIG V  
Sbjct:  189 QVKDLDEKLETLKMKRAEDKAKLKELEKSKLQLEQLQEWKSKMQEQQADVQRQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQQKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQ----------EVNREL-RNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQFCKKIRRRMPGTEAAGIPAALSFAQPVSRTLLDCRKYLKCV--VAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKEADDRVEKIQTKLEETQTVLKKKEKEFEETMDALQADIDQLESEKAELRQRLNNQSKRTIEGLRGSPASGVASIVSGLAGGERQTLSSGQSLLNGSGPVQVKDSPLLLQQIDALRLSMKHLKHENNKLKAHQIKADLASLPALHVP-KLSLPKDRQREEALSGTLYRK----TSQLL--DALQQMSANAKVVDIAHKKAGSPAVHLLEQTARLKSLSDTIDKLKDEVMKET--VAQCPGANVPTDFATFPSSDFIKAKEEKKEDTVYIGKVTL 1216          

HSP 2 Score: 90.1225 bits (222), Expect = 1.697e-17
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNTSAESKVRPSALRK 316
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+  + DG ++T+           L+K
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPETPEPAASKGLKK 102          
BLAST of Dynactin 1b vs. Ensembl Xenopus
Match: ENSXETT00000000846.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 401.749 bits (1031), Expect = 9.447e-119
Identity = 326/1058 (30.81%), Postives = 569/1058 (53.78%), Query Frame = 2
Query:  491 QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEK----SSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLS-------TNLD-----KCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXX---XXXXXXXNFFDNINISTSKIADQVDSGSSQEISA------------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSA-VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCP----------LFKSKDQNLND--YIGSVNF 3496
            QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ A+ QR L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE+ ++ EI K  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +EL+   +++++L  +    +++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+RDL   LQ          + N EL +NQ + +VEK    S E++  K K  ETK  A  IE EL+K++VSQ++ HV +L  F+PD F + G D+D I+++LLI +LI K E ++ Q +E+F LS     +SG+   + +  ++   L+Y L+     L  Y++ L  C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL ++  +C ++++D +K      D +         F+  H  + S  +  L++ L+    D++   + IR+ +  + +    + LS       T LD     KCV  ++   ++  +    +A + + +  +++ +  + +K  E+    +  +    +  +   ++     ++ +M+ GEYD E    K+  P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    KE D+ +E+++ KLE+T+  L +KEKE ++T +ALQ+DI+ LE ++ EL+++     +        +     + I   +  G  Q +S+                   L +I  LR  + +L+++N +L++         L  L +P  L+ P   +    +    Y      +S+ L  D    +SA  K++D++ +      ++ L    R+K   + + K K + + E    ++   A+ P            K+K++   D  YIG V  
Sbjct:  212 QVKDLDEKLETLKMKRAEDKAKLKELEKSKLQLEQLQEWKSKMQEQQADVQRQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQQKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQ----------EVNREL-RNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQFCKKIRRRMPGTEAAGIPAALSFAQPVSRTLLDCRKYLKCV--VAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKEADDRVEKIQTKLEETQTVLKKKEKEFEETMDALQADIDQLESEKAELRQRLNNQSKRTIEGLRGSPASGVASIVSGLAGGERQTLSSGQSLLNGSGPVQVKDSPLLLQQIDALRLSMKHLKHENNKLKAHQIKADLASLPALHVP-KLSLPKDRQREEALSGTLYRK----TSQLL--DALQQMSANAKVVDIAHKKAGSPAVHLLEQTARLKSLSDTIDKLKDEVMKET--VAQCPGANVPTDFATFPSSDFIKAKEEKKEDTVYIGKVTL 1239          

HSP 2 Score: 90.8929 bits (224), Expect = 1.082e-17
Identity = 39/84 (46.43%), Postives = 55/84 (65.48%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNTSAESKVRPSALR--KPMS 325
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+  + DG ++T+           L+  KP+S
Sbjct:   49 RGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPETPEPAASKGLKKGKPLS 132          
BLAST of Dynactin 1b vs. Ensembl Xenopus
Match: ENSXETT00000000206.1 (dynactin subunit 1 [Source:NCBI gene;Acc:447948])

HSP 1 Score: 401.749 bits (1031), Expect = 1.009e-118
Identity = 331/1059 (31.26%), Postives = 571/1059 (53.92%), Query Frame = 2
Query:  491 QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEK----SSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLS-------TNLD-----KCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIAD------------QVDSGSS----------QEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSA-VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCP----------LFKSKDQNLND--YIGSVNF 3496
            QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ A+ QR L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE+ ++ EI K  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +EL+   +++++L  +    +++I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+RDL   LQ          + N EL +NQ + +VEK    S E++  K K  ETK  A  IE EL+K++VSQ++ HV +L  F+PD F + G D+D I+++LLI +LI K E ++ Q +E+F LS     +SG+   + +  ++   L+Y L+     L  Y++ L  C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL ++  +C ++++D +K      D +         F+  H  + S  +  L++ L+    D++   + IR+ +  + +    + LS       T LD     KCV  ++   ++  +    +A + + +  +++ +  + +K  E+    +  +    +  +   ++     ++ +M+ GEYD E    K+  P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    KE D+ +E+++ KLE+T+  L +KEKE ++T +ALQ+DI+ LE ++ EL+++L    KR          S +A              V SG S          ++    L +I  LR  + +L+++N +L++         L  L +P  L+ P   +    +    Y      +S+ L  D    +SA  K++D++ +      ++ L    R+K   + + K K + + E    ++   A+ P            K+K++   D  YIG V  
Sbjct:  212 QVKDLDEKLETLKMKRAEDKAKLKELEKSKLQLEQLQEWKSKMQEQQADVQRQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEELKIDLEIFKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKVQKQMEKKNTELDTLRQQKEKLQEEASLMEKTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQ----------EVNREL-RNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVSQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEASEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQSEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HVGQESSDFAILLKDLETSCSDIRQFCKKIRRRMPGTEAAGIPAALSFAQPVCETLLDCRKYLKCV--VAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGSKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKEADDRVEKIQTKLEETQTVLKKKEKEFEETMDALQADIDQLESEKAELRQRLNNQSKRTIEGLRGSPASGVASIVSGLAGEEEQRGVSSGQSLLNGSGPVQVKDSPLLLQQIDALRLSMKHLKHENNKLKAHQIKADLASLPALHVP-KLSLPKDRQREEALSGTLYRK----TSQLL--DALQQMSANAKVVDIAHKKAGSPAVHLLEQTARLKSLSDTIDKLKDEVMKE--TVAQCPGANVPTDFATFPSSDFIKAKEEKKEDTVYIGKVTL 1240          

HSP 2 Score: 91.2781 bits (225), Expect = 8.833e-18
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNTSAESKVRPSALRKPMSIKSRS 340
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+  + DG ++T+           L+K +S   +S
Sbjct:   42 RGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPETPEPAASKGLKKDVSETPKS 128          
BLAST of Dynactin 1b vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 478.404 bits (1230), Expect = 4.710e-147
Identity = 375/1238 (30.29%), Postives = 627/1238 (50.65%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV--------------------------RPSALRKPMSIKSRSXXXXX------------XXXXXTENAVTPKE---EVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFS 3577
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+    DG ++T+     S+ SKV                          R +  R+P   +  S                      +    TP +       +P         +   P   KE      QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P D  +++ D +K      D +         F+ +   EA++    L  L+    D +   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + TIL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +L++T+  L +KEK+ ++T +ALQ+DI+ LE             +K      +N  + +  +    G  ++    L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F   +   ++ ++   +LT  +LH + S
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLE------------AEKAELKQRLNSQSKRTIE----GLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHEGPGGNLVAGALYRK-TSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLGQRHRL---VLTQEQLHQLHS 1239          
BLAST of Dynactin 1b vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 476.863 bits (1226), Expect = 1.716e-146
Identity = 377/1208 (31.21%), Postives = 621/1208 (51.41%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV----RPSALRKPMSIKSRSXXXXXXXXX--------------XTENAVTPKE---EVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQV-----------------DSGSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+    DG ++T+     S+ SKV       A  K   + +R     +   +               +    TP +       +P         +   P   KE      QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P D  +++ D +K      D +         F+ +   EA++    L  L+    D +   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + TIL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +L++T+  L +KEK+ ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V                   G  ++    L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHEGPGGNLVAGALYRK-TSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1211          
BLAST of Dynactin 1b vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 474.937 bits (1221), Expect = 1.243e-145
Identity = 379/1233 (30.74%), Postives = 620/1233 (50.28%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV--------------------------RPSALRKPMSIKSRSXXXXX------------XXXXXTENAVTPKE---EVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIA----------DQVDSGSSQEISA------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+    DG ++T+     S+ SKV                          R +  R+P   +  S                      +    TP +       +P         +   P   KE      QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P D  +++ D +K      D +         F+ +   EA++    L  L+    D +   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + TIL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +L++T+  L +KEK+ ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA           Q      Q   A             L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEPQRGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHEGPGGNLVAGALYRK-TSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1236          
BLAST of Dynactin 1b vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 474.167 bits (1219), Expect = 3.512e-145
Identity = 379/1233 (30.74%), Postives = 620/1233 (50.28%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV--------------------------RPSALRKPMSIKSRSXXXXX------------XXXXXTENAVTPKE---EVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIA----------DQVDSGSSQEISA------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+    DG ++T+     S+ SKV                          R +  R+P   +  S                      +    TP +       +P         +   P   KE      QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P D  +++ D +K      D +         F+ +   EA++    L  L+    D +   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + TIL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +L++T+  L +KEK+ ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA           Q      Q   A             L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEPQRGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHEGPGGNLVAGALYRK-TSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1253          
BLAST of Dynactin 1b vs. Ensembl Mouse
Match: Dctn1 (dynactin 1 [Source:MGI Symbol;Acc:MGI:107745])

HSP 1 Score: 412.535 bits (1059), Expect = 9.871e-124
Identity = 332/1058 (31.38%), Postives = 555/1058 (52.46%), Query Frame = 2
Query:  455 PVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQV-----------------DSGSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            P   KE      QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P D  +++ D +K      D +         F+ +   EA++    L  L+    D +   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + TIL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +L++T+  L +KEK+ ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V                   G  ++    L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   77 PSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHEGPGGNLVAGALYRK-TSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1114          
BLAST of Dynactin 1b vs. UniProt/SwissProt
Match: sp|Q14203|DCTN1_HUMAN (Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3)

HSP 1 Score: 481.485 bits (1238), Expect = 4.990e-147
Identity = 339/1009 (33.60%), Postives = 545/1009 (54.01%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL-------------------AKVDGDESTNTSAE-SKVR-------PSA----LRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQD---------------LPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-----EIRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+                   +KV   E T+T+A+ SK+R       P+A     R+P   +  S       ++L  +      E+                 +P  +          P   KE      QV+DL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P DC +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++       A  +      + N   L   +E+       +I    S+ P      +  IL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+A L +KEKE ++T +ALQ+DI+ LE
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEV---AAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLE 1027          
BLAST of Dynactin 1b vs. UniProt/SwissProt
Match: sp|O08788|DCTN1_MOUSE (Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dctn1 PE=1 SV=3)

HSP 1 Score: 474.167 bits (1219), Expect = 2.456e-144
Identity = 379/1233 (30.74%), Postives = 620/1233 (50.28%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV--------------------------RPSALRKPMSIKSRSXXXXX------------XXXXXTENAVTPKE---EVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIA----------DQVDSGSSQEISA------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+    DG ++T+     S+ SKV                          R +  R+P   +  S                      +    TP +       +P         +   P   KE      QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + +++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P D  +++ D +K      D +         F+ +   EA++    L  L+    D +   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + TIL  + N ++ +M+ GEYD E    K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +L++T+  L +KEK+ ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA           Q      Q   A             L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   ++H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKP-PPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEPQRGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHEGPGGNLVAGALYRK-TSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1253          
BLAST of Dynactin 1b vs. UniProt/SwissProt
Match: sp|Q6PCJ1|DCTN1_XENLA (Dynactin subunit 1 OS=Xenopus laevis OX=8355 GN=dctn1 PE=2 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 4.746e-143
Identity = 384/1244 (30.87%), Postives = 655/1244 (52.65%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNTSAESKVRPSALRK-----PMSIK--------------SRSXXXXXXXXXXTENAVTP-KEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEK----SSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLS-------TNLD-----KCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNF-------FDNINISTSKIADQVDSGSS----------QEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSA-VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCP----------LFKSKDQNLND--YIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY*IVIC 3595
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+  + DG ++T+           L+K     P S K              + ++   ++ +  +  A TP    +   P             P   KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE  ++ EILK  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +EL+   +++++L  +    +++I ELKEQVD+ALGA+EMV  L E+NL LEE V+ L E  ++LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+RDL   LQ          + NSEL +NQ + +VEK    S E++  K K  ETK  A  IE EL+K++V+Q++ HV +L  F+PD F + G D+D I+++LLI +LI K E ++ Q +E+F LS +   +SG+   + +  ++   L+Y L+     L  Y++ L  C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL ++  +C ++++D +K      D +         F+  H  + S  +  L++ L+    D++   + IR+ +  + +    + L        T LD     KCV  ++   ++  +    +A + + +  +++ +  + +K  E+    +  +    +  +   ++     ++ +M+ GEYD E    K+  P+   A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    KE D+ +E+++ KLE+T+  L +KEKE ++T +ALQ+DI+ LE ++ EL+++L    KR            +    S +A  V SG S          ++    L +I  LR  + +L+++N +L++         L  L +P  L  P         +K E  + T+    +   D    +SA  K++D++ +         L    R+K   + + K K + + E    S+   A+ P            K+K++   D  YIG V      +P +  ++   +LT  +LH +     +IC
Sbjct:   24 RGTVAYVGATLFATGKWVGVILDDSKGKNDGTVQGRRYFTCEENHGIFVRQSQIQVIEDGADTTSPETPEPTASKGLKKDVMETPKSSKLPTRPSSSAASSGTASASCGEISSSEPSTPAQTPLAAPIIPSPSSAITSPVAPLPGPGPSKEEENLRAQVKDLEEKLETLKMKRAEDKAKLKEMEKSKLQLEQVQEWKSKMQEQQADIQRQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEEHKIDLEILKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHIKVQKQMEKKNTELDTLRQQKEKLQEEASHMEKTIDELKEQVDAALGAEEMVETLAERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIKKYRDLTAHLQ----------EVNSEL-RNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEVTQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFELSEVGEQKSGMRGAVGEQMSFAAGLVYSLTLLQATLHKYEQALDKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLADQAEECTMQLSDHIKFTQSALDCMGVEVSRLRAFL--HAGQESSDFAILLKDLETSCSDIRQFCKKIRRRMPGTEAAGIPAALGFGQQVCETLLDCRKYLKCV--VAVFQEVAAAGAQMIAPMGENEGLQALKLEDVAFKATEQIYGTKGSNPYECLRQSCSVVIATMNKMATAMQEGEYDAEKPQSKSPPPVEQRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKEADDRVEKIQTKLEETQTVLKKKEKEFEETMDALQADIDQLESEKAELRQRLNNQSKRTIEGLRGVPASGVASIVSGLAGGVSSGQSLINGSGPVQVKDSPLLLQQIDALRLSMKHLKHENNKLKAHQIKTDLSSLPALHVP-KLTLPKDR------QKEEAMSGTLYRKTSQLLDALQQMSANAKVVDITHKKAGNPAAQLLEQTARLKSLSDTIDKLKNEVMKE--TVSQCPGANVPTDFATFPSTDFIKAKEEKKEDTVYIGKVTLS--CQPGQG-QIHKLVLTPEQLHELHER--LIC 1232          
BLAST of Dynactin 1b vs. UniProt/SwissProt
Match: sp|P28023|DCTN1_RAT (Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2)

HSP 1 Score: 465.692 bits (1197), Expect = 2.759e-141
Identity = 381/1233 (30.90%), Postives = 619/1233 (50.20%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQL------AKVDGDESTNTSAE--------------SKVR-------PSA----LRKPMSIKSRSXXXXX------------XXXXXTENAVTPKE---EVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI------YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSY-CLELATVSDEDDAKSVNMSSLYKYIEKFME-IRNLSSTLP--IFTNTETILKISAN-ISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDS----------------------GSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTR-DIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKE--KTDFINEDNLFSKIDNASCP---LFKSKDQNLND--YIGSVNF 3496
            +GTV ++G T FA+G W GV LD  KGKNDG+V G+ YF CD+ HGIFVR +Q+      A     E+ ++SA               SK+R       P+A     R+P   +  S                      +    TP +       +P         +   P   KE     +QV+DL EKL+TL++KRSEDK KLKE EK K++++Q++E K  +QE+ A+ QR L + K+    L E  + Y EE    AD IEM T+DKEMAEE+ ES + E++ LK + +E++ + EILK  +E+ G       D      Q   L+ QN +L+DA++ MRDL+ + K E+ K  K + K   ELE   ++R+RL  +L  A+ +I ELKEQVD+ALGA+EMV  LT++NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI+K+R L   LQ          D N EL+ NQ + +VE+  +       +K K  ETK  A  IE EL++++V+Q++ H+ +L  F+PD F + G D+D ++++LL+ +LI K E +  Q +E+F LS       G+     +  ++   L+Y LS     L  Y+  LS C +  + ++GSL+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +P +  +++ D +K      D +         F+ +   EA++    L  L+    D++   + IR+ +  +       +L F S +S  L  C   L+ +  ++          ++   + + + +++L +   K  E I    S+ P      + +IL  + N ++ +M+ GEYD E    K        A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE IE+++ +LE+T+  L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    KR          S IA  V                        G  ++    L +I  +R  I  L+++N  LR          L PL +      P+     +L+    Y   T    E L +   Y+H+  +     + + P  + + +++    +    EKL+ E  K             D A+ P     ++K++  +D  Y+G V F
Sbjct:   41 RGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKILKREGADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRDQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEAKEAKEAL-EAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGS------DGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQ----------DVNRELT-NQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEESTMQLADHIKFTQSALDCMSVEVGRLRAFL-QGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCSILISTMNKLATAMQEGEYDAERPPSKPPPVEPWPAA-LRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMDALQADIDQLEAEKTELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGGTPGQAPGALPGPGPVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKFSLPPHEGPGGNLLSGALYRK-TSQLLEKLNQLSTYTHVVDITRSSPACKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTF 1252          
BLAST of Dynactin 1b vs. UniProt/SwissProt
Match: sp|P35458|DCTN1_CHICK (Dynactin subunit 1 OS=Gallus gallus OX=9031 GN=DCTN1 PE=1 SV=2)

HSP 1 Score: 451.825 bits (1161), Expect = 1.279e-136
Identity = 364/1158 (31.43%), Postives = 600/1158 (51.81%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV-------------------------RPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQEL--------EISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTETILKISANI-----------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVD--SGSSQEISA--------------------FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTI-TSSENLTRDIYSHLSAVKIID 3292
            +GTV ++G T  A+G W GV LD  KGKNDG+V G+ YF C++NHGIFVR +Q+    DG ++T+     SA  KV                         RP   R P S  S          + +   ++  E        +   +         ++   P   KE  +   QV+DL EKL+TL+IKR+EDK KLKE EK K++++Q++E K  +QE+ A+ QR L + K++    +E  + Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K E ++++ EILK  +E+ G       D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +ELE   ++R++L  ++K A++++ ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI+K+R+L   LQ+  ++L  Q + ++E  K Q     +   EI+  K K  ETK  A  IE EL++++V Q++ HV +L  F+PD F + G D+D I+++LLI +LI K + ++ Q +E+F L+      +G+     +  ++   L+Y LS     L  Y++ L+ C +  + ++G L+ EMS +E+S+D+LI+LL K  LDE  ++EPL ++I Y+Q  Y +HL  +  DC +++ D +K      D   +E C    +   ++   EAS+    L  L+    D++   + IR+ +  +       +L F   +S  L  C   L+ +  ++     E+A    +  A    ++       +   +   S    +  +    L++ A +           + +M+ GEYD +    K   P  + A   + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ D+ +E+++ KL++T+  L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    KR          S +A  V   +G  Q+                        L +I+ L+  I +L+N+N RL+          LKPL +   ++ P + +          A LT+   S  L   +Y   +  K++D
Sbjct:   42 RGTVAYVGATLXATGKWVGVILDEAKGKNDGTVQGRKYFTCEENHGIFVRQSQIQVFEDGADTTSPETPESAALKVPKRHSRXAAKGSKLRGAKPKKTTARRPKPTRTPTSAPSSGTAGPSGSASASGGEMSSSEPSTPAQTPLVAPVIPSPSLTSPVAPMVPSPTKEEENLRSQVRDLEEKLETLKIKRNEDKAKLKELEKYKIQLEQVQEWKSKMQEQQADLQRRLKEAKKEAKDALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDSLKEKVEYLTMDLEILKHEIEEKGS------DGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKLQKQMEKKNTELESLRQQREKLQEEVKQAEKTVDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDLAAAR----VREAEKRVEAAQETVADYQQTIKKYRELTAHLQDVNRELMSQQEASAE--KQQ-----QPPPEIFDFKIKFAETKAHAKAIEMELRQMEVQQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKADVISKQAQEKFELNENCTARAGLRGAAGEQLSFAAGLVYSLSLLQATLHKYEQALNKCSVEVYKKVGMLYPEMSVHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQAEDCTMQLADHIKFTQSALDCMGVEVCR---LRAFLQAGQEASDLAILLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALGFGQQVSDTLLDCRKHLTWVVAVLQ----EVAAAGAQLIAP---LAENGAAGGEAGGLGLQSQRADLQRSGHQPLRVPAPVLQHPHCHHEQDATAMQEGEYDADRPQSKPTPPAELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADDRVEKIQTKLDETQTLLKKKEKEFEETMDALQADIDQLESEKVELKQRLNNQSKRTIEGLRGAPASGVASIVSGIAGEEQQRGVGAGQAAGGSAGPVQVKDSPLLLQQIEALQLSIRHLKNENNRLKGAQMKLELAGLKPLQV-AKVSLPQSKQGEG------PATLTLYRKSTQLLETLYQMSTNAKVVD 1165          
BLAST of Dynactin 1b vs. TrEMBL
Match: A0A3P9KHY1 (Dynactin 1b OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 2.538e-154
Identity = 384/1221 (31.45%), Postives = 643/1221 (52.66%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD--GDEST-----------------NTSAESKVRPSALRK---PMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEH----------KEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLE----LATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD  GD ++                  T+  +K+R   LRK   P    SR              + +  E          Q   ++   P  H          KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+  +      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  +       +L F   +S  L      L+ +  ++          ++ + +++   +V +  + ++  E+    +          NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S + P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTGDTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTPAPRKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTPLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGSARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALSFGPQVSDALSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFRATEQVYASQG--------ANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLSSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEVQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTDGPPGVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1217          
BLAST of Dynactin 1b vs. TrEMBL
Match: A0A3P9M050 (Dynactin 1b OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 3.116e-154
Identity = 383/1228 (31.19%), Postives = 641/1228 (52.20%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD--GDEST-----------------NTSAESKVRPSALRK---PMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPV-----------------EHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLE----LATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD  GD ++                  T+  +K+R   LRK   P    +R           T              E    E     + P+                   KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+  +      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  +       +L F   +S  L      L+ +  ++          ++ + +++   +V +  + ++  E+    +          NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S + P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTGDTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTPAPRKTTARRPKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTPLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGSARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALSFGPQVSDALSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFRATEQVYASQG--------ANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLSSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEVQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTDGPPGVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1224          
BLAST of Dynactin 1b vs. TrEMBL
Match: A0A3B3H6F4 (Dynactin 1b OS=Oryzias latipes OX=8090 GN=LOC101166919 PE=4 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 4.921e-154
Identity = 395/1223 (32.30%), Postives = 640/1223 (52.33%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN-------------------TSAESKVRPSALRK---PMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEH----------KEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTD-LSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR----NLSSTLPIF----TNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD    T                    T+  +K+R   LRK   P    SR              + +  E          Q   ++   P  H          KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  + +    + LS      V+D LS   K +T     L  V+    A    M S     E    ++       +T  ++     NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S N P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTPAPRKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTPLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAAR----VREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALS--FGPQVSDALSDSRKHLTWVVAVLQEVA----AAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLNSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEAQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTNGPPRVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1217          
BLAST of Dynactin 1b vs. TrEMBL
Match: A0A3P9M0D4 (Dynactin 1b OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 8.883e-154
Identity = 382/1228 (31.11%), Postives = 644/1228 (52.44%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD--GDEST-----------------NTSAESKVRPSALRKPMSIKSRSXXXXXXXX---------------XXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDE-----QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLE----LATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD  GD ++                  T+  +K+R   LRK  + + +                          +  A TP +        +   L  +   P       S +E     QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+  +      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  +       +L F   +S  L      L+ +  ++          ++ + +++   +V +  + ++  E+    +          NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S + P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTGDTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTTARRPKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQT------PLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGSARVREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALSFGPQVSDALSDSRKHLTWVVAVLQEVAAAGAQMMSPLGEQEGLSAVKLEDVAFRATEQVYASQG--------ANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLSSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEVQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTDGPPGVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1218          
BLAST of Dynactin 1b vs. TrEMBL
Match: A0A3B3I0G2 (Dynactin 1b OS=Oryzias latipes OX=8090 GN=LOC101166919 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 9.037e-154
Identity = 394/1230 (32.03%), Postives = 638/1230 (51.87%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN-------------------TSAESKVRPSALRK---PMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPV-----------------EHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTD-LSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR----NLSSTLPIF----TNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD    T                    T+  +K+R   LRK   P    +R           T              E    E     + P+                   KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  + +    + LS      V+D LS   K +T     L  V+    A    M S     E    ++       +T  ++     NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S N P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTPAPRKTTARRPKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTPLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAAR----VREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALS--FGPQVSDALSDSRKHLTWVVAVLQEVA----AAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLNSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEAQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTNGPPRVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1224          
BLAST of Dynactin 1b vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 447.973 bits (1151), Expect = 1.958e-136
Identity = 356/1084 (32.84%), Postives = 582/1084 (53.69%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV-RPSALRKP---------MSIKSRSXXXXXXXXXXTEN---AVTP------KEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLV-------DLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVT---------DLSAITKIITSYCLEL-ATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVD------------SGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP 3154
            +GTV +IGTT FASG W GV L+ PKGKNDG+V GK YF C +NHGIFVR +Q+  V DG ++T+      A +KV R   L  P         + +K  S        + +E    A TP         V  LP      +      P   KE  +   QV+DL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK K +E++++ E+LK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+        KLQ ++EK   E D L V       ++K A+++I ELKEQVD+ALGA++MV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++     +++E  K + A  E + DY+ TI+K+R+L   LQ   ++L  Q +  +E          E+ +E++  K K  ETK  A  IE EL+K++V+QS+  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+       G+  +  +  ++   LIY LS     L  Y+  L+ C +  + R+GSL+ EMS +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +  DC +++ D +K      D +         F+     E   S   L  L     D++   + IR+ +  + +    + L+     C T          ++A+ + + +   +L A + + +   ++ +  + +K  E+    + ++    +  +   ++     ++ +M+ GEYD E        P+ + A+  + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T+A L +KEKE ++T +ALQ+DI+ LE ++ EL++++    K           S IA  V             +G  Q I + L   +I+  R  I  L+N+N  L+++        L PL++P
Sbjct:   24 RGTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLVEDGADTTSPDTPEPATAKVPRREILEAPKTNKVTRAGVGVKVGSGSASAGEMSSSEPSTPAQTPLAAPVIPSPVGALPSPGAPPI------PAPSKEEEALRAQVQDLEEKLETLRMKRAEDKAKLKELEKHKIQLEQLQEWKTKMQEQQNELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHL-------KLQKQMEKKNFELDVLRVQKEKGQEEMKLAEKTIDELKEQVDAALGAEQMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQ--------EQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSV-LLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALNFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEKPQCGI-APVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQTVLDETQALLKKKEKEFEETMDALQADIDQLEAEKTELRQRINSQSKMTIEGLRGSPGSGIASIVTGGIANGAVGVCAAGGVQVIDSPLLTQQIEAQRLSIKRLKNENNLLKAEKMRAQLASLPPLNVP 1078          
BLAST of Dynactin 1b vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 447.588 bits (1150), Expect = 2.886e-136
Identity = 356/1088 (32.72%), Postives = 585/1088 (53.77%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV-RPSALRKP---------MSIKSRSXXXXXXXXXXTEN---AVTP------KEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLV-------DLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVT---------DLSAITKIITSYCLEL-ATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNF--------FDNINISTSKIADQ--------VDSGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP 3154
            +GTV +IGTT FASG W GV L+ PKGKNDG+V GK YF C +NHGIFVR +Q+  V DG ++T+      A +KV R   L  P         + +K  S        + +E    A TP         V  LP      +      P   KE  +   QV+DL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK K +E++++ E+LK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+        KLQ ++EK   E D L V       ++K A+++I ELKEQVD+ALGA++MV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++     +++E  K + A  E + DY+ TI+K+R+L   LQ   ++L  Q +  +E          E+ +E++  K K  ETK  A  IE EL+K++V+QS+  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+       G+  +  +  ++   LIY LS     L  Y+  L+ C +  + R+GSL+ EMS +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +  DC +++ D +K      D +         F+     E   S   L  L     D++   + IR+ +  + +    + L+     C T          ++A+ + + +   +L A + + +   ++ +  + +K  E+    + ++    +  +   ++     ++ +M+ GEYD E        P+ + A+  + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T+A L +KEKE ++T +ALQ+DI+ LE ++ EL++++    K               +I T  IA++          +G  Q I + L   +I+  R  I  L+N+N  L+++        L PL++P
Sbjct:   24 RGTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLVEDGADTTSPDTPEPATAKVPRREILEAPKTNKVTRAGVGVKVGSGSASAGEMSSSEPSTPAQTPLAAPVIPSPVGALPSPGAPPI------PAPSKEEEALRAQVQDLEEKLETLRMKRAEDKAKLKELEKHKIQLEQLQEWKTKMQEQQNELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHL-------KLQKQMEKKNFELDVLRVQKEKGQEEMKLAEKTIDELKEQVDAALGAEQMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQ--------EQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSV-LLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALNFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEKPQCGI-APVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQTVLDETQALLKKKEKEFEETMDALQADIDQLEAEKTELRQRINSQSKMTIEGLRGSPGSGIASIVTGGIANEEQKGAVGVCAAGGVQVIDSPLLTQQIEAQRLSIKRLKNENNLLKAEKMRAQLASLPPLNVP 1082          
BLAST of Dynactin 1b vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 444.891 bits (1143), Expect = 7.673e-136
Identity = 343/1064 (32.24%), Postives = 571/1064 (53.67%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLV-------DLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEI--YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLE----LATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNF--------FDNINISTSKIADQ--------VDSGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP 3154
            +GTV +IGTT FASG W GV L+ PKGKNDG+V GK YF C +NHGIFVR +Q+  V  ++  +T++     P+                         A  P+ E+          LE  +   VE +   +   QV+DL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK K +E++++ E+LK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+        KLQ ++EK   E D L V       ++K A+++I ELKEQVD+ALGA++MV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++     +++E  K + A  E + DY+ TI+K+R+L   LQ   ++L  Q +  +E          E+ +E+  +K K  ETK  A  IE EL+K++V+QS+  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+       G+  +  +  ++   LIY LS     L  Y+  L+ C +  + R+GSL+ EMS +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +  DC +++ D +K      D +         F+     E   S   L  L     D++   + IR+ +  +       +L F   +   L +    L+ +  ++          +A + + +   ++ +  + +K  E+    + ++    +  +   ++     ++ +M+ GEYD E        P+ + A+  + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T+A L +KEKE ++T +ALQ+DI+ LE ++ EL++++    K               +I T  IA++          +G  Q I + L   +I+  R  I  L+N+N  L+++        L PL++P
Sbjct:   24 RGTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLV--EDGADTTSPDTPEPA------------------------TAKVPRREI----------LEAPKTNKVEEEALRA---QVQDLEEKLETLRMKRAEDKAKLKELEKHKIQLEQLQEWKTKMQEQQNELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHL-------KLQKQMEKKNFELDVLRVQKEKGQEEMKLAEKTIDELKEQVDAALGAEQMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQ--------EQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSV-LLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALNFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEKPQCGI-APVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQTVLDETQALLKKKEKEFEETMDALQADIDQLEAEKTELRQRINSQSKMTIEGLRGSPGSGIASIVTGGIANEEQKGAVGVCAAGGVQVIDSPLLTQQIEAQRLSIKRLKNENNLLKAEKMRAQLASLPPLNVP 1025          
BLAST of Dynactin 1b vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 446.817 bits (1148), Expect = 1.391e-135
Identity = 356/1088 (32.72%), Postives = 585/1088 (53.77%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV-RPSALRKP---------MSIKSRSXXXXXXXXXXTEN---AVTP------KEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLV-------DLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVT---------DLSAITKIITSYCLEL-ATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNF--------FDNINISTSKIADQ--------VDSGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP 3154
            +GTV +IGTT FASG W GV L+ PKGKNDG+V GK YF C +NHGIFVR +Q+  V DG ++T+      A +KV R   L  P         + +K  S        + +E    A TP         V  LP      +      P   KE  +   QV+DL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK K +E++++ E+LK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+        KLQ ++EK   E D L V       ++K A+++I ELKEQVD+ALGA++MV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++     +++E  K + A  E + DY+ TI+K+R+L   LQ   ++L  Q +  +E          E+ +E++  K K  ETK  A  IE EL+K++V+QS+  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+       G+  +  +  ++   LIY LS     L  Y+  L+ C +  + R+GSL+ EMS +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +  DC +++ D +K      D +         F+     E   S   L  L     D++   + IR+ +  + +    + L+     C T          ++A+ + + +   +L A + + +   ++ +  + +K  E+    + ++    +  +   ++     ++ +M+ GEYD E        P+ + A+  + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T+A L +KEKE ++T +ALQ+DI+ LE ++ EL++++    K               +I T  IA++          +G  Q I + L   +I+  R  I  L+N+N  L+++        L PL++P
Sbjct:   43 RGTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLVEDGADTTSPDTPEPATAKVPRREILEAPKTNKVTRAGVGVKVGSGSASAGEMSSSEPSTPAQTPLAAPVIPSPVGALPSPGAPPI------PAPSKEEEALRAQVQDLEEKLETLRMKRAEDKAKLKELEKHKIQLEQLQEWKTKMQEQQNELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHL-------KLQKQMEKKNFELDVLRVQKEKGQEEMKLAEKTIDELKEQVDAALGAEQMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQ--------EQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSV-LLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALNFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEKPQCGI-APVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQTVLDETQALLKKKEKEFEETMDALQADIDQLEAEKTELRQRINSQSKMTIEGLRGSPGSGIASIVTGGIANEEQKGAVGVCAAGGVQVIDSPLLTQQIEAQRLSIKRLKNENNLLKAEKMRAQLASLPPLNVP 1101          
BLAST of Dynactin 1b vs. Ensembl Cavefish
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:103040401])

HSP 1 Score: 442.58 bits (1137), Expect = 2.195e-134
Identity = 355/1089 (32.60%), Postives = 588/1089 (53.99%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV-DGDESTNT----SAESKV-RPSALRKP---------MSIKSRSXXXXXXXXXXTEN---AVTP------KEEVQDLPEKIFQELEI-SQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLV-------DLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVT---------DLSAITKIITSYCLEL-ATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNF--------FDNINISTSKIADQ--------VDSGSSQEISAFL--SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP 3154
            +GTV +IGTT FASG W GV L+ PKGKNDG+V GK YF C +NHGIFVR +Q+  V DG ++T+      A +KV R   L  P         + +K  S        + +E    A TP         V  LP      +   S+   ++ +E  +   QV+DL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+  E Q+ L + K++  + +E  + Y EE    AD IEM T+DKEMAEE+ ES + E D LK K +E++++ E+LK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+        KLQ ++EK   E D L V       ++K A+++I ELKEQVD+ALGA++MV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++     +++E  K + A  E + DY+ TI+K+R+L   LQ   ++L  Q +  +E          E+ +E++  K K  ETK  A  IE EL+K++V+QS+  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F L+       G+  +  +  ++   LIY LS     L  Y+  L+ C +  + R+GSL+ EMS +E+S+D+LIDLL K  LDE  ++EPL ++I Y+Q  Y +HL  +  DC +++ D +K      D +         F+     E   S   L  L     D++   + IR+ +  + +    + L+     C T          ++A+ + + +   +L A + + +   ++ +  + +K  E+    + ++    +  +   ++     ++ +M+ GEYD E        P+ + A+  + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++  L++T+A L +KEKE ++T +ALQ+DI+ LE ++ EL++++    K               +I T  IA++          +G  Q I + L   +I+  R  I  L+N+N  L+++        L PL++P
Sbjct:   24 RGTVAYIGTTLFASGKWVGVILEEPKGKNDGTVQGKRYFTCLENHGIFVRQSQIQLVEDGADTTSPDTPEPATAKVPRREILEAPKTNKVTRAGVGVKVGSGSASAGEMSSSEPSTPAQTPLAAPVIPSPVGALPSPGAPPIPAPSKCDSMDTQEEEALRAQVQDLEEKLETLRMKRAEDKAKLKELEKHKIQLEQLQEWKTKMQEQQNELQKQLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQLEADALKEKVDELTMDLELLKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSASEKQEHL-------KLQKQMEKKNFELDVLRVQKEKGQEEMKLAEKTIDELKEQVDAALGAEQMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREQLDLSAASVREAEKRVEAAQETVADYQHTIQKYRELTAHLQEANRELMSQQEATAEPQ--------EQPAEMFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVALLTSFMPESFLRHGGDHDGILVLLLIPRLICKAELISKQAQEKFDLTENCSQRPGMRGSTGEQLSFSAGLIYSLSLLQATLHKYEHALNQCSVDVYKRVGSLYSEMSVHERSLDFLIDLLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQSEDCTMQLADHIKFTQSALDCMAVEVGRLRAFLQAGQDETQLSV-LLKDLDTSCSDIRQFCKKIRRRMPGTDAPGIPAALNFGPQVCETLAESRRQLAWVNAVLQEVAAAGAQLIAPLGEHEGLPTLKLEDMAFKAAEQIYGSQGINPYECLRQSCSVVIATMNKMATAMQEGEYDSEKPQCGI-APVNVRASALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQTVLDETQALLKKKEKEFEETMDALQADIDQLEAEKTELRQRINSQSKMTIEGLRGSPGSGIASIVTGGIANEEQKGAVGVCAAGGVQVIDSPLLTQQIEAQRLSIKRLKNENNLLKAEKMRAQLASLPPLNVP 1089          
BLAST of Dynactin 1b vs. Ensembl Sea Lamprey
Match: dctn1a (dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205])

HSP 1 Score: 400.979 bits (1029), Expect = 2.939e-119
Identity = 317/992 (31.96%), Postives = 546/992 (55.04%), Query Frame = 2
Query:  491 QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLK---------SP----SLQFNSGLSTNLDKCVTDLSAIT----KIITSYCLELATVSDEDDAKSVNMSSL-YKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIA--------DQVDSGSS--------------QEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP-------ISLNTPNANRNSS-LIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHPEK 3316
            QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +Q++ A+ Q+ L + K++  ++IE  + Y EE   ++D IEM T+DKEMAEEK ES + E++ LK K EE+S++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E  K  K + K  SEL+    ++++L  +L+ A+  I ELKEQVD+ALGA++MV  LTE+NL LEE V+ L E  N+LE + DMN+E+ E       +L+ ++   +  ++E  K + A  E + DY+ T++K+R L   L++  ++L  Q + ++E    + Q A       +K K  ETK  A  I+ +L+K++V Q++ HV ++  F+PD F + G D+D ++++LL+ +LI K E ++ Q +E++ L+      + +     +  ++   L+Y LS    IL  Y+  LS C + T+ ++GSL+ EMS +E+S+D+LI+LLR   LDE  ++EPL ++I Y+Q  Y +HL  +  DC I++ D +++     D +         F+ +   +   ++  L++      DL+++T ++R+   K         +P    +L +   ++  L  C   LS +     +I       +A +++ +   S  +  L +K  E+    +NLS    I  +   ++     ++ +M+ GEYD E    K   P+ + A   K E+ D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL    K+ DE +E+++ KL+   A L +KEKE ++T +ALQ+DI+ LE ++ ELK++L    +R+        TS IA        D  D G+S              ++    L +I+ L+  + +L+N+N RL+++        L PL IP       ++  T   NR ++ L++ +++  +T                  +++D+S R PEK
Sbjct:  228 QVKDLDEKLETLKVKRNEDKVKLKELEKYKIQMEQLQEWKSRMQDQQADLQKQLKEAKREAKEVIEAKERYMEEMADVSDAIEMATLDKEMAEEKSESLQQEVENLKEKVEELSMDLEILKHEIEEKGS------DGAASSYHVKQLEEQNARLKEALVRMRDLSTSEKQEYLKQQKHMEKKNSELDTLRTQKEKLQAELQQAEGIIDELKEQVDAALGAEDMVETLTERNLNLEERVRELMENVNDLEAINDMNDELQENCRETELELREQLDMANARVREGEKRVDAAQEMVADYQQTMQKYRQLTAHLEDVNRELMSQQEASAE----REQTAPPPEMFDFKIKFAETKAHAKAIDMDLRKMEVQQANRHVSLMTSFMPDSFLRRGGDHDCLLVLLLVPRLICKAELISKQAQEKYELNEEAMKSANLRGAQGEQLSFTGGLVYSLSLLQTILHKYETALSQCSVETYVKVGSLYPEMSVHERSLDFLIELLRNDRLDETVNVEPLTKAIKYYQHLYSIHLSEKAEDCTIQLADHIRVSQSALDCMAVEVGRLRSFLQQQTGQEGSNFALLLK------DLETSTSDVRQFCKKVRRRMPGTDAPGIPTALSYGPQVAEGLLDCRKHLSWVVASLQEIAAVSAQMIAPLTENEGLNSARLEELAFKASEQIYAGQNLSPYECIRQSCNVVIVTMNKLATAMQEGEYDAEKHQNKPANPVELRAVALKAEIMDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQTKLDDITAFLKKKEKEFEETMDALQADIDQLESEKVELKQRLANMPRRSVEGLRGAQTSGIASIVTGIATDDEDEGASPTQGMGGGSGPVQVKDSPLLLHQIEALKMALKHLKNENNRLKAEKMKSDLASLPPLRIPKAGEEGMVADPTLALNRKTNQLLESLQHMCVT-----------------ARVVDISHRKPEK 1186          

HSP 2 Score: 94.7449 bits (234), Expect = 9.100e-20
Identity = 42/87 (48.28%), Postives = 56/87 (64.37%), Query Frame = 2
Query:   62 VLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD--GDESTNTSAESKVRPSALRK 316
            V+  G + GTV ++G T FA+G W GV LD  KGKNDG+V GK YF C+ NHGIFVR +Q+  V+  GD ++  S E    P+ + K
Sbjct:   33 VIGKGQI-GTVAYVGATMFATGKWVGVILDEAKGKNDGTVQGKRYFTCEDNHGIFVRQSQIQLVEDGGDTTSPESPEPAAAPAKIPK 118          
BLAST of Dynactin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006027.1 (pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 gene:ENSPMAG00000005440.1 transcript:ENSPMAT00000006027.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 5.614e-18
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:   41 DFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMS 325
            + KI D VL +GT  G V F+G   FA G W GV+LD P GKNDGSVAG  YF+C   +G+F    ++ ++    +T   A++       R+ +S
Sbjct:  235 ELKIGDRVLVSGTKAGVVRFLGEADFAKGEWCGVELDEPLGKNDGSVAGTRYFQCQPKYGLFAPTHKVTRIGFPSTTPAKAKAGGAVPGTRRTVS 329          

HSP 2 Score: 65.0846 bits (157), Expect = 1.111e-10
Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 2
Query:  131 WYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGD 262
            W G++L+ P GKNDGSVAG  YF+C   HG+F R ++LA   G+
Sbjct:   89 WAGIELEEPVGKNDGSVAGVRYFQCRPLHGVFTRPSKLAPTAGE 132          
BLAST of Dynactin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006020.1 (pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 gene:ENSPMAG00000005440.1 transcript:ENSPMAT00000006020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.434e-17
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query:   41 DFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAES 289
            + KI D VL +GT  G V F+G   FA G W GV+LD P GKNDGSVAG  YF+C   +G+F    ++ ++    +T   A++
Sbjct:  231 ELKIGDRVLVSGTKAGVVRFLGEADFAKGEWCGVELDEPLGKNDGSVAGTRYFQCQPKYGLFAPTHKVTRIGFPSTTPAKAKA 313          

HSP 2 Score: 68.9366 bits (167), Expect = 7.250e-12
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 2
Query:   32 EMSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGD 262
            E   F+++  V + G         G T  A   W G++L+ P GKNDGSVAG  YF+C   HG+F R ++LA   G+
Sbjct:   60 EAVQFRLDGPVFFWG--------YGLTSHAVNEWAGIELEEPVGKNDGSVAGVRYFQCRPLHGVFTRPSKLAPTAGE 128          
BLAST of Dynactin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004647.1 (pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 gene:ENSPMAG00000004232.1 transcript:ENSPMAT00000004647.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 2.527e-17
Identity = 40/86 (46.51%), Postives = 54/86 (62.79%), Query Frame = 2
Query:   41 DFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVR 298
            D K+ D VL  GT  G V F+G T FA G W GV+LD P GKNDG+VAG  YF+C + +G+F    ++AK+      +TSA  K++
Sbjct:  190 DLKMGDRVLVGGTKAGVVRFVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQQRYGLFAPIHKVAKIG---FPSTSARRKMK 272          

HSP 2 Score: 77.0258 bits (188), Expect = 7.819e-15
Identity = 31/70 (44.29%), Postives = 45/70 (64.29%), Query Frame = 2
Query:   41 DFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAK 250
            DF I + V  NG+  G ++++G T FA G W G+ LD   GKNDG+V+G  YF C+   GIF R ++L++
Sbjct:   27 DFIIGERVWVNGSKPGHIQYLGETQFAPGQWAGIVLDEATGKNDGAVSGVRYFMCEAGRGIFTRPSKLSR 96          
BLAST of Dynactin 1b vs. Ensembl Sea Lamprey
Match: si:dkeyp-47f9.4 (si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9])

HSP 1 Score: 80.1073 bits (196), Expect = 1.820e-15
Identity = 30/72 (41.67%), Postives = 49/72 (68.06%), Query Frame = 2
Query:   38 SDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            ++ ++ + +L +G   G + F GTTHFA G WYG++L+ P G+NDGSVAG  YF+C   HG+F   +++ ++
Sbjct:  435 AELELGERLLVSGQRAGVLRFQGTTHFAPGHWYGIELEQPSGRNDGSVAGVRYFQCPAKHGVFAPPSRVQRL 506          

HSP 2 Score: 67.0106 bits (162), Expect = 1.872e-11
Identity = 28/63 (44.44%), Postives = 41/63 (65.08%), Query Frame = 2
Query:   62 VLYNGTLK-GTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLA 247
            VL  GT + GTV F+G   FA+G W G++L +P+GK+DG+V G  YF C    G+ VR  +++
Sbjct:  581 VLVAGTGEMGTVRFVGEVGFAAGTWLGLELRAPRGKHDGAVGGHRYFSCRPGCGVMVRPGRVS 643          

HSP 3 Score: 63.1586 bits (152), Expect = 3.516e-10
Identity = 28/72 (38.89%), Postives = 38/72 (52.78%), Query Frame = 2
Query:   41 DFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD 256
               +   V+  G   G + F G T FA   W GV+LD   GKN+GSV G  YF C   HGIF   +++A+ +
Sbjct:  233 GLTVGQRVIVGGRKTGVLRFCGPTEFAGDQWAGVELDEADGKNNGSVDGTRYFTCAPRHGIFAPLSKVARAE 304          
BLAST of Dynactin 1b vs. Ensembl Yeast
Match: NIP100 (Large subunit of the dynactin complex; dynactin is involved in partitioning the mitotic spindle between mother and daughter cells; putative ortholog of mammalian p150(glued) [Source:SGD;Acc:S000006095])

HSP 1 Score: 75.485 bits (184), Expect = 3.644e-14
Identity = 38/89 (42.70%), Postives = 48/89 (53.93%), Query Frame = 2
Query:   35 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCD--------KNHGIFVR--NTQLAKVDGDEST 271
            M    + D VL N  +KG V+FIG T FA G+WYG++LD P GKNDGS  G  YF  D          +G+F +    Q  K D DE +
Sbjct:   12 MQKISLQDTVLVN-EMKGRVKFIGETQFAKGIWYGIELDKPLGKNDGSANGIRYFDIDLKKANSNGGYYGLFCKKDTLQFYKPDDDEHS 99          
BLAST of Dynactin 1b vs. Ensembl Nematostella
Match: EDO49101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGS4])

HSP 1 Score: 423.32 bits (1087), Expect = 1.332e-128
Identity = 346/1130 (30.62%), Postives = 600/1130 (53.10%), Query Frame = 2
Query:   80 LKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDEST-----NTSAESKVRPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQ---ELEISQEKPVEHKEFVSNDEQ---VKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQ-QTDNNSELSKNQHQIAVEKSSEI--YKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDA----IEYCSKYAIEFMVKHNMEASESYEFLVR-LQQFGLDLKSNTRNIRKHLLKSPS--LQFNSGLSTNLDKCVTDLSAITK----IITSYCLELATVSDEDDAKSVNMSSLYKYIEKFM-EIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNI---NISTSKIADQV------------DSGSSQEI--------SAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAV--KIIDLSIRHPEK 3316
            L GTV ++G T FA+G W GV LD  KGKNDG+V GK YF C+  +GIFVR +Q+  +D + ST     NT       P+ LRK    K  S       +  T     P      LPE        L  +   P+E K  V  + +   + DL  KL+TL+ KR EDK K+K+ EK +M+++Q+ E K   QE   + Q  L   K++  ++++  D+  E+ T L + +EM T+DKEMAEE+LE    E + LK + EE++L+ EIL+ E S G      +     AQ   L+ QNT+L++AI+  +++  + K + +   K++  L S       ++D+L+ + +  + ++ ELKEQVD+ALGA+EMV  LT+KNL LEE V++L +  ++LE L D+N E+ ET++    DL+ E+      ++E  +      + I D + TIEKFRDLV  LQ   +++++ Q D+   L      I +  + +I  +K K  E K++A  ++NE++K  V Q++ H++ML  FLPD F + G DNDSI+++LLI +L FK E L +Q+++++ L+        +  +  +  ++   ++Y L+T   ++RH+++ +S C  + F++L  ++ E++ +EK+VD LIDLL+   LD+   +EPLE++I+Y+ T  + HL N+P  C   +ND + ++   +D     +E    YA       N +   ++  LV  ++   ++++   + I++ + +     L F   +  +L +CV     + K    +++    + AT+ D +   S  +  +   +   + E  ++S+          ++   A  +  M+ GEYD +     T+ P +  +  FK+EL D      KL  K+  +R+ K  LKLK +E+S+ ++R+ ++EK+L    KE D  +E   +K+EQ    L +K+KE + T + LQ+DI+ LE ++E++KK+L    KR    ++     ++S IA  V             +G+ Q+            L+++++L+  + +L+N+NIRL+S        +L  + +P ++      R+ +L    E  N +  + E LT        +V  K++D+S R P K
Sbjct:    4 LIGTVAYVGATQFATGKWIGVVLDEKKGKNDGTVQGKEYFSCEDGYGIFVRQSQIIVLDSNTSTPQQPGNTGIPKPGIPT-LRKE---KVSSPPTSRIQSPKTSTVSQPTPRGTSLPEPKVTGRTSLPTASTPPIETKPAVHAERKPSVIVDLEGKLETLKAKRLEDKHKMKDLEKARMQLEQMIEYKSKWQEAQRDLQNQLTAAKKELKEVLQSKDS--EDLTELQEAVEMATLDKEMAEERLEGMMQENEQLKERVEELTLDLEILRSEISEGG----VEGAAANAQVKQLEQQNTRLKEAIVRFKEIQMSDKQQLQSLQKQVKDLHSANTSLQADKDQLMEEAEQLESTLAELKEQVDTALGAEEMVETLTDKNLELEEEVQTLRDTVSDLEALRDLNEELEETHLQTEQDLREELDMTSNKVREAERKYEQAQDSIGDLQQTIEKFRDLVAKLQESNREIQEKQEDSEKRL------IDLPPTPDIMDFKVKSAEIKSLAKSVDNEMRKFQVQQANEHIKMLNSFLPDAFLRRGGDNDSILLLLLIPRLDFKTELLIDQLRQKYELADCLDDVRLITGHKAEGLSFSSMVMYNLATLQAVVRHFRRAVSKCDPALFNKLVGIYPELAAHEKAVDKLIDLLKADQLDDTVGMEPLEKAIHYYSTMARFHLGNDPISCTEFLNDQLNVLNVAADGMTVEVERLKGYA-----SGNCDNGSTFMQLVSDMELRNVEVRQLCKKIKRRMPQDDKSILSFAEKVQVSLVECVQQQGLLLKFCQDLVSVAAQKAATLPDNEHLLSGQLEEMAMDVAVLVYEKEDVSAYKACSETFHEVMSFLAGFAIKMQEGEYDAQPPEQDTKPPYLERSKAFKSELFDTAGVEEKLLQKESNVREIKKTLKLKSEEVSQANIRIGLLEKRLENASKEADARVEAANKKMEQAMEELQKKKKEYEDTMDELQADIDTLEKEKEDMKKRLDAYSKRTLLADLARHTSASSGIAAVVAGNPLKGGSPLRAAGAGQQPVQVVIKDSPIILAQVESLKIALRHLKNENIRLKSHRLKSKLSELPEIFVPPTIGP----RHEAL----EQQNDSPDTKETLTLATKLQRMSVTQKVVDISGRKPGK 1104          
BLAST of Dynactin 1b vs. Ensembl Nematostella
Match: EDO33600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR5])

HSP 1 Score: 84.7297 bits (208), Expect = 2.325e-17
Identity = 35/71 (49.30%), Postives = 47/71 (66.20%), Query Frame = 2
Query:   44 FKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD 256
            F++ D VL N T  G + F+G T FA G W G+ LD P GKNDGSVAG+ YF+C   HG+F +  ++ KV+
Sbjct:    7 FQVGDRVLVNNTKPGVIAFLGETKFAKGDWAGIILDDPTGKNDGSVAGEKYFECKPLHGVFTKLEKITKVN 77          

HSP 2 Score: 80.4925 bits (197), Expect = 5.762e-16
Identity = 35/78 (44.87%), Postives = 50/78 (64.10%), Query Frame = 2
Query:   38 SDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDEST 271
            S  +I D V+ +G   GT+ ++GTT FA G W GV+LD P GKNDG+VAG  YF+C + +G+F    ++ K    E+T
Sbjct:   91 SSLEIGDRVVVSGNKIGTLRYVGTTEFAKGEWAGVELDEPLGKNDGAVAGTRYFQCIQGYGLFAPVHKVIKTGKKETT 168          
BLAST of Dynactin 1b vs. Ensembl Nematostella
Match: EDO43343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ45])

HSP 1 Score: 84.3445 bits (207), Expect = 7.378e-17
Identity = 40/96 (41.67%), Postives = 57/96 (59.38%), Query Frame = 2
Query:   32 EMSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKP 319
            + ++  I + V   GT  G + F G T FASG W GV+LD P GKNDGSV G  YF+C+ NHGIF   +++ +     +  T   S+++P A R+P
Sbjct:  224 DANELTIGERVYIGGTKSGVLRFCGRTEFASGEWVGVELDQPVGKNDGSVDGVQYFQCEPNHGIFAPASKVTR-----NGTTQHISRLKPRASRRP 314          

HSP 2 Score: 77.7962 bits (190), Expect = 7.379e-15
Identity = 34/70 (48.57%), Postives = 43/70 (61.43%), Query Frame = 2
Query:   41 DFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAK 250
            DF+I + VL  G   G V+FIG T FASG W G++L +P GKNDGSV G  YF C    G+F    ++ K
Sbjct:  358 DFQIGEHVLVAGQKPGIVQFIGQTQFASGWWLGIELSNPVGKNDGSVGGVRYFTCKPRFGVFAPVAKVTK 427          
BLAST of Dynactin 1b vs. Ensembl Nematostella
Match: EDO40244 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7S7])

HSP 1 Score: 72.7886 bits (177), Expect = 5.253e-14
Identity = 30/50 (60.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query:   83 KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVR 232
            +G V F+GTT F  G W G+K D P GKNDGSVAGK YF+C   +G FVR
Sbjct:  175 RGEVMFVGTTDFKPGYWVGIKYDEPLGKNDGSVAGKRYFQCPPKYGGFVR 224          
BLAST of Dynactin 1b vs. Ensembl Nematostella
Match: EDO44433 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVR2])

HSP 1 Score: 75.485 bits (184), Expect = 1.356e-13
Identity = 30/58 (51.72%), Postives = 38/58 (65.52%), Query Frame = 2
Query:   59 IVLYNGTLK-GTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFV 229
            + + N  L+ G + F GTTHF+ G W G+ LD   GKNDGSV G  YF C ++HGIFV
Sbjct:  207 VCVLNKRLRTGVLRFTGTTHFSPGEWCGIVLDDACGKNDGSVKGVRYFDCKQDHGIFV 264          
BLAST of Dynactin 1b vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 506.138 bits (1302), Expect = 1.852e-157
Identity = 395/1223 (32.30%), Postives = 640/1223 (52.33%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN-------------------TSAESKVRPSALRK---PMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEH----------KEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTD-LSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR----NLSSTLPIF----TNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD    T                    T+  +K+R   LRK   P    SR              + +  E          Q   ++   P  H          KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  + +    + LS      V+D LS   K +T     L  V+    A    M S     E    ++       +T  ++     NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S N P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTPAPRKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTPLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAAR----VREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALS--FGPQVSDALSDSRKHLTWVVAVLQEVA----AAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLNSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEAQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTNGPPRVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1217          
BLAST of Dynactin 1b vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 505.753 bits (1301), Expect = 3.402e-157
Identity = 394/1230 (32.03%), Postives = 638/1230 (51.87%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN-------------------TSAESKVRPSALRK---PMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPV-----------------EHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTD-LSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR----NLSSTLPIF----TNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD    T                    T+  +K+R   LRK   P    +R           T              E    E     + P+                   KE  +   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  + +    + LS      V+D LS   K +T     L  V+    A    M S     E    ++       +T  ++     NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S N P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTPAPRKTTARRPKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTPLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAAR----VREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALS--FGPQVSDALSDSRKHLTWVVAVLQEVA----AAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLNSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEAQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTNGPPRVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1224          
BLAST of Dynactin 1b vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 504.212 bits (1297), Expect = 9.306e-157
Identity = 393/1230 (31.95%), Postives = 641/1230 (52.11%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN-------------------TSAESKVRPSALRKPMSIKSRSXXXXXXXX---------------XXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDE-----QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTD-LSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR----NLSSTLPIF----TNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFL---------SEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIP--ISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHP--EKEYLNELSAKTR-IKLQFEKLRKEKTDFINEDNLFSKIDN-----ASCPLFKSKDQNLNDYI 3481
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD    T                    T+  +K+R   LRK  + + +                          +  A TP +        +   L  +   P       S +E     QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  + +    + LS      V+D LS   K +T     L  V+    A    M S     E    ++       +T  ++     NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE ++ ELK++L    K +        T  ++  + +     +SA L          +I+  R  I  L+NDN RL+++        L PL +P   S N P    + +L +K          +E L   +    + VK++D++ + P      L E +A+ R ++   E+L+ E  + +      +++ +      S P  K+K++   D +
Sbjct:   29 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVDDTADTTSPDTPEPSSSRVLKKEILETTKSAKLRGVKLRKTTARRPKQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQT------PLVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAAR----VREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALS--FGPQVSDALSDSRKHLTWVVAVLQEVA----AAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLESEKAELKQRLNSQSKMSTDLGGGGPTGAVSMVMGTAGGSPVSAGLQVIDSPLLTQQIEAQRLCIKQLKNDNNRLKAEKIRAQLASLPPLHVPKLPSTNGPPRVLSGALYRK----------TEQLLETLLQMSANVKVVDVTGKCPVSPAAQLLEQTARLRSLRETLERLKDEVAEHVVSQQPGARVPSDFATFPSPPFVKAKEERGGDTV 1218          
BLAST of Dynactin 1b vs. Ensembl Medaka
Match: dctn1a (dynactin subunit 1 [Source:NCBI gene;Acc:101162870])

HSP 1 Score: 497.664 bits (1280), Expect = 8.189e-153
Identity = 371/1110 (33.42%), Postives = 596/1110 (53.69%), Query Frame = 2
Query:   47 KINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVD-GDESTNT-SAESKVRPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPV---------------EHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIY--KSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGL---DLKSNTRNIRKHLLKS------PSLQFNSGLSTNLDKCVTDLSAITKIITSYCLE----LATVSDEDDAKSVNMSSLY-KYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDS----------GSSQEISAFL--SEIQTLRTIIHNLRNDNIRL-----RSQITSKHAQKLKPLSI--------PISLNTPNANRNSSLI 3199
            KI  +V   G   +GTV +IGTT FASG W GV LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD G  ST+  + ES +     +K M+   ++                      DL E      + +   PV                 KE  S   QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE Q+ L + K+D  +  E  D Y EE    AD IEM T+DKEMAEE+ ES + E+D LK K EE+S++ E+L+ E S        D      Q   L+ QN +L++A++ MRDL+ + K E+ K  K++ K  +ELE    ++++L  +LK A+ +I ELKEQVD+ALG++EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E       +L+ ++      ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q   N+E    Q Q   + ++E++  K K  ETK  A  IE EL+K++V+Q++ HV +L  F+PD F + G D+D I+++LLI +LI K + ++ Q +E+F L+      SG+     +  ++   L+Y LS     L  Y++ L++C +  F R+G+L+ EMS +E+++DY IDLL K  LDE    EPL ++I Y+Q  Y VHL ++  DC +++ D +K +    D    C    +  +        ES    V L+       D++   + IR+ +  +       +L + + +S  L +C   L+    ++          +A++ +++   ++ +  +  K +EK    +++     +  +   ++     +S +M+ GEYD E    +   P+ + A+  + E++D E    KLE ++  +++ K +LK+K +ELSE +VRL+++EKKL  + K+ D+ +E+++ KL++  A L +KEKE ++T +ALQ+DI+ LE ++ ELK ++    K          TS IA  V            G+ Q + + L   +++  R  I  L+N+N RL     R+Q+ S        L +        P+ LNT    R   L+
Sbjct:   34 KIGSVVEVTGKGQRGTVAYIGTTLFASGKWVGVILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQVVDEGSGSTSPETPESTLAKILKQKEMAETPKTTKQTPANLKKASRESLSSSHSGDLSEASLHSQQGALGAPVVPQPSGSPAAAAPATPSKEEESLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQKQLKEAKKDAREAQEAKDRYMEEMADTADAIEMATLDKEMAEERAESLQVEVDTLKEKVEELSMDLELLRHEISEKGS----DGAASSYQVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNAELETLRTQKEKLQEELKQAEATIDELKEQVDAALGSEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETEMELREQVDLSGAKVREAEKKVEAAQETVADYQHTINKYRELTASLQGANRELVSQQSANAE----QFQ---QPTAELFDFKIKFAETKAYAKAIEMELRKMEVAQANRHVSLLTSFMPDSFLRHGGDHDCILVLLLIPRLICKADLISKQAQEKFDLNGTPVQGSGLRGPPGEQRSFASGLVYSLSLLQATLHRYEQALNTCSVDVFKRMGTLYSEMSFHERALDYFIDLLHKDQLDETVQGEPLTKAIKYYQQLYSVHLADQSEDCTVQLADHIKFLQSALD----CMGVEVARLRAFLAAGQESSGLAVLLKDLDTSCSDIRQFCKKIRRRMPGTDVAGVPAALSYGAQVSETLTECRRQLTCAVAVLQEVAATGAQLVASLGEQEGLNALKLEDIVCKAVEKVGSSQSVKGPEFLRQSCSAVIATMNKMSTAMQEGEYDAEKPQGQA-PPVEVRASTVRAEMTDAEGLGVKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDTSTKDADDRVEKIQTKLDENLALLKKKEKEFEETMDALQADIDQLEAEKAELKLRITNQSKMTIEGLRAPPTSGIASIVQGSAGGLAPPMPGAMQVVDSPLLRQQVEAQRMGIKFLKNENNRLKAEKMRAQLASLPPLCPPKLPLAPRDSAVPPVGLNTVTYRRTDQLL 1127          
BLAST of Dynactin 1b vs. Ensembl Medaka
Match: dctn1b (dynactin subunit 1 [Source:NCBI gene;Acc:101166919])

HSP 1 Score: 483.411 bits (1243), Expect = 1.701e-150
Identity = 346/997 (34.70%), Postives = 553/997 (55.47%), Query Frame = 2
Query:   44 FKINDIVLYNG-TLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALR------------KPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDE-----QVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILK--LEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINE----TNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSD--AIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTD-LSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIR----NLSSTLPIF----TNTETILKISANI--------SDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLE 2905
             K+  +V   G +  GTV +IGTT FASG W G+ LD PKGKNDG+V GK YF C++NHGIFVR +Q+  VD  ++ +T++     PS+ R            +P     R   +     +  E + +        P  +   L  +   P       S +E     QVKDL EKL+TL++KR+EDK KLKE EK K++++QL+E K  +QE+ AE QR L + K++  + +E  + Y EE +  AD IEM T+DKEMAEE+ ES + E+D LK + EE++++ EILK  +E+ G       D          L+ QN +L++A++ MRDL+ + K E+ K  K++ K   EL+    ++++L  ++ +A+ +I ELKEQVD+ALGA+EMV  LTE+NL LEE V+ L E   +LE + +MN+E+ E    T + L   L    A     ++E  K + A  E + DY+ TI K+R+L   LQ   ++L  Q + ++EL   Q Q   +     +K K  ETK  A  IE EL+K++V+Q+S  V +L  F+P+ F + G D+D I+++LLI +LI K E ++ Q +E+F LS       G+  ++ +  ++   L+Y LS     L  Y++ LS C ++ + ++GSL+ EMS +E+S+D+LIDLL +  LDE   +EPL ++I Y+Q  Y +HL ++  DC +++ D ++      +  A+E     A    +    E +E    L  L+    D++   + IR+ +  + +    + LS      V+D LS   K +T     L  V+    A    M S     E    ++       +T  ++     NT   L+ S NI        + +M+ GEYD E   +K   P+ + A   + E++D E    KLE ++  +++ K +LK+K +ELSE SVRL+++EKKL  + K+ DE +E+++ +L++T+A L +KEK+ ++T + LQ+DI+ LE
Sbjct:   36 LKVGSLVEVIGKSQHGTVAYIGTTLFASGKWVGIILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQLVD--DTADTTSPDTPEPSSSRVLKKGESPNQPSRPTGGTGRGAASGSASASTGEMSSSEASTPAQTP--LVAPLIPTLHSPGNAAAPPSKEEETLRAQVKDLEEKLETLKMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQAELQRQLKEAKREAKEALEAKERYTEEMSDTADAIEMATLDKEMAEERAESLQLEVDSLKERVEELTMDLEILKHEIEEKGS------DGAASSFHVKQLEEQNGRLKEALVRMRDLSASEKQEHVKLQKQMEKKNMELDSLRGQKEKLQEEMSAAERTIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVTDLEAINEMNDELQENARETELELREMLDLGAAR----VREAEKRVEAAQETVADYQQTINKYRELTAHLQELNRELTSQQEASAEL---QQQPPADMFD--FKIKFAETKAYAKAIEMELRKMEVAQASRQVSLLTSFMPESFLRHGGDHDCILVLLLIPRLICKAELISKQAEEKFELSEGCVERVGLRGSVGEQLSFAAGLVYSLSLLQATLHKYEQALSQCSVNVYKKVGSLYPEMSVHERSLDFLIDLLHRDQLDETVRVEPLTKAIKYYQHLYSIHLADQTEDCTMQLADHIRFTQSALNCMAVEVGRLRAF---LHAGQEKAELAVLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALS--FGPQVSDALSDSRKHLTWVVAVLQEVA----AAGAQMMSPLGEQEGLSAVKLEDVAFQATEQVYGSQGANTYECLRQSCNIVIATMNKMATAMQEGEYDSEKPQMKNPPPVELQAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEASVRLSLLEKKLDSSSKDADERVEKIQTRLDETQALLKKKEKDFEETMDTLQADIDQLE 1004          
BLAST of Dynactin 1b vs. Planmine SMEST
Match: SMESG000029463.1 (SMESG000029463.1)

HSP 1 Score: 2233.37 bits (5786), Expect = 0.000e+0
Identity = 1172/1182 (99.15%), Postives = 1175/1182 (99.41%), Query Frame = 2
Query:   35 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY 3580
            MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRSNLNLLNINNLTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSEDKEKLKEYEKLKMKVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGND     SVNDEAQCLMLKSQNTKLRDAIILMRDLNENHKVENEKNVKEITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC KYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTE ILKISANISDSMEHGEYDYEGT+VKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRN+NIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLS+VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY
Sbjct:    1 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRSNLNLLNINNLTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSEDKEKLKEYEKLKMKVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGND-----SVNDEAQCLMLKSQNTKLRDAIILMRDLNENHKVENEKNVKEITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCCKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTENILKISANISDSMEHGEYDYEGTAVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNENIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSSVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY 1177          
BLAST of Dynactin 1b vs. Planmine SMEST
Match: SMESG000029463.1 (SMESG000029463.1)

HSP 1 Score: 2222.2 bits (5757), Expect = 0.000e+0
Identity = 1159/1182 (98.05%), Postives = 1162/1182 (98.31%), Query Frame = 2
Query:   35 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKSRSXXXXXXXXXXTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY 3580
            MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIK             TENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSEDKEKLKEYEKLKMKVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGND     SVNDEAQCLMLKSQNTKLRDAIILMRDLNENHKVENEKNVKEITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYC KYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTE ILKISANISDSMEHGEYDYEGT+VKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRN+NIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLS+VKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY
Sbjct:    1 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIK-------------TENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSNDEQVKDLTEKLQTLQIKRSEDKEKLKEYEKLKMKVQQLEENKKHIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGND-----SVNDEAQCLMLKSQNTKLRDAIILMRDLNENHKVENEKNVKEITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCCKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNLSSTLPIFTNTENILKISANISDSMEHGEYDYEGTAVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQSDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISAFLSEIQTLRTIIHNLRNENIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSSVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY 1164          
BLAST of Dynactin 1b vs. Planmine SMEST
Match: SMESG000069358.1 (SMESG000069358.1)

HSP 1 Score: 181.8 bits (460), Expect = 5.371e-46
Identity = 266/1052 (25.29%), Postives = 490/1052 (46.58%), Query Frame = 2
Query:  485 DEQVKDLTEKLQTLQIKRSXXXXXXXXXXXXXXXVQQLEENKK--HIQEKAAEYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLESFRSEIDLLKSKNEEISLENEILKLEKSGGND---FLMQDSVNDEAQCLML---------KSQNTKLRDAIILMRDLXXXXXXXXXXXXXXITKLQSELEKCVKERDRLLVDLKSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEELCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDTIEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYETKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILLIDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLSTWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNLDENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIEYCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPSLQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLYKYIEKFMEIRNL---SSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKTEEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENSVRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRK---EKELDQTSEALQSDINHLEMXXXXXXXXXXXXXXXNFFDNINISTSKIADQVDSGS-SQEISAFLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANRNSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHPEKEYLNELSAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIGSVNFHPISKPEEKIK-VSGSLLTVAKLHNIF 3574
            D+++KDL EK +TLQI +                    +E K+   +++   E QR L   K+   ++ +EFD+YR+   +  + IEM+TIDKEMAEEKLE    +   LK   E++  EN +LK    G +D   F+ Q S  ++ +  +L         K +N  L   + ++++L    + E+E       +L+S++EK  K       DLK       E+K+ VDS    + ++  LT KN  LE+ +K L++   EL++L D   E+ E+    + +   E    +L + E+   L  K     +   T  +  + +  L N++K+ + +    +E+ K       E SS  +  +  E   +   IEN+L+ +++S  S  VQ+L ++LP  F   G ++D I  + ++DKLI KI  +   I ++  L           +NI       +KL +LL  W  +L+  +  +         +L S F ++   E+++D LIDL++K  LD + +   + +SI +FQ FY      +  DC +KM +F+ I+  GS+ +     + I+ M+++N+   ++ + +  L +   +++S  +N + +L  +  + F+S +S ++D  +  L  I   I+ + L+L       D +  +  ++ +  E F   RN    +S   I  +  +I K   NI  + + G YD +  +      I   ATN++ +L  L+   ++++ KDE L      LK K  +LSE  +++N  ++KL   ++ ++ II +L Q++ + +A   ++   EK  +  SE L+                              IS S ++++ +  S S +I+ + +EI+ L  I+  L +   +  +  +    Q+LKP+            +  + I   E  NL +  +  + RDIY  LS VKI DLS R   K++  +    +++K Q EKL  +     N+  ++    N++C          N+ IG + F   S  ++ +K VS    ++ KL  +F
Sbjct:  353 DKEIKDLKEKNETLQILKK-------------------KEYKRCGDLEKLNNELQRELLDAKEREERIKKEFDSYRDMMRSGEEEIEMITIDKEMAEEKLEQVNQDYRNLKKLYEQVLEENSMLK-NSDGTSDAKIFIDQTSTINKYKNALLELSQSINCYKEENRNLNSELDILKELQIFQENESE-------QLKSKIEKHEK-------DLK-------EMKDLVDSTADVEVILDKLTFKNEYLEKELKKLKKRLIELDKLEDDRLEVIESKDKKIREFHEECDCLNLIVNEIQNALDKKKIENSELLKTTNQMNERICLLTNELKEKELEIQKQNEIVKKAKAKDRELSSLTFSKQNIEKNEMKRDIENKLKTIEISHKSHQVQLLIQYLPASFSLPGGEHDLIETVQIVDKLIDKISLVLEYIIQKRRLYQQRDNSEKTPENI----CIQYKLEFLLLIWCGLLKQLQINIHHSSPEALCQLRSEFKQILQQEQNIDLLIDLMKKQCLDNSRNFSGVLQSIEFFQNFYADRFCYQQIDCNLKMENFISILSKGSECLRNDLSW-IDQMLENNV-GEQTLKLMDNLNKISTNVQSTMKNTQMYLRHNQRITFDSSVSKSIDGIIFLLMDIVLSISDFALQLT------DERIFSDEAMCRLTEIFANNRNPLNPTSDNEILFSLNSIDKQVENIVSNFKSGVYDADKLNKTFNSAIDTNATNYREKLMGLQALSFEIKLKDEMLALINQELKEKSSQLSEILMQVNFYKQKLQTAVESREIIINQLNQRIYELEANAAKRNETEKLSEFESEPLKISCEP-------------------------ISHSSVSNEENFKSCSIDINDYQNEIRNLTIIVKYLMSKLHKSNAIKSDNRLQELKPI------------KTQTFISDKEL-NLLMQRAVTINRDIYESLSNVKIPDLSSRKDIKQFSEKSIIFSKLKNQSEKLIIDGMKKCNQKLVYFDSPNSACT---------NNSIGLIRFDRNSVNDQSMKSVSIDNWSLKKLEELF 1304          

HSP 2 Score: 97.0561 bits (240), Expect = 6.242e-20
Identity = 43/92 (46.74%), Postives = 62/92 (67.39%), Query Frame = 2
Query:   35 MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSAL 310
            +++F+I D VLYN  L+GTV FIG+T  A G +YG++L +  G+ DG++ G SYF+C + HGIF R +QL K+   E   TS+ES+V    L
Sbjct:    2 INEFQIGDSVLYNSKLEGTVRFIGSTASAKGTFYGIELHTADGRTDGTMDGISYFECKEKHGIFARRSQLTKIQSTEV--TSSESEVHDKLL 91          
BLAST of Dynactin 1b vs. Planmine SMEST
Match: SMESG000015470.1 (SMESG000015470.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.180e-15
Identity = 34/72 (47.22%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   38 SDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            S  +I D VL  G  KG + F+G T F+ G WYG++LD P GKNDG+V G  YF+C  N G+F   ++L K+
Sbjct:  238 SPLQICDRVLVAGQRKGVIRFVGPTKFSPGTWYGIELDKPVGKNDGAVNGVRYFQCGANRGVFAPLSRLHKL 309          

HSP 2 Score: 68.1662 bits (165), Expect = 2.251e-11
Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 2
Query:   50 INDIVLYNGTL--KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            + D VL  G +   G + + G   FA GVW GV+LD P+GKN G+V G  YF+C++ +G+F   T+++KV
Sbjct:  124 LGDRVLVRGDVDRSGILRYCGPVEFADGVWAGVELDEPQGKNSGTVNGVWYFQCEEQYGVFAPVTRVSKV 193          

HSP 3 Score: 60.077 bits (144), Expect = 7.666e-9
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 2
Query:   62 VLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN 274
            VL N  L G + ++G  +F+ G+W GV+L    GK+DG V  K YF C  +HGI VR ++++ V G    N
Sbjct:  391 VLCNNEL-GIIRYVGAVNFSDGIWVGVELRHKTGKHDGIVLNKRYFLCPPDHGIMVRPSRIS-VKGINGAN 459          
BLAST of Dynactin 1b vs. Planmine SMEST
Match: SMESG000015470.1 (SMESG000015470.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.243e-15
Identity = 34/72 (47.22%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   38 SDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            S  +I D VL  G  KG + F+G T F+ G WYG++LD P GKNDG+V G  YF+C  N G+F   ++L K+
Sbjct:  304 SPLQICDRVLVAGQRKGVIRFVGPTKFSPGTWYGIELDKPVGKNDGAVNGVRYFQCGANRGVFAPLSRLHKL 375          

HSP 2 Score: 68.5514 bits (166), Expect = 2.100e-11
Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 2
Query:   50 INDIVLYNGTL--KGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKV 253
            + D VL  G +   G + + G   FA GVW GV+LD P+GKN G+V G  YF+C++ +G+F   T+++KV
Sbjct:  190 LGDRVLVRGDVDRSGILRYCGPVEFADGVWAGVELDEPQGKNSGTVNGVWYFQCEEQYGVFAPVTRVSKV 259          

HSP 3 Score: 60.4622 bits (145), Expect = 6.643e-9
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 2
Query:   62 VLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVAGKSYFKCDKNHGIFVRNTQLAKVDGDESTN 274
            VL N  L G + ++G  +F+ G+W GV+L    GK+DG V  K YF C  +HGI VR ++++ V G    N
Sbjct:  457 VLCNNEL-GIIRYVGAVNFSDGIWVGVELRHKTGKHDGIVLNKRYFLCPPDHGIMVRPSRIS-VKGINGAN 525          
The following BLAST results are available for this feature:
BLAST of Dynactin 1b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCTN12.888e-14933.73dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN18.640e-14931.11dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN11.229e-14831.11dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN15.908e-14830.93dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
DCTN15.908e-14830.93dynactin subunit 1 [Source:HGNC Symbol;Acc:HGNC:27... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnc-11.471e-6326.48DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-12.024e-6326.48DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-12.505e-6326.48DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-12.901e-6326.48DyNactin Complex component [Source:UniProtKB/TrEM... [more]
dnc-14.762e-6326.56DyNactin Complex component [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCTN1-p1504.253e-7429.03gene:FBgn0001108 transcript:FBtr0075756[more]
CG92792.276e-4627.90gene:FBgn0036882 transcript:FBtr0074976[more]
CG92792.276e-4627.90gene:FBgn0036882 transcript:FBtr0332758[more]
CLIP-1901.182e-2043.93gene:FBgn0020503 transcript:FBtr0301441[more]
CLIP-1901.234e-2043.93gene:FBgn0020503 transcript:FBtr0332453[more]
back to top
BLAST of Dynactin 1b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn1a1.156e-14531.23dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1a1.156e-14531.23dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1a9.610e-14230.61dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
dctn1b2.131e-14132.29dynactin 1b [Source:ZFIN;Acc:ZDB-GENE-050419-28][more]
dctn1b2.607e-14131.55dynactin 1b [Source:ZFIN;Acc:ZDB-GENE-050419-28][more]
back to top
BLAST of Dynactin 1b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000028179.14.422e-14130.85dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000011610.13.542e-12031.56dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000000695.15.537e-11930.81dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000000846.19.447e-11930.81dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
ENSXETT00000000206.11.009e-11831.26dynactin subunit 1 [Source:NCBI gene;Acc:447948][more]
back to top
BLAST of Dynactin 1b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dctn14.710e-14730.29dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn11.716e-14631.21dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn11.243e-14530.74dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn13.512e-14530.74dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
Dctn19.871e-12431.38dynactin 1 [Source:MGI Symbol;Acc:MGI:107745][more]
back to top
BLAST of Dynactin 1b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14203|DCTN1_HUMAN4.990e-14733.60Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN... [more]
sp|O08788|DCTN1_MOUSE2.456e-14430.74Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dct... [more]
sp|Q6PCJ1|DCTN1_XENLA4.746e-14330.87Dynactin subunit 1 OS=Xenopus laevis OX=8355 GN=dc... [more]
sp|P28023|DCTN1_RAT2.759e-14130.90Dynactin subunit 1 OS=Rattus norvegicus OX=10116 G... [more]
sp|P35458|DCTN1_CHICK1.279e-13631.43Dynactin subunit 1 OS=Gallus gallus OX=9031 GN=DCT... [more]
back to top
BLAST of Dynactin 1b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9KHY12.538e-15431.45Dynactin 1b OS=Oryzias latipes OX=8090 PE=4 SV=1[more]
A0A3P9M0503.116e-15431.19Dynactin 1b OS=Oryzias latipes OX=8090 PE=4 SV=1[more]
A0A3B3H6F44.921e-15432.30Dynactin 1b OS=Oryzias latipes OX=8090 GN=LOC10116... [more]
A0A3P9M0D48.883e-15431.11Dynactin 1b OS=Oryzias latipes OX=8090 PE=4 SV=1[more]
A0A3B3I0G29.037e-15432.03Dynactin 1b OS=Oryzias latipes OX=8090 GN=LOC10116... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn1b1.958e-13632.84dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
dctn1b2.886e-13632.72dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
dctn1b7.673e-13632.24dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
dctn1b1.391e-13532.72dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
dctn1b2.195e-13432.60dynactin subunit 1 [Source:NCBI gene;Acc:103040401... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn1a2.939e-11931.96dynactin 1a [Source:ZFIN;Acc:ZDB-GENE-070117-2205][more]
ENSPMAT00000006027.15.614e-1840.00pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 g... [more]
ENSPMAT00000006020.11.434e-1743.37pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 g... [more]
ENSPMAT00000004647.12.527e-1746.51pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 ge... [more]
si:dkeyp-47f9.41.820e-1541.67si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NIP1003.644e-1442.70Large subunit of the dynactin complex; dynactin is... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491011.332e-12830.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336002.325e-1749.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433437.378e-1741.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402445.253e-1460.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444331.356e-1351.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynactin 1b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn1b1.852e-15732.30dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1b3.402e-15732.03dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1b9.306e-15731.95dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
dctn1a8.189e-15333.42dynactin subunit 1 [Source:NCBI gene;Acc:101162870... [more]
dctn1b1.701e-15034.70dynactin subunit 1 [Source:NCBI gene;Acc:101166919... [more]
back to top
BLAST of Dynactin 1b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029463.10.000e+099.15SMESG000029463.1[more]
SMESG000029463.10.000e+098.05SMESG000029463.1[more]
SMESG000069358.15.371e-4625.29SMESG000069358.1[more]
SMESG000015470.11.180e-1547.22SMESG000015470.1[more]
SMESG000015470.11.243e-1547.22SMESG000015470.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017339 ID=SMED30017339|Name=Dynactin 1b|organism=Schmidtea mediterranea sexual|type=transcript|length=3825bp
CACAAACTCGTAATTTAGAAAGTAATTAAATGAAATGTCAGATTTCAAAA
TTAATGATATAGTTCTTTATAATGGGACTTTGAAAGGTACAGTCGAGTTT
ATCGGTACAACACATTTTGCAAGTGGTGTTTGGTATGGTGTTAAATTAGA
TTCCCCGAAAGGAAAAAATGACGGTTCTGTGGCTGGTAAATCGTATTTCA
AATGTGATAAAAATCATGGTATTTTTGTTAGAAATACACAATTGGCAAAA
GTTGATGGTGATGAATCAACTAACACATCTGCTGAATCTAAAGTTAGACC
ATCTGCTCTCAGAAAACCAATGTCTATTAAAAGTAGATCTAATTTAAATT
TATTAAATATTAATAATTTAACGGAAAATGCGGTGACACCGAAAGAAGAA
GTTCAAGATCTTCCCGAAAAAATTTTTCAAGAATTGGAAATTAGCCAAGA
AAAACCAGTTGAACATAAGGAATTTGTAAGTAATGATGAACAAGTTAAAG
ATTTAACAGAAAAATTGCAAACTCTTCAAATTAAACGAAGTGAAGACAAA
GAGAAACTGAAAGAATATGAAAAATTAAAAATGAAAGTTCAACAGTTGGA
AGAAAATAAGAAACATATCCAAGAGAAAGCAGCTGAATATCAAAGAGCAT
TGGATAAAATGAAACAAGATCACAGTAAATTAATAGAGGAATTTGATAAT
TACCGCGAAGAAACCACAACTCTTGCTGATAACATTGAAATGCTAACTAT
TGATAAAGAAATGGCTGAAGAAAAATTAGAAAGCTTTCGTTCGGAAATCG
ATTTGTTGAAATCTAAAAACGAAGAGATTAGTTTAGAAAATGAAATATTG
AAACTGGAGAAAAGTGGTGGTAATGATTTTCTGATGCAAGATTCAGTGAA
TGACGAAGCTCAATGTTTGATGCTTAAATCTCAAAATACTAAATTAAGGG
ATGCTATCATTCTCATGCGAGATTTAAATGAAAATCATAAAGTTGAAAAC
GAAAAGAATGTGAAAGAGATAACAAAATTGCAATCGGAATTGGAAAAATG
TGTCAAAGAACGTGATAGATTGCTAGTTGATTTGAAGTCAGCTCAGGAAA
GCATTATTGAGTTAAAAGAACAAGTTGATAGTGCTCTTGGTGCTGATGAA
ATGGTGAGTAATTTAACAGAAAAAAATTTAACTCTTGAAGAAACAGTCAA
ATCATTAGAAGAAGCCAAAAATGAACTAGAAGAACTATGTGACATGAACA
ACGAAATTAATGAAACAAATGTCAGTTTAATGAGTGATCTGAAATTTGAA
ATTGCCAATAAAGATCTCGCTATTCAAGAATTAAATAAAGTTCTTGTTGC
AAAGAATGAGTGCATTTTAGATTATGAAGATACAATAGAAAAATTCCGTG
ACCTGGTTAAGGATTTGCAGAATCAAGTTAAAGATTTGAAGCAGCAAACT
GACAATAATTCAGAATTATCCAAAAATCAACATCAAATAGCAGTAGAGAA
ATCTTCTGAGATTTACAAGAGCAAGATCTATGAAACTAAAACAATTGCTT
CTATTATTGAAAATGAACTTCAGAAACTTGATGTCAGTCAAAGTTCTTCT
CATGTTCAAATGCTTGAAAGATTTCTTCCTGATAAATTTTTCAAAACTGG
AGCCGATAATGACTCAATAATGATGATTCTTTTGATTGACAAATTAATAT
TTAAAATTGAGTTTCTAACCAATCAAATCAAAGAAAGATTTCTATTGAGT
CCTCTGGAACCAACGGAATCTGGAGTTGCGAAGAATATAAATGATTCCAC
CGCCTATTATCATAAATTGATATATTTACTCAGCACTTGGTATATTATCC
TACGGCACTACAAAAAAACATTGAGTTCATGTCAGCTGTCAACATTCAGT
CGATTAGGCTCACTTTTTATAGAAATGAGTCCAAATGAGAAATCAGTCGA
TTATTTAATTGATTTATTAAGGAAAGGTAATTTAGACGAGAACAGTTCTT
TGGAACCATTGGAGAGATCAATAAATTATTTCCAAACATTCTATCAAGTG
CACCTTATCAATGAGCCACCTGATTGCTTGATAAAAATGAATGATTTTGT
AAAAATTATGCTTGGTGGTTCAGATGCCATTGAATATTGTAGTAAATATG
CTATCGAATTCATGGTGAAACATAATATGGAAGCCAGTGAAAGTTATGAA
TTCCTTGTCAGGTTACAACAGTTCGGTTTGGATTTGAAATCCAACACGAG
AAATATCAGAAAGCATTTATTGAAGAGTCCAAGCTTACAGTTCAACAGTG
GATTATCTACTAATTTAGACAAATGCGTTACAGATCTCTCTGCCATTACG
AAGATAATCACTAGTTATTGCTTGGAATTAGCTACTGTTTCTGATGAAGA
TGATGCGAAATCAGTGAACATGTCGAGTTTATACAAATATATAGAAAAGT
TCATGGAAATACGCAATTTATCTAGCACTTTACCTATATTCACTAATACC
GAAACTATTTTGAAAATATCGGCTAATATCTCAGACTCCATGGAACACGG
GGAATACGACTATGAAGGAACTTCAGTTAAAACTGAAGAACCAATCGTAA
TTATAGCTACGAATTTCAAAAATGAGTTATCCGACTTAGAAAATACTTGT
TATAAACTCGAGCATAAAGACGAGGAGCTTCGACAGGCAAAACTCAATTT
AAAACTGAAATGTGACGAATTAAGCGAAAATTCTGTTCGATTAAATATTG
TTGAGAAAAAACTCTCGATTAACATTAAAGAAAAGGATGAAATTATTGAG
CGATTAGAACAAAAATTGGAGCAGACTAAAGCCGCATTAGTCAGAAAAGA
AAAAGAACTTGATCAAACATCTGAGGCTCTTCAATCCGATATTAATCATT
TAGAAATGCAAAGAGAAGAACTTAAGAAACAATTAAAAGAAACCAAGAAG
CGAAATTTTTTTGATAATATTAATATTTCTACCTCAAAAATAGCAGATCA
GGTTGATAGTGGATCATCTCAGGAAATTAGCGCATTTTTGAGTGAAATTC
AAACGTTGAGAACTATTATACATAATCTGCGTAATGACAATATTCGGCTG
CGATCTCAGATCACTTCAAAACATGCACAGAAATTGAAACCGCTGTCTAT
TCCAATTAGTTTGAATACACCAAATGCAAATCGAAATAGTTCTCTGATTA
AAAAGATGGAATATGCCAATTTGACAATTACAAGTTCTGAGAATCTTACG
CGAGATATTTATTCCCATTTGAGTGCTGTCAAAATAATTGATCTCTCTAT
TCGACACCCAGAAAAAGAATACCTTAATGAGTTGTCTGCTAAAACTCGAA
TAAAACTTCAGTTCGAAAAATTACGAAAAGAAAAGACCGATTTTATCAAT
GAAGATAACTTGTTCAGTAAAATCGACAATGCTTCATGTCCATTGTTCAA
ATCTAAAGACCAAAATCTGAATGATTATATTGGATCTGTTAACTTTCATC
CTATATCGAAACCAGAAGAGAAAATCAAAGTTTCTGGCTCATTGCTAACT
GTTGCCAAATTGCACAATATCTTCAGTTATTGAATTGTGATTTGTGATGG
GGAACATTTATATGCTGTGATGATGGTTTCATTGACATTCATTTTATAAT
TCCGTAAGGATATCTGTTACCAACAATATACTTTCTATTTAGCTATTTTA
ATGTATGTTTGTTTTATTTTGGCACTAATTTAATTCGGAGGCTTTCGATA
ATTCAATATAAAAAATATGCCAAATTTGCATTGTTTCAAGCCGATGATAT
TTGTCTTATTAAAGGAATAAAATTA
back to top

protein sequence of SMED30017339-orf-1

>SMED30017339-orf-1 ID=SMED30017339-orf-1|Name=SMED30017339-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1183bp
MSDFKINDIVLYNGTLKGTVEFIGTTHFASGVWYGVKLDSPKGKNDGSVA
GKSYFKCDKNHGIFVRNTQLAKVDGDESTNTSAESKVRPSALRKPMSIKS
RSNLNLLNINNLTENAVTPKEEVQDLPEKIFQELEISQEKPVEHKEFVSN
DEQVKDLTEKLQTLQIKRSEDKEKLKEYEKLKMKVQQLEENKKHIQEKAA
EYQRALDKMKQDHSKLIEEFDNYREETTTLADNIEMLTIDKEMAEEKLES
FRSEIDLLKSKNEEISLENEILKLEKSGGNDFLMQDSVNDEAQCLMLKSQ
NTKLRDAIILMRDLNENHKVENEKNVKEITKLQSELEKCVKERDRLLVDL
KSAQESIIELKEQVDSALGADEMVSNLTEKNLTLEETVKSLEEAKNELEE
LCDMNNEINETNVSLMSDLKFEIANKDLAIQELNKVLVAKNECILDYEDT
IEKFRDLVKDLQNQVKDLKQQTDNNSELSKNQHQIAVEKSSEIYKSKIYE
TKTIASIIENELQKLDVSQSSSHVQMLERFLPDKFFKTGADNDSIMMILL
IDKLIFKIEFLTNQIKERFLLSPLEPTESGVAKNINDSTAYYHKLIYLLS
TWYIILRHYKKTLSSCQLSTFSRLGSLFIEMSPNEKSVDYLIDLLRKGNL
DENSSLEPLERSINYFQTFYQVHLINEPPDCLIKMNDFVKIMLGGSDAIE
YCSKYAIEFMVKHNMEASESYEFLVRLQQFGLDLKSNTRNIRKHLLKSPS
LQFNSGLSTNLDKCVTDLSAITKIITSYCLELATVSDEDDAKSVNMSSLY
KYIEKFMEIRNLSSTLPIFTNTETILKISANISDSMEHGEYDYEGTSVKT
EEPIVIIATNFKNELSDLENTCYKLEHKDEELRQAKLNLKLKCDELSENS
VRLNIVEKKLSINIKEKDEIIERLEQKLEQTKAALVRKEKELDQTSEALQ
SDINHLEMQREELKKQLKETKKRNFFDNINISTSKIADQVDSGSSQEISA
FLSEIQTLRTIIHNLRNDNIRLRSQITSKHAQKLKPLSIPISLNTPNANR
NSSLIKKMEYANLTITSSENLTRDIYSHLSAVKIIDLSIRHPEKEYLNEL
SAKTRIKLQFEKLRKEKTDFINEDNLFSKIDNASCPLFKSKDQNLNDYIG
SVNFHPISKPEEKIKVSGSLLTVAKLHNIFSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000132establishment of mitotic spindle orientation
GO:0060219camera-type eye photoreceptor cell differentiation
GO:0010970transport along microtubule
GO:0031122cytoplasmic microtubule organization
GO:0090316positive regulation of intracellular protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036859CAP-Gly_dom_sf
IPR000938CAP-Gly_domain
IPR022157Dynactin
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0008017microtubule binding
GO:0070840dynein complex binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005869dynactin complex
GO:0005874microtubule
GO:0030286dynein complex
GO:0035371microtubule plus-end
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 154..226
NoneNo IPR availableCOILSCoilCoilcoord: 374..411
NoneNo IPR availableCOILSCoilCoilcoord: 297..370
NoneNo IPR availableCOILSCoilCoilcoord: 234..275
NoneNo IPR availableCOILSCoilCoilcoord: 907..973
NoneNo IPR availableCOILSCoilCoilcoord: 858..899
NoneNo IPR availableCOILSCoilCoilcoord: 1005..1025
NoneNo IPR availableCOILSCoilCoilcoord: 444..481
NoneNo IPR availablePANTHERPTHR18916:SF76DYNACTIN 1A-RELATEDcoord: 143..997
NoneNo IPR availablePANTHERPTHR18916:SF76DYNACTIN 1A-RELATEDcoord: 17..85
NoneNo IPR availablePANTHERPTHR18916DYNACTIN 1-RELATED MICROTUBULE-BINDINGcoord: 143..997
coord: 17..85
IPR000938CAP Gly-rich domainSMARTSM01052CAP_GLY_2coord: 6..71
e-value: 6.3E-27
score: 105.4
IPR000938CAP Gly-rich domainPFAMPF01302CAP_GLYcoord: 9..69
e-value: 3.5E-22
score: 78.2
IPR000938CAP Gly-rich domainPROSITEPS00845CAP_GLY_1coord: 24..55
IPR000938CAP Gly-rich domainPROSITEPS50245CAP_GLY_2coord: 24..66
score: 17.674
IPR022157Dynein associated proteinPFAMPF12455Dynactincoord: 461..743
e-value: 2.3E-48
score: 164.9
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 2..86
e-value: 1.3E-28
score: 100.3
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 3..91