centrosomal protein of 83 kDa-like

Overview
Namecentrosomal protein of 83 kDa-like
Smed IDSMED30017333
Length (bp)2307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of centrosomal protein of 83 kDa-like (SMED30017333) t-SNE clustered cells

Violin plots show distribution of expression levels for centrosomal protein of 83 kDa-like (SMED30017333) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of centrosomal protein of 83 kDa-like (SMED30017333) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for centrosomal protein of 83 kDa-like (SMED30017333) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017333

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017333SMESG000033227.1 SMESG000033225.1 SmedASXL_012950SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017333SMESG000033227.1 SMESG000033225.1 dd_Smed_v4_12969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017333SMESG000033227.1 SMESG000033225.1 dd_Smed_v4_12969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017333SMESG000033227.1 SMESG000033225.1 dd_Smed_v4_12969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017333SMESG000033227.1 SMESG000033225.1 dd_Smed_v4_12969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017333SMESG000033227.1 SMESG000033225.1 dd_Smed_v6_12969_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017333SMESG000033227.1 SMESG000033225.1 dd_Smed_v4_12969_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Human
Match: CEP83 (centrosomal protein 83 [Source:HGNC Symbol;Acc:HGNC:17966])

HSP 1 Score: 174.866 bits (442), Expect = 3.318e-45
Identity = 181/687 (26.35%), Postives = 374/687 (54.44%), Query Frame = 2
Query:   74 YNKMNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSE--------LTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM-------QSANPSSF-------SVDTPF----HESRYEQSLEQLKRRLEILD 2047
            +  M+   +N        L     + S  E QK+L DE+ R   HK NYQ +K+E  + Q  + +L++E       ++ +  + Q+ + +L  +LV+  +++E++++  +T +++E++R +I+++ E+   ER      E E  +    KLR E+TFLK+EF+HQ +E+ RI++E K+ ++SE+  L  DK  L     ++++ ++S  ++++++E   L  ++K L  E+ E +A+ E+  A  +   R +++QL+E  +T R +E E +S   +    +KEL S + +N+ L    ++ +R    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +        +  L E++  + R+  + KE  + ++  L++EKLELE+++++LE    E       +   +EEK R ++  E +  KE +  + K +  +  I++ +   NE  + + QQ + L      LA SE        + K+  + L+Q+  +   Q ++   + E  + +K  Q  +++ +  +RI + EE+ +++ EK +      +++   H N  ++ Q++++++ A K+E+  E ++L R NVP ED+ +L + LKD+++RH E+R++I+        S NP SF       S++ PF     E ++++ L  L++RLE L+
Sbjct:    6 FTDMDTFPNNFPPGGDSGL-----TGSQSEFQKMLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQSEKDQYEEKLRASQMAEEITRKELQSVRLKLQQQIVTIENAEKEKNE-NSDLKQQISSLQIQVTSLAQSENDLLNSNQMLKEMVERLKQECRNFRSQAEKAQLEAEKTLEEKQIQWLEEKHKLHERITDREEKYNQAKEKLQRAAIAQKKRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSLLRKRLEELE 686          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Human
Match: CEP83 (centrosomal protein 83 [Source:HGNC Symbol;Acc:HGNC:17966])

HSP 1 Score: 174.866 bits (442), Expect = 3.318e-45
Identity = 181/687 (26.35%), Postives = 374/687 (54.44%), Query Frame = 2
Query:   74 YNKMNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSE--------LTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM-------QSANPSSF-------SVDTPF----HESRYEQSLEQLKRRLEILD 2047
            +  M+   +N        L     + S  E QK+L DE+ R   HK NYQ +K+E  + Q  + +L++E       ++ +  + Q+ + +L  +LV+  +++E++++  +T +++E++R +I+++ E+   ER      E E  +    KLR E+TFLK+EF+HQ +E+ RI++E K+ ++SE+  L  DK  L     ++++ ++S  ++++++E   L  ++K L  E+ E +A+ E+  A  +   R +++QL+E  +T R +E E +S   +    +KEL S + +N+ L    ++ +R    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +        +  L E++  + R+  + KE  + ++  L++EKLELE+++++LE    E       +   +EEK R ++  E +  KE +  + K +  +  I++ +   NE  + + QQ + L      LA SE        + K+  + L+Q+  +   Q ++   + E  + +K  Q  +++ +  +RI + EE+ +++ EK +      +++   H N  ++ Q++++++ A K+E+  E ++L R NVP ED+ +L + LKD+++RH E+R++I+        S NP SF       S++ PF     E ++++ L  L++RLE L+
Sbjct:    6 FTDMDTFPNNFPPGGDSGL-----TGSQSEFQKMLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQSEKDQYEEKLRASQMAEEITRKELQSVRLKLQQQIVTIENAEKEKNE-NSDLKQQISSLQIQVTSLAQSENDLLNSNQMLKEMVERLKQECRNFRSQAEKAQLEAEKTLEEKQIQWLEEKHKLHERITDREEKYNQAKEKLQRAAIAQKKRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSLLRKRLEELE 686          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Human
Match: CEP83 (centrosomal protein 83 [Source:HGNC Symbol;Acc:HGNC:17966])

HSP 1 Score: 131.339 bits (329), Expect = 2.823e-31
Identity = 114/425 (26.82%), Postives = 241/425 (56.71%), Query Frame = 2
Query:  173 ILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEI 1441
            +L DE+ R   HK NYQ +K+E  + Q  + +L++E       ++ +  + Q+ + +L  +LV+  +++E++++  +T +++E++R +I+++ E+   ER      E E  +    KLR E+TFLK+EF+HQ +E+ RI++E K+ ++SE+  L  DK  L     ++++ ++S  ++++++E   L  ++K L  E+ E +A+ E+  A  +   R +++QL+E  +T R +E E +S   +    +KEL S + +N+ L    ++ +R    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +        +  L E++  + R+  + KE  + ++  L++EKLELE+++++LE    E       +   +EEK R ++  E +  KE +  + K +  +  I
Sbjct:    1 MLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQSEKDQYEEKLRASQMAEEITRKELQSVRLKLQQQIVTI 425          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Human
Match: CEP83 (centrosomal protein 83 [Source:HGNC Symbol;Acc:HGNC:17966])

HSP 1 Score: 121.709 bits (304), Expect = 2.072e-29
Identity = 96/349 (27.51%), Postives = 200/349 (57.31%), Query Frame = 2
Query:   74 YNKMNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIE 1114
            +  M+   +N        L     + S  E QK+L DE+ R   HK NYQ +K+E  + Q  + +L++E       ++ +  + Q+ + +L  +LV+  +++E++++  +T +++E++R +I+++ E+   ER      E E  +    KLR E+TFLK+EF+HQ +E+ RI++E K+ ++SE+  L  DK  L     ++++ ++S  ++++++E   L  ++K L  E+ E +A+ E+  A  +   R +++QL+E  +T R +E E +S   +    +KEL S + +N+ L    ++ +R    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++
Sbjct:    6 FTDMDTFPNNFPPGGDSGL-----TGSQSEFQKMLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELD 349          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Human
Match: CEP83 (centrosomal protein 83 [Source:HGNC Symbol;Acc:HGNC:17966])

HSP 1 Score: 98.9821 bits (245), Expect = 3.745e-21
Identity = 88/312 (28.21%), Postives = 175/312 (56.09%), Query Frame = 2
Query:  467 ERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKE 1396
            ER      E E  +    KLR E+TFLK+EF+HQ +E+ RI++E K+ ++SE+  L  DK  L     ++++ ++S  ++++++E   L  ++K L  E+ E +A+ E+  A  +   R +++QL+E  +T R +E E +S   +    +KEL S + +N+ L    ++ +R    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +        +  L E++  + R+  + KE  + ++  L++EKLELE+++++LE    E       +   +EEK R ++  E +  KE
Sbjct:    3 ERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQSEKDQYEEKLRASQMAEEITRKE 314          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Zebrafish
Match: cep83 (centrosomal protein 83 [Source:NCBI gene;Acc:100007472])

HSP 1 Score: 166.392 bits (420), Expect = 6.160e-43
Identity = 116/386 (30.05%), Postives = 229/386 (59.33%), Query Frame = 2
Query:  146 SESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEI--PQESGS-LKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLE 1294
            + S +E QK+L DE+ R   HK NYQ +K E  + Q+ Y R ++E       R++   + Q+ +++L  +L+D  R++E+L++  +T +R+E++R +++++ E+   ER  +   E E  +++  KLR + TFLK+EFDHQ +EH R++EE ++ H+++V  L  DK   LA+ L+   P   G  ++ + +E   L  +++ L  E+ E RA+  +  A  +   R +++QL+E+ +  + +E E +S++ QL  ++ EL     +N+ L    ++ +R    L ++++E+    K++L+ +KLE  + KG++ER++D+L  ++E L+  + +  +   + +  + E+E  + RR  + +E E  ++  L+ EKLELE+++S LE
Sbjct:   39 TSSDMEFQKMLIDERMRCENHKTNYQTLKVEHTRLQDQYTRAQNELKRLLSDRQVTQEKQQLLLAELRGELLDKTRDLEELKLQVLTPQRLELLRAQVQQELEAPIRERFNKLQEEAENYRSEYNKLRYDLTFLKSEFDHQKEEHARVLEERRIRHEADVARLEHDKED-LATQLQSGDPARDGKRVEALLREKAQLHQRLRGLEAEVTELRAERNNSGAQAENVQRIQIRQLAESQAAVKALEAEKQSIRMQLDRTESELRLSQEQNTLLTGKLHKAEREINSLNSQVEEMKHTHKLELSNVKLECVRSKGELERERDMLQCQVEGLQSDIEVMKSALERNKELISEKEREMVRRVQAAREEEIHKMATLQEEKLELENRLSELE 423          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Zebrafish
Match: cep83 (centrosomal protein 83 [Source:NCBI gene;Acc:100007472])

HSP 1 Score: 166.777 bits (421), Expect = 1.157e-42
Identity = 116/386 (30.05%), Postives = 229/386 (59.33%), Query Frame = 2
Query:  146 SESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEI--PQESGS-LKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLE 1294
            + S +E QK+L DE+ R   HK NYQ +K E  + Q+ Y R ++E       R++   + Q+ +++L  +L+D  R++E+L++  +T +R+E++R +++++ E+   ER  +   E E  +++  KLR + TFLK+EFDHQ +EH R++EE ++ H+++V  L  DK   LA+ L+   P   G  ++ + +E   L  +++ L  E+ E RA+  +  A  +   R +++QL+E+ +  + +E E +S++ QL  ++ EL     +N+ L    ++ +R    L ++++E+    K++L+ +KLE  + KG++ER++D+L  ++E L+  + +  +   + +  + E+E  + RR  + +E E  ++  L+ EKLELE+++S LE
Sbjct:   39 TSSDMEFQKMLIDERMRCENHKTNYQTLKVEHTRLQDQYTRAQNELKRLLSDRQVTQEKQQLLLAELRGELLDKTRDLEELKLQVLTPQRLELLRAQVQQELEAPIRERFNKLQEEAENYRSEYNKLRYDLTFLKSEFDHQKEEHARVLEERRIRHEADVARLEHDKED-LATQLQSGDPARDGKRVEALLREKAQLHQRLRGLEAEVTELRAERNNSGAQAENVQRIQIRQLAESQAAVKALEAEKQSIRMQLDRTESELRLSQEQNTLLTGKLHKAEREINSLNSQVEEMKHTHKLELSNVKLECVRSKGELERERDMLQCQVEGLQSDIEVMKSALERNKELISEKEREMVRRVQAAREEEIHKMATLQEEKLELENRLSELE 423          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Xenopus
Match: cep83 (centrosomal protein 83kDa [Source:NCBI gene;Acc:100145346])

HSP 1 Score: 147.902 bits (372), Expect = 7.915e-37
Identity = 125/440 (28.41%), Postives = 253/440 (57.50%), Query Frame = 2
Query:  161 ELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAEC-SECRKI------ESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARL--LASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLK 1453
            ELQK+L DE+ R   HK NYQ +K+E       + RL+DE+ +  +EC+++         + Q+ +++L  +L+D  RE E+L++  ++ +++E+++++I E+ E+   ER  +   E E  + D  KLR E T L+AEFDHQ +EH R+++E ++ +++E+  L  +K  L     S++  ++S  ++ + +E   L  ++K+L  E  E RA+ E+  +  +   R +++Q++E  +T R +E E +S+K QL   +KEL     +N+ L    ++++R    L +R  EL    K++++ +KLE+AK K ++ER++D + ++++ ++ +  +      + +  L E++  + R+  + KE  + ++  L++E+L+LE++++ LE    E  +    ++S  EEK   A+  E    +E +  + K++  VS I+ L+
Sbjct:   13 ELQKLLIDEQMRCEHHKTNYQTLKAE-------HTRLQDEYIKSQNECKRLLMEKQNTQEKVQLMLAELRGELLDKTREAEELKLKVLSPQKLELLKIQILEEQEAPIKERYRQLEEEAEKYRGDYNKLRYELTLLRAEFDHQKEEHERVLQERRIKYEAEILQLEREKKELHDQIMSVDPTRDSKRVEVLLREKAQLYQKLKSLEAETTELRAERENYGSQAENVQRIQVRQMAENQATIRSLEAEKQSMKLQLERLEKELHESTEQNTILTAKLHKMEREVNALSSRTGELKYSHKMEISNIKLEAAKTKNEVERERDKVQSQLDVMQTENGILKATLDRQKEILAEKDRELIRKVQAAKEAGFQQIVTLQDERLQLENRIAELERYKVEHDSQKQTEISQIEEKLHIAQTAEESTRRELQSLRSKHQQQVSYIEQLQ 445          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Xenopus
Match: cep83 (centrosomal protein 83kDa [Source:NCBI gene;Acc:100145346])

HSP 1 Score: 120.553 bits (301), Expect = 5.088e-28
Identity = 103/375 (27.47%), Postives = 217/375 (57.87%), Query Frame = 2
Query:  335 ISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARL--LASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLK 1453
            +++L  +L+D  RE E+L++  ++ +++E+++++I E+ E+   ER  +   E E  + D  KLR E T L+AEFDHQ +EH R+++E ++ +++E+  L  +K  L     S++  ++S  ++ + +E   L  ++K+L  E  E RA+ E+  +  +   R +++Q++E  +T R +E E +S+K QL   +KEL     +N+ L    ++++R    L +R  EL    K++++ +KLE+AK K ++ER++D + ++++ ++ +  +      + +  L E++  + R+  + KE  + ++  L++E+L+LE++++ LE    E  +    ++S  EEK   A+  E    +E +  + K++  VS I+ L+
Sbjct:    2 LAELRGELLDKTREAEELKLKVLSPQKLELLKIQILEEQEAPIKERYRQLEEEAEKYRGDYNKLRYELTLLRAEFDHQKEEHERVLQERRIKYEAEILQLEREKKELHDQIMSVDPTRDSKRVEVLLREKAQLYQKLKSLEAETTELRAERENYGSQAENVQRIQVRQMAENQATIRSLEAEKQSMKLQLERLEKELHESTEQNTILTAKLHKMEREVNALSSRTGELKYSHKMEISNIKLEAAKTKNEVERERDKVQSQLDVMQTENGILKATLDRQKEILAEKDRELIRKVQAAKEAGFQQIVTLQDERLQLENRIAELERYKVEHDSQKQTEISQIEEKLHIAQTAEESTRRELQSLRSKHQQQVSYIEQLQ 376          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Xenopus
Match: cep83 (centrosomal protein 83kDa [Source:NCBI gene;Acc:100145346])

HSP 1 Score: 58.5362 bits (140), Expect = 3.268e-8
Identity = 38/106 (35.85%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1784 KQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIMQS-------ANPSSF-------SVDTPF---HESRYEQSLEQLKRRLEILD 2047
            K QK+++L+ A K+E+ A+  +L R NVP E+F +L + LKDL++RH E+R++I+          NP SF         D  F    E ++++ L  L++RLE L+
Sbjct:  569 KLQKKIELLEATKEELEAQKHVLNRQNVPHEEFGRLQKRLKDLQRRHNEFRSLILGPNISASGLLNPVSFLSSTVVPGADLSFINAQEEQHQRELSLLRKRLEDLE 674          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Xenopus
Match: cep83 (centrosomal protein 83kDa [Source:NCBI gene;Acc:100145346])

HSP 1 Score: 58.5362 bits (140), Expect = 3.436e-8
Identity = 38/106 (35.85%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1784 KQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIMQS-------ANPSSF-------SVDTPF---HESRYEQSLEQLKRRLEILD 2047
            K QK+++L+ A K+E+ A+  +L R NVP E+F +L + LKDL++RH E+R++I+          NP SF         D  F    E ++++ L  L++RLE L+
Sbjct:  567 KLQKKIELLEATKEELEAQKHVLNRQNVPHEEFGRLQKRLKDLQRRHNEFRSLILGPNISASGLLNPVSFLSSTVVPGADLSFINAQEEQHQRELSLLRKRLEDLE 672          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Xenopus
Match: cep83 (centrosomal protein 83kDa [Source:NCBI gene;Acc:100145346])

HSP 1 Score: 58.5362 bits (140), Expect = 3.471e-8
Identity = 38/106 (35.85%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1784 KQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIMQS-------ANPSSF-------SVDTPF---HESRYEQSLEQLKRRLEILD 2047
            K QK+++L+ A K+E+ A+  +L R NVP E+F +L + LKDL++RH E+R++I+          NP SF         D  F    E ++++ L  L++RLE L+
Sbjct:  569 KLQKKIELLEATKEELEAQKHVLNRQNVPHEEFGRLQKRLKDLQRRHNEFRSLILGPNISASGLLNPVSFLSSTVVPGADLSFINAQEEQHQRELSLLRKRLEDLE 674          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Mouse
Match: Cep83 (centrosomal protein 83 [Source:MGI Symbol;Acc:MGI:1924298])

HSP 1 Score: 176.792 bits (447), Expect = 4.288e-46
Identity = 188/685 (27.45%), Postives = 350/685 (51.09%), Query Frame = 2
Query:  110 LNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSV-------------SEIKSLKVNLNEAKTKIIQQEAELDECYNRLA-MSELTKKEKKDLQQQV----TDLTKQLKEITSQ--------HENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM-------QSANPSSF--SVDTPFHESRYEQSL--EQLKRRLEIL 2044
                G  R N E E     Q +L DE+ R   HK NYQ +K E  + QE Y + ++E       ++    ++Q+ +  L  +LV+  R+IE +++  +T +++E+++ +++++ E+   ER      E E  + +  KLR E TFLK+EF+HQ +E  R+ EE K+ ++SEV  L  DK  L     S++  ++S  ++++ +E   L  ++K+L  E+ E RA+ E+  A  +   R +++QL+E  +T R +E E +S K Q    +KEL S N +N+ L    +  DR    L + + EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +  +     +  L E++  + R+  + KE  + ++  L++EKLELE+++S+LE    E       +    EEK R ++  E  A +E +  + K +  +             SE+K    +L    T + Q E +L    + L  M E  K+E ++L+ Q      D+ K L+E   Q        HE + TD++ +  Q + + Q+                       +++   H N  ++ Q++++++ A K+E+  E ++L R NVP E++ +L + LKD+++RH E+R++I+        S +P++F  +V  P  E  +   L  EQ +R L +L
Sbjct:    8 FPPGGDSRLNPEPE----FQNMLIDERVRCEHHKHNYQALKIEHKRLQEEYVKSQNELKRVLIEKQASQEKFQLLLEDLRGELVEKARDIEKMKLQVLTPQKLELVKAQLQQELEAPMRERFRTLDEEVERYRAEYNKLRYEYTFLKSEFEHQKEEFTRVSEEEKMKYKSEVARLEKDKEELHNQLLSVDPTRDSKRMEQLVREKTHLLQKLKSLEAEVAELRAEKENSGAQVENVQRIQVRQLAEMQATLRSLEAEKQSAKLQAERLEKELQSSNEQNTCLISKLHRADREISTLASEVKELKHANKLEITDIKLEAARAKSELERERNKIQSELDGLQSDNEILKSTVEHHKALLVEKDRELIRKVQAAKEEGYQKLMVLQDEKLELENRLSDLEKMKVERDVWRQSEKEQCEEKLRASQMAEEAARRELQSTRLKLQQQIVNTEKAEKEKLENSELKQQISHLQIQVTSLTQSENDLLNSNHMLKDMVERLKQECRNLRSQAEKAQLDVEKTLEEKQIQWLEEKHKLHERI-TDREEKYNQAKEKLQRAATAQ------------------KKRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEEYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASISPANFQSAVTVPGAELSFPPHLQEEQHQRELSLL 669          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Mouse
Match: Lama1 (laminin, alpha 1 [Source:MGI Symbol;Acc:MGI:99892])

HSP 1 Score: 58.151 bits (139), Expect = 5.417e-8
Identity = 83/370 (22.43%), Postives = 163/370 (44.05%), Query Frame = 2
Query:  602 KLIHQSEVNTLRSDKARLLASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDL----------------LSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREAS-IKETEWARVQQLENEKLELESQVSNLESTLREEKNSI----SGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIK-----SLKV-NLNEAKTKIIQQEAELDECYNRLAMSELTKKEK-KDLQQQVTDLTKQLKEITSQHENV 1627
            KL    E N+L S+ +  L ++ E+ +E+GS    ++E+N+L   +KA L E  E + +++ ++ N   EL AK ++  + + T        +    QL   + EL  W  +  +        D   +M + R  +L  +A+   ++L+  +     D+E  +++                L+   E L         K   +   L  R  ++ +R +  +KE+   R +Q +   ++L+ ++ NL S  +E  ++I    +  L+   E      +K R   K RE+A    ES+V  ++     SL+V N +E  +++     E ++  +   M+ L    K KD++ Q   L  +LK + +  EN+
Sbjct: 1750 KLKALKEANSLLSNHSEKLQAAEELLKEAGS---KTQESNLLLLLVKANLKEFQEKKLRVQEEQ-NVTSELIAKGREWVDAAGT---HTAAAQDTLTQLEHHRDELLLWARKIRSHVD-----DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLTEEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQ-QGITMKLD-ELKNLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGR---KARELAAAANESAVKTLEDVLALSLRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEENL 2102          
BLAST of centrosomal protein of 83 kDa-like vs. UniProt/SwissProt
Match: sp|Q9D5R3|CEP83_MOUSE (Centrosomal protein of 83 kDa OS=Mus musculus OX=10090 GN=Cep83 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 2.999e-45
Identity = 188/685 (27.45%), Postives = 350/685 (51.09%), Query Frame = 2
Query:  110 LNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSV-------------SEIKSLKVNLNEAKTKIIQQEAELDECYNRLA-MSELTKKEKKDLQQQV----TDLTKQLKEITSQ--------HENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM-------QSANPSSF--SVDTPFHESRYEQSL--EQLKRRLEIL 2044
                G  R N E E     Q +L DE+ R   HK NYQ +K E  + QE Y + ++E       ++    ++Q+ +  L  +LV+  R+IE +++  +T +++E+++ +++++ E+   ER      E E  + +  KLR E TFLK+EF+HQ +E  R+ EE K+ ++SEV  L  DK  L     S++  ++S  ++++ +E   L  ++K+L  E+ E RA+ E+  A  +   R +++QL+E  +T R +E E +S K Q    +KEL S N +N+ L    +  DR    L + + EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +  +     +  L E++  + R+  + KE  + ++  L++EKLELE+++S+LE    E       +    EEK R ++  E  A +E +  + K +  +             SE+K    +L    T + Q E +L    + L  M E  K+E ++L+ Q      D+ K L+E   Q        HE + TD++ +  Q + + Q+                       +++   H N  ++ Q++++++ A K+E+  E ++L R NVP E++ +L + LKD+++RH E+R++I+        S +P++F  +V  P  E  +   L  EQ +R L +L
Sbjct:    8 FPPGGDSRLNPEPE----FQNMLIDERVRCEHHKHNYQALKIEHKRLQEEYVKSQNELKRVLIEKQASQEKFQLLLEDLRGELVEKARDIEKMKLQVLTPQKLELVKAQLQQELEAPMRERFRTLDEEVERYRAEYNKLRYEYTFLKSEFEHQKEEFTRVSEEEKMKYKSEVARLEKDKEELHNQLLSVDPTRDSKRMEQLVREKTHLLQKLKSLEAEVAELRAEKENSGAQVENVQRIQVRQLAEMQATLRSLEAEKQSAKLQAERLEKELQSSNEQNTCLISKLHRADREISTLASEVKELKHANKLEITDIKLEAARAKSELERERNKIQSELDGLQSDNEILKSTVEHHKALLVEKDRELIRKVQAAKEEGYQKLMVLQDEKLELENRLSDLEKMKVERDVWRQSEKEQCEEKLRASQMAEEAARRELQSTRLKLQQQIVNTEKAEKEKLENSELKQQISHLQIQVTSLTQSENDLLNSNHMLKDMVERLKQECRNLRSQAEKAQLDVEKTLEEKQIQWLEEKHKLHERI-TDREEKYNQAKEKLQRAATAQ------------------KKRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEEYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASISPANFQSAVTVPGAELSFPPHLQEEQHQRELSLL 669          
BLAST of centrosomal protein of 83 kDa-like vs. UniProt/SwissProt
Match: sp|Q9Y592|CEP83_HUMAN (Centrosomal protein of 83 kDa OS=Homo sapiens OX=9606 GN=CEP83 PE=1 SV=3)

HSP 1 Score: 174.866 bits (442), Expect = 1.593e-44
Identity = 181/687 (26.35%), Postives = 374/687 (54.44%), Query Frame = 2
Query:   74 YNKMNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSE--------LTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM-------QSANPSSF-------SVDTPF----HESRYEQSLEQLKRRLEILD 2047
            +  M+   +N        L     + S  E QK+L DE+ R   HK NYQ +K+E  + Q  + +L++E       ++ +  + Q+ + +L  +LV+  +++E++++  +T +++E++R +I+++ E+   ER      E E  +    KLR E+TFLK+EF+HQ +E+ RI++E K+ ++SE+  L  DK  L     ++++ ++S  ++++++E   L  ++K L  E+ E +A+ E+  A  +   R +++QL+E  +T R +E E +S   +    +KEL S + +N+ L    ++ +R    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +        +  L E++  + R+  + KE  + ++  L++EKLELE+++++LE    E       +   +EEK R ++  E +  KE +  + K +  +  I++ +   NE  + + QQ + L      LA SE        + K+  + L+Q+  +   Q ++   + E  + +K  Q  +++ +  +RI + EE+ +++ EK +      +++   H N  ++ Q++++++ A K+E+  E ++L R NVP ED+ +L + LKD+++RH E+R++I+        S NP SF       S++ PF     E ++++ L  L++RLE L+
Sbjct:    6 FTDMDTFPNNFPPGGDSGL-----TGSQSEFQKMLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHKAEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQSEKDQYEEKLRASQMAEEITRKELQSVRLKLQQQIVTIENAEKEKNE-NSDLKQQISSLQIQVTSLAQSENDLLNSNQMLKEMVERLKQECRNFRSQAEKAQLEAEKTLEEKQIQWLEEKHKLHERITDREEKYNQAKEKLQRAAIAQKKRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSLLRKRLEELE 686          
BLAST of centrosomal protein of 83 kDa-like vs. UniProt/SwissProt
Match: sp|Q66H89|CEP83_RAT (Centrosomal protein of 83 kDa OS=Rattus norvegicus OX=10116 GN=Cep83 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.288e-42
Identity = 185/680 (27.21%), Postives = 364/680 (53.53%), Query Frame = 2
Query:  110 LNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS--SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSV-------------SEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM-------QSANPSSFS---------VDTPFH--ESRYEQSLEQLKRRLEILD 2047
                G  R N E E     Q +L DE+ R   HK NYQ +K E  + QE Y + ++E       ++    ++Q+ + +L  +LV+  +++E +++  +T +++E+++ +++++ E+   ER      E E  + +  KLR E+TFLK+EF+HQ +E  RI EE K+ ++SEV  L  DK  L     S++  ++S  ++++ +E   L  ++K+L  E+ E RA+ E+  A  +   R +++QL+E  +T R +E E +S K Q    +KEL S N +N+ L    ++ DR    L +++ EL    K+++T +KLE+A+ K ++ER+++ + + ++ L+    +  +     +  L E++  + R+  + KE  + ++  L++EKLELE+++S+LE    E       +    EEK R ++  E  A +E +  + K +  +             SE+K    +L    T + Q E +L      L  +++ K   + L+Q+   L  Q +++  + E  + +K  Q  +++ +  +RI + EE+ +++ EK +      +++   H N  ++ Q++++++ A K+E+  E ++L R NVP E++ +L + LKD+++RH E+R++I+        S NP++F          +  P H  E ++++ L  L++RLE L+
Sbjct:    8 FPPGGDSRLNPEPE----FQSMLIDERVRCEHHKHNYQALKIEHKRLQEEYVKSQNELKRVLNEKQTNQEKFQLLLEELRGELVEKVKDMEAMKLQILTPQKLELVKAQLQQELEAPMRERFRTLDEEVERYRAEYNKLRYEHTFLKSEFEHQKEELTRISEEEKMKYKSEVARLEKDKEELHNQLLSVDPTRDSKRVEQLVREKTHLLQKLKSLEAEVAELRAEKENSGAQVENVQRIQVRQLAEMQATLRSLEAEKQSAKLQAERLEKELQSSNEQNTCLISKLHKADREISTLTSQVKELKHANKLEITDVKLEAARAKSELERERNKIQSELDGLQSDNEILKSTVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLSDLEKMKVEHDVWRQSEKDQCEEKLRASQAAEEAARRELQSIRLKLQQQIVNTEKAEKEKLENSELKQQISHLQIQVTSLTQSENDL------LNSNQMLKDMVERLKQECRHLRSQAEKVQLEVEKTLEEKQIQWLEEKHKLHERITDREEKYNQAKEKLQRAATAQKKRKSLHENKLKRLQEKVEVLEAKKEELETENQVLNRQNVPFEEYTRLQKRLKDIQRRHNEFRSLILVPNMPPAASVNPANFQSSAIVPGVELSFPPHLQEEQHQRELSLLRKRLEELE 677          
BLAST of centrosomal protein of 83 kDa-like vs. UniProt/SwissProt
Match: sp|F1R4Y7|CEP83_DANRE (Centrosomal protein of 83 kDa OS=Danio rerio OX=7955 GN=cep83 PE=3 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 8.438e-42
Identity = 116/386 (30.05%), Postives = 229/386 (59.33%), Query Frame = 2
Query:  146 SESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEI--PQESGS-LKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLE 1294
            + S +E QK+L DE+ R   HK NYQ +K E  + Q+ Y R ++E       R++   + Q+ +++L  +L+D  R++E+L++  +T +R+E++R +++++ E+   ER  +   E E  +++  KLR + TFLK+EFDHQ +EH R++EE ++ H+++V  L  DK   LA+ L+   P   G  ++ + +E   L  +++ L  E+ E RA+  +  A  +   R +++QL+E+ +  + +E E +S++ QL  ++ EL     +N+ L    ++ +R    L ++++E+    K++L+ +KLE  + KG++ER++D+L  ++E L+  + +  +   + +  + E+E  + RR  + +E E  ++  L+ EKLELE+++S LE
Sbjct:   39 TSSDMEFQKMLIDERMRCENHKTNYQTLKVEHTRLQDQYTRAQNELKRLLSDRQVTQEKQQLLLAELRGELLDKTRDLEELKLQVLTPQRLELLRAQVQQELEAPIRERFNKLQEEAENYRSEYNKLRYDLTFLKSEFDHQKEEHARVLEERRIRHEADVARLEHDKED-LATQLQSGDPARDGKRVEALLREKAQLHQRLRGLEAEVTELRAERNNSGAQAENVQRIQIRQLAESQAAVKALEAEKQSIRMQLDRTESELRLSQEQNTLLTGKLHKAEREINSLNSQVEEMKHTHKLELSNVKLECVRSKGELERERDMLQCQVEGLQSDIEVMKSALERNKELISEKEREMVRRVQAAREEEIHKMATLQEEKLELENRLSELE 423          
BLAST of centrosomal protein of 83 kDa-like vs. UniProt/SwissProt
Match: sp|P19137|LAMA1_MOUSE (Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 3.789e-7
Identity = 83/370 (22.43%), Postives = 163/370 (44.05%), Query Frame = 2
Query:  602 KLIHQSEVNTLRSDKARLLASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDL----------------LSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREAS-IKETEWARVQQLENEKLELESQVSNLESTLREEKNSI----SGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIK-----SLKV-NLNEAKTKIIQQEAELDECYNRLAMSELTKKEK-KDLQQQVTDLTKQLKEITSQHENV 1627
            KL    E N+L S+ +  L ++ E+ +E+GS    ++E+N+L   +KA L E  E + +++ ++ N   EL AK ++  + + T        +    QL   + EL  W  +  +        D   +M + R  +L  +A+   ++L+  +     D+E  +++                L+   E L         K   +   L  R  ++ +R +  +KE+   R +Q +   ++L+ ++ NL S  +E  ++I    +  L+   E      +K R   K RE+A    ES+V  ++     SL+V N +E  +++     E ++  +   M+ L    K KD++ Q   L  +LK + +  EN+
Sbjct: 1750 KLKALKEANSLLSNHSEKLQAAEELLKEAGS---KTQESNLLLLLVKANLKEFQEKKLRVQEEQ-NVTSELIAKGREWVDAAGT---HTAAAQDTLTQLEHHRDELLLWARKIRSHVD-----DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLTEEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQ-QGITMKLD-ELKNLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGR---KARELAAAANESAVKTLEDVLALSLRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEENL 2102          
BLAST of centrosomal protein of 83 kDa-like vs. TrEMBL
Match: A0A1S3K008 (centrosomal protein of 83 kDa-like OS=Lingula unguis OX=7574 GN=LOC106177686 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.113e-69
Identity = 204/659 (30.96%), Postives = 355/659 (53.87%), Query Frame = 2
Query:   92 LASNHSLNASGSLRPNFESESI------LELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLA-SSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHK---YESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLA-----MSELTKKEKKDLQQQVTDLTK---QLK-------EITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKK--HGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPF 1987
            +AS+ S   S SL P F S  +       ELQK+LADEK R+ +H+ NYQ +K+E  + Q+ + +L+ E     E  K+    Y+ +I    R+      EIE+L+   VT +R+E+IR++I E+ E  Y E+     SE E  +    KLR E +FLK+E +H+ +E  +++E+MKL H++EV  LR ++  +LA  + +   ++  ++ V +EN+ L+ +IK LL EL E RA+ EH     D   R + KQL+E S+  + +E E ++L+ Q    QKEL S ++  + +    ++L+R N +L+N+++E++ KAKVDL+ +++E  +++GD+ER++D L  ++E+L+ Q+ +      Q    + E+E   A++  S +E EW R  +LE E+LELE+++  +E    +E+          EE+ + A   +  A+KE  + + K   Y+S   +++  +   +E KTKI Q    LD  YN L      +SEL  K +  L    +DL+K   Q+K       ++ +QH     D+  +  +      + +             T+L Q    +K +K  +     K + +LQL+ A   E+  E ++L +NVP E   +L ++LKDL++RH E+R +++     S  + + P 
Sbjct:    1 MASSGSGMVS-SLSPGFTSSPLPKLMQETELQKMLADEKIRSEQHRTNYQMLKAEHTRLQDEHMQLQHEMRRTIEEAKMMQDRYKTQIEMAQRETSAKVAEIEELKTQVVTPQRLEVIRMQIAEEVEGPYREKFTTLDSEVEGYRNQYNKLRYEFSFLKSEMEHEREEQKKLVEDMKLQHEAEVANLRKEREVILARQTTDTAGDAQRVRVVQRENSQLQLKIKGLLTELEEIRAQREHMGMQSDHVSRLQGKQLAEHSANIKALETEKQALRLQCENLQKELTSTSDLYTQMTSKIHQLERDNTVLKNKMEEVSHKAKVDLSNMRMELVRERGDLERERDGLLTKVEDLQAQIDVTKHSMEQQAAAILEKERECAKKVQSAREEEWERTNKLETERLELEAKLQEIERRKIDEEARRHADKERAEEQIKAAHGSQEAAEKECAVLRTKLQQYQSMEMQLEQERSQNSELKTKIHQ----LDTDYNSLLNSEQELSELVNKLQTQLSATASDLSKAREQVKRTEREGDKVLAQHRGAWADEKGELQKRVEELTREL---------EDTHTKLTQATAVQKKRKAQYSKLHTKLKNRLQLLEASLQEVQMERDVLNKNVPQEIHNRLKKQLKDLQRRHNEFRQVLI-----SGTTTNVPI 640          
BLAST of centrosomal protein of 83 kDa-like vs. TrEMBL
Match: A0A210QX33 (Centrosomal protein of 83 kDa OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11554 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.166e-54
Identity = 201/708 (28.39%), Postives = 371/708 (52.40%), Query Frame = 2
Query:   92 LASNHSLNASGSLR--------------------PNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS-SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVS----------EIKSLKVNLNEAKTKI---IQQEAEL-DECYNRLAMSELTKKEKKDLQQQVTDLTK-QLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSV-DTPF-------------------HESRYEQSLEQLKRRLEILD 2047
            +AS+  L ASG +                     P   +E+  ELQK+L DE+ R+  H+ NY+Q+K E  + Q+ Y++LEDE     E  KI   +Y+    Q  + L     ++EDLR   VT +R+E++++++ +  E  Y E+  R  +E +  K+   KL+ E  F+K+EF+H   E  RII+E++L H++EV+ LR ++   L     E   +S  ++ + +EN  +  ++K+L  E+ E +A+ E    + D   R + KQ++E +++ + +E E ESL++Q+   Q++L+   + ++ L   ++E++R N +L+N+ DE++ K+KVDLT LK++  KQ+GD+ER +D L+  I++L  +L ++     Q    L E+E   ARR    +E E+ +  +LE+EKL +E+++  +E    +E+     +    EE+ R A  ++ +A++E  + K K   S S          E   LK  +N+ +T++   +  E E+ DE        EL K+E K        LTK QL  I   H+ ++  +      DR++ + R+ ELE +L  + +K +      ++  K+  +  +  + +LQL+ A  +E+  E + L+  VP + + KL ++ KDL++RH E+R  ++ +      ++ D  F                    E ++++ +  LK+RL+++D
Sbjct:    1 MASSSFLGASGGMGLNASLPPLPPSPGQSLAQKLPQLATET--ELQKMLTDERMRSQMHRTNYEQLKQEHRRLQDEYSKLEDEIKHTIEESKIVQEKYKTMYEQARKDLTCKSEQLEDLRSKVVTPQRLEILKMQVVDDMERTYKEKYHRQETELDEYKSSCTKLKYEVAFVKSEFEHGTLESQRIIDELRLQHEAEVSNLRKERELTLTKMKAEGTLDSERVRVLQRENAQIHLKLKSLSTEMEEIQAQREKQSFDVDHLNRVQAKQIAEFTASIKAIETERESLRKQVEQLQRDLSGTGDTHNKLISRTHEVERENILLKNKADEVSHKSKVDLTNLKMDMLKQRGDLERDRDRLANLIDDLTTKLEISKHTVDQQSRSLAEKEREAARRVQGAREEEFEKFTRLESEKLAMETKLQEIERRKIDEEAQKHAQREKTEERIRAAMDQKDIAERELLVIKTKLTHSQSTSDQLERERRENSELKSKVNKVETELSSYMGNEHEMTDENIRLRNQVELLKEEVK--------LTKDQLHRIQDNHDLIVAQQKTAFTDDRTQLELRVHELENKLGIAQKKYQKACTVYKKYKKRSQHVVENTRDRLQLMEAKNEELQLEKKALECCVPQDTYNKLKKQWKDLQRRHGEFRRFLLSTGGLQQVAIGDMSFGSVNLAMDATILPNVSFTEQERKHQEDIRLLKQRLDVVD 698          
BLAST of centrosomal protein of 83 kDa-like vs. TrEMBL
Match: A0A2G8L7N3 (Uncharacterized protein (Fragment) OS=Stichopus japonicus OX=307972 GN=BSL78_06807 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.726e-51
Identity = 147/442 (33.26%), Postives = 255/442 (57.69%), Query Frame = 2
Query:  161 ELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS-SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKAR--NAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKT 1477
            ELQK+LADEK R   HK NYQ +K+E  + Q +  RL+D+     E +K    + Q  +++ N++L +   +I DL+   +T +++E+++LKI E  E  + +RL +   + +  +    KLR ENTFLK+E++H+  E  R++EEMK  H++E+ +LR DK  ++A  S +  Q+   ++ + +EN  L  ++K LL+EL+E RA+ E      D   R + +QLSE ++  + +E E  SLK  +   QKEL S  +E   L    ++L+R N  L+ +L+E T + K++LT+ K+E+ + +G++ER+KD +  ++EEL+ ++ +A +        + E+E   AR+  S++E EW +V QLE E  +L++++   E   +E           FE K++  ++E  ERV + ER     K + S  EI +LK  L + ++
Sbjct:   47 ELQKMLADEKMRCDMHKTNYQTLKAEHTRLQNDMKRLQDDLDRVREEKKTAEEKLQSLLTKANKELAEHAGQIADLKSQVLTPQKLELVKLKISEDMEQPFRDRLTQVCKDLDHFREGYNKLRYENTFLKSEYEHEQAERKRVMEEMKSQHEAEIESLRKDKETIIARYSQDNNQDGEKVRNLHRENAQLNLKLKGLLSELNEIRAQREQAGLQSDHVTRLQARQLSEHATNIKTLETEKNSLKLHMDQLQKELTSSQDEQRILNNKIHDLERQNSELRGQLEETTHQKKLELTKAKMEAVRIRGELEREKDAIVNQLEELKVKVEIAESSLQAQSNLVAEKEKETARKVQSVREEEWEKVSQLETENSDLDARLQEAEKLYKE-----------FEYKSKQESSELDERVHEAER-----KQDESQKEISNLKTKLEQQRS 472          
BLAST of centrosomal protein of 83 kDa-like vs. TrEMBL
Match: W4Z3P5 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.518e-48
Identity = 151/475 (31.79%), Postives = 263/475 (55.37%), Query Frame = 2
Query:   71 QYNKMNL-LASNHSLNASGSL--RPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECS-ECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLAS-SLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGT---KCGQLETQLQ-------EREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSL 1450
            Q+  + L L     L  S  L  RP        ELQK+L DE+ R   HK NYQ IK+E  K Q+  +RL+ E  + + +C+ +E    Q  ++++NR+L     E+E+ R   +T  ++E+I+LKI E  E  + ER  +   + E  +T+  KLR EN+F+K+E++H+  EH R++EE+K+ +++E+  L  DK  ++A  S E   +S  ++ + ++N  L  ++K LL EL E RA+ E      D   R + +QLSE ++  + ++ E ESL+  +    KEL    + + +L   +++L++ N  L++R++E   + K+++T LK+ + K  G++ER+KD L   + ELE +  L  +   K   LE  L        ++E  +AR+  S++E EW R+ +LE EKLELE ++   E    +E++       N +E+ R AE++   A+++ ++ K K E   + +K L
Sbjct:   32 QFAGLGLGLGQPSGLGLSQGLDQRPVTHLNQETELQKMLTDERMRGEMHKTNYQMIKAEHTKLQDENSRLQRELEQVTADCQVMEE-RLQEGVNKINRELAIKCAELEEFRAQALTLDKLELIKLKIAEDLEQPFRERFTQLEQDVEHYRTEFNKLRYENSFIKSEYEHEQAEHKRVVEEIKMQYETEIKNLHRDKEAIVAKYSQENSHDSDKVRTLYRDNAQLNLKVKGLLTELDEIRAQREQSGLQSDHVSRLQARQLSEHATNIKALQSEKESLQLHMEQLTKELGLSQDTHRSLTTKTHDLEKQNMELRSRMEETLHRNKMEITDLKMAAMKTGGELEREKDGL---VNELEGKYALDSSLKAKHEVLEKSLDAQTNAVADKEREVARKVQSVREEEWDRINKLEGEKLELEGRLQEFERLKIDEESQRYADKENGQERIREAEKRCEQAERDLQLIKTKLEHHNTSLKDL 502          
BLAST of centrosomal protein of 83 kDa-like vs. TrEMBL
Match: A0A4W4F7N3 (Centrosomal protein 83 OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.020e-47
Identity = 181/671 (26.97%), Postives = 353/671 (52.61%), Query Frame = 2
Query:  107 SLNASGSLR-------PNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLA--SSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRL---AMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKR-NVPAEDFQKLTRELKDLRKRHQEYRNIIM---QSANPSSFSVDTPFHESRY--------EQSLEQLKRRLEILD 2047
            +L A GS +       P   S S +ELQK+L DE+ R   HK NYQ +K+E  + Q+ Y R + E       ++    + Q+ ++ L  +L+D  RE+E+LR+  VT +R+E+++ +++++ E+   ER ++   E E  +++  KLR + TFLK+EFDHQ +EH RI+EE ++ + +E++ L  +K  L A   S +  ++   ++ + +E   L  +++ L  E+ E RA+ ++  A  +   R +++QL+E+ +  + +E E +SL+ QL    KEL S   +N+ L    ++ +R +  L ++++ +    K++L  +KLE  K +G++ER++D L AR+E L+  L +      + +  L E+E  + RR  + +E E  ++  ++ EKLELE+++S+LE     ++ + + +   +E++ R A+  E     E++       +S +        L+ +++++ +    L EC  RL     S  T+ E+   QQ+   L ++ +    + ++ + D++A+  +   + ++R++       K    T   + +L              Q ++QL+ A  +E+  E  + K+   P E+   L R LK+L++RH E+R +++    S+ P   S+  P  ES +        ++ L  L+RRLE L+
Sbjct:   15 NLEAGGSGKASALLAVPVGLSSSDMELQKLLIDERMRGENHKTNYQTLKAEHTRLQDEYTRAQSECKRLLNEKQAGQEQLQLLLADLRGQLLDKTRELEELRLQVVTPQRLELLKAQVQQEMEAPIRERFSKLEEEAEKYRSEYNKLRYDITFLKSEFDHQREEHERILEERRMRYSAELSRLEREKETLTAQLQSGDPARDGRRVEALLREKAQLHQRLRGLEAEVAELRAERDNSGAQAENVQRIQIRQLAESQAAVKALESEKQSLRMQLERMDKELRSTQEQNTLLTGKLHKAERESNALNSQVEGMHHTHKLELANVKLECVKARGEVERERDTLQARVEGLQCDLEVLKAAMQRNKEMLSEKEREMVRRVQAAREDEIHKMAVIQEEKLELENRLSDLEQQRALQEATGNSQKEEWEDRVRAAQLGEEAVLLEQDYPDRLLVTSCT--------LSHSESELTEANGRLRECLERLREELRSARTQMERT--QQEAERLVEERRVEWLEEKHKLQDREAELHEKHDQAKERLQRAALAQKKRKTMTEAKEKKL--------------QNKIQLLEAKMEELEIEARVAKKYYFPWENNTHLRRRLKELQRRHNEFRRLLLGNQMSSTPLPHSLLIPGPESSFSNLQEEQHQKELSLLQRRLEELE 661          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Cavefish
Match: cep83 (centrosomal protein 83 [Source:NCBI gene;Acc:103039279])

HSP 1 Score: 169.088 bits (427), Expect = 1.587e-43
Identity = 142/488 (29.10%), Postives = 272/488 (55.74%), Query Frame = 2
Query:  107 SLNASGSLR-------PNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARL---LASSLEIPQESGS-LKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSE 1537
            +L + GS R       P   S S +ELQK+L DE+ R  +HK NYQ +K+E  + Q+   R++ E       ++    + Q+ +++L  +L+D  RE+E+L++  +T +R+E+++ +++++ E+   ER ++   E E  ++   KLR + TFLK+EFDHQ +EH RI+EE K+ + +++  L  DK  L   L SS   P   G  ++ + +E   L  +++ L  E+ E RA+ +   A  +   R +++Q++E+ S  + +E E +S++ QL   +KEL S   +N+ L    ++ +R    L ++L+ +    K++L  +KLE  + +G++ER++D L A++E L   L +      + +  L E+E  + RR  + +E E  ++  ++ EKLELE+++S LE     ++ + +     +E++ R A+ +++ A KE +  + K +    +++ L+    E   ++ +Q AEL+   N L+ SE
Sbjct:   15 NLESGGSGRVPTLLGGPGGLSSSDMELQKMLIDERMRCEKHKTNYQTLKAEHTRLQDECTRVQSELKRMLNDKQTGQEKLQLLLAELRGELLDKTRELEELKLQALTPQRLELVKAQVQQEMEAPIRERFSKLEEEAEKYRSQYNKLRYDFTFLKSEFDHQREEHERILEERKIRYSADLARLERDKEELSTQLQSS--DPARDGKRVEALLREKAQLHQRVRGLEAEVAELRAERDSTGAQAENVQRIQIRQIAESQSAVKALESEKQSVRMQLERVEKELRSTLEQNTLLTSKLHKAEREINTLSSQLEGMKHTHKLELANVKLECVRARGEVERERDTLQAQMEGLHSDLEVWKAAVDRNKELLSEKERELVRRVQAAREEEIQKLTAVQEEKLELENRLSELEQQKALQEATGNSLKEEWEDRVRAAQLEKKAAHKELQNIRAKMQQQGLQLEELERQKAET-AELRRQNAELNLQVNTLSHSE 499          
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000390.1 (pep scaffold:Pmarinus_7.0:GL476890:21714:24837:1 gene:ENSPMAG00000000352.1 transcript:ENSPMAT00000000390.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 2.765e-17
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 2
Query:  161 ELQKILADEKKRAAEHKFNYQQIKSE--LNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQV-TEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEV 625
            E+QK+L DE+ R   HK NY+ +K E   ++ Q+   R + E       ++     +Q+ +++L  +L+D  REIE+LR  +    +R+E+++ +I+++ E    ERL R   E E  + +  KLR E T LK+EF+HQ  EH R++EEM L HQ++V
Sbjct:   22 EMQKMLMDERMRCEHHKTNYRTLKEEHTRHRLQDESLRTQAELKRVVTDKQSLQERFQLMVTELRGELLDKTREIEELRSQRCRPHQRLELLKAQIQQELELPMRERLRRQEEEAERYRGEFNKLRYEQTVLKSEFEHQRAEHGRVLEEMLLKHQAQV 179          
BLAST of centrosomal protein of 83 kDa-like vs. Planmine SMEST
Match: SMESG000033227.1 (SMESG000033227.1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 342/343 (99.71%), Postives = 343/343 (100.00%), Query Frame = 2
Query:   83 MNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWXXXXXXXXXXXXXXDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARI 1111
            MNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWNNENSNLQFNSNELDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQK+LLSARI
Sbjct:    1 MNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIKSELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIEDLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRTENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEIPQESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQLSETSSTCRKMELEIESLKQQLVTSQKELASWNNENSNLQFNSNELDRANRMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKNLLSARI 343          
BLAST of centrosomal protein of 83 kDa-like vs. Planmine SMEST
Match: SMESG000033225.1 (SMESG000033225.1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 346/359 (96.38%), Postives = 351/359 (97.77%), Query Frame = 2
Query: 1076 IERQKDLLSARIEELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKXXXXXXXXXXXXXXXKGDFEKPEAIYGPGGDNI 2152
            + +Q+ +    I ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQ ERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKQQQQLPEVLQLQEVEKGDFEKPEA+YGPGGDNI
Sbjct:    4 LNKQRKISKHSIYELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQMERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKQQQQLPEVLQLQEVEKGDFEKPEAMYGPGGDNI 362          
BLAST of centrosomal protein of 83 kDa-like vs. Planmine SMEST
Match: SMESG000033225.1 (SMESG000033225.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 344/346 (99.42%), Postives = 345/346 (99.71%), Query Frame = 2
Query: 1115 ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKXXXXXXXXXXXXXXXKGDFEKPEAIYGPGGDNI 2152
            ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQ ERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKQQQQLPEVLQLQEVEKGDFEKPEA+YGPGGDNI
Sbjct:   13 ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQMERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKQQQQLPEVLQLQEVEKGDFEKPEAMYGPGGDNI 358          
BLAST of centrosomal protein of 83 kDa-like vs. Planmine SMEST
Match: SMESG000033225.1 (SMESG000033225.1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 344/346 (99.42%), Postives = 345/346 (99.71%), Query Frame = 2
Query: 1115 ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAXXXXXXXXXXXXIXXXXXXXXXXXXXTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKXXXXXXXXXXXXXXXKGDFEKPEAIYGPGGDNI 2152
            ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQ ERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKQQQQLPEVLQLQEVEKGDFEKPEA+YGPGGDNI
Sbjct:   10 ELEYQLRLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQVSNLESTLREEKNSISGKLSNFEEKARNAEQMERVADKEREIAKHKYESSVSEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTDLTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRLLQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQKLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRRLEILDEKQQQQLPEVLQLQEVEKGDFEKPEAMYGPGGDNI 355          
The following BLAST results are available for this feature:
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP833.318e-4526.35centrosomal protein 83 [Source:HGNC Symbol;Acc:HGN... [more]
CEP833.318e-4526.35centrosomal protein 83 [Source:HGNC Symbol;Acc:HGN... [more]
CEP832.823e-3126.82centrosomal protein 83 [Source:HGNC Symbol;Acc:HGN... [more]
CEP832.072e-2927.51centrosomal protein 83 [Source:HGNC Symbol;Acc:HGN... [more]
CEP833.745e-2128.21centrosomal protein 83 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep836.160e-4330.05centrosomal protein 83 [Source:NCBI gene;Acc:10000... [more]
cep831.157e-4230.05centrosomal protein 83 [Source:NCBI gene;Acc:10000... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep837.915e-3728.41centrosomal protein 83kDa [Source:NCBI gene;Acc:10... [more]
cep835.088e-2827.47centrosomal protein 83kDa [Source:NCBI gene;Acc:10... [more]
cep833.268e-835.85centrosomal protein 83kDa [Source:NCBI gene;Acc:10... [more]
cep833.436e-835.85centrosomal protein 83kDa [Source:NCBI gene;Acc:10... [more]
cep833.471e-835.85centrosomal protein 83kDa [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cep834.288e-4627.45centrosomal protein 83 [Source:MGI Symbol;Acc:MGI:... [more]
Lama15.417e-822.43laminin, alpha 1 [Source:MGI Symbol;Acc:MGI:99892][more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D5R3|CEP83_MOUSE2.999e-4527.45Centrosomal protein of 83 kDa OS=Mus musculus OX=1... [more]
sp|Q9Y592|CEP83_HUMAN1.593e-4426.35Centrosomal protein of 83 kDa OS=Homo sapiens OX=9... [more]
sp|Q66H89|CEP83_RAT1.288e-4227.21Centrosomal protein of 83 kDa OS=Rattus norvegicus... [more]
sp|F1R4Y7|CEP83_DANRE8.438e-4230.05Centrosomal protein of 83 kDa OS=Danio rerio OX=79... [more]
sp|P19137|LAMA1_MOUSE3.789e-722.43Laminin subunit alpha-1 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K0081.113e-6930.96centrosomal protein of 83 kDa-like OS=Lingula ungu... [more]
A0A210QX333.166e-5428.39Centrosomal protein of 83 kDa OS=Mizuhopecten yess... [more]
A0A2G8L7N35.726e-5133.26Uncharacterized protein (Fragment) OS=Stichopus ja... [more]
W4Z3P55.518e-4831.79Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A4W4F7N31.020e-4726.97Centrosomal protein 83 OS=Electrophorus electricus... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep831.587e-4329.10centrosomal protein 83 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000390.12.765e-1736.08pep scaffold:Pmarinus_7.0:GL476890:21714:24837:1 g... [more]
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 83 kDa-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000033227.10.000e+099.71SMESG000033227.1[more]
SMESG000033225.10.000e+096.38SMESG000033225.1[more]
SMESG000033225.10.000e+099.42SMESG000033225.1[more]
SMESG000033225.10.000e+099.42SMESG000033225.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017333 ID=SMED30017333|Name=centrosomal protein of 83 kDa-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2307bp
TAGCGATAGTCATATTTAATTTTTTTTATTCGTGTAATTTTATGATTATT
TGCAAGTACTTTTAACAATACAGTATAATAAAATGAATTTGCTTGCTTCG
AATCATTCTTTGAACGCTTCGGGTTCTTTAAGGCCGAATTTTGAGTCAGA
ATCAATTTTGGAATTGCAAAAAATTCTAGCTGATGAAAAAAAACGAGCTG
CTGAACATAAATTTAATTACCAACAAATAAAATCGGAATTAAATAAGTTT
CAAGAAAATTATGCAAGACTTGAAGATGAATTTGCCGAATGTTCAGAATG
TAGAAAGATTGAAAGTGCTGAATATCAGATTAAAATTAGTCAGCTTAATC
GCAAGTTGGTTGATGCTCAGCGTGAAATTGAAGATTTAAGAATTAATCAA
GTTACGGAAAAAAGAATAGAAATGATTAGATTAAAGATTGAAGAGCAATT
CGAGAGCGTTTATCACGAGAGATTAGCTCGGTGTTCATCTGAATGTGAAG
CAATCAAAACGGATATGATGAAACTACGCACTGAAAATACATTTTTAAAA
GCGGAATTCGATCACCAGTACAAAGAGCATAATCGGATAATTGAAGAAAT
GAAACTCATTCATCAATCAGAGGTAAATACTCTCAGAAGTGACAAGGCGA
GACTTTTAGCCAGTAGTTTGGAAATCCCACAAGAATCTGGCAGTTTAAAA
GAAGTTTCTAAGGAAAATAATGTCTTGCGATCGCAAATAAAAGCCTTACT
CAATGAATTACATGAAGCACGTGCCAAAATGGAGCACGATCGAGCAAATT
ACGATCAGGAATTGAGGGCAAAACTAAAGCAATTATCCGAGACATCTTCA
ACATGCAGGAAAATGGAGCTAGAAATAGAAAGTCTAAAACAGCAACTCGT
CACTAGTCAAAAAGAATTGGCATCGTGGAACAATGAAAACTCAAATTTAC
AGTTCAATTCAAACGAATTAGACCGGGCGAATCGGATGCTACAAAATCGT
CTTGACGAGTTGACTCAGAAAGCTAAAGTCGATCTTACTCAATTGAAATT
AGAATCCGCGAAGCAGAAAGGAGATATCGAGAGGCAAAAAGATTTATTAT
CTGCGAGAATAGAAGAACTTGAATATCAACTGCGACTTGCTGGTACGAAG
TGTGGACAGTTAGAAACTCAATTGCAAGAACGAGAAGTGTCAATTGCTCG
TAGAGAAGCCTCAATTAAAGAAACTGAATGGGCTCGAGTTCAACAATTGG
AAAATGAAAAATTGGAGCTTGAAAGTCAAGTGAGCAATTTAGAATCGACA
TTAAGGGAAGAAAAGAATTCTATTTCGGGAAAACTCTCCAATTTTGAAGA
GAAAGCAAGAAATGCGGAACAAAAGGAACGGGTGGCTGATAAAGAACGAG
AAATCGCCAAGCATAAATATGAATCATCAGTTTCAGAAATAAAAAGTTTA
AAAGTTAATTTGAATGAAGCTAAAACTAAAATCATTCAACAAGAAGCAGA
ATTGGATGAGTGTTACAACAGACTGGCTATGTCTGAATTGACCAAGAAGG
AAAAGAAAGATTTGCAACAACAGGTCACTGATCTCACAAAGCAACTAAAG
GAAATCACCTCTCAGCATGAAAATGTTATGACTGACAAGGATGCTCAGTC
GTTTCAAGACCGTTCAAGATTTCAACAAAGAATAAAAGAGTTAGAAGAAG
AGTTATCCAAAAGTTTAGAAAAGACGAGATTGCTACAGGATGAGCTACGA
AGAAAAAACAAGAAACATGGTAATTATTTCCAGAAACAGCAGAAACAACT
CCAGTTGATAACTGCGATGAAAGATGAAATGGGTGCGGAAATGGAAATTC
TCAAGCGCAATGTTCCGGCTGAAGATTTTCAAAAGTTAACGCGTGAGCTT
AAAGATTTACGTAAGCGTCATCAGGAATATCGTAATATTATCATGCAATC
TGCCAATCCATCATCTTTCAGTGTTGATACTCCTTTCCATGAGTCTCGAT
ATGAGCAAAGCTTGGAACAGTTAAAAAGGCGTCTCGAGATTCTAGATGAG
AAGCAGCAACAACAATTGCCTGAAGTATTACAATTACAGGAAGTAGAAAA
GGGTGATTTCGAGAAACCAGAAGCGATATATGGTCCGGGTGGTGACAATA
TCTGACAAGATTTATTATTATAACTATATATCATATAGATGTATTTCATG
GCATTTTCTTTGATAATCACGATCTTTGTTTTTATTATTTGTTTCCAGCA
ACACTAATCCATCAGTGATATATGATTGTATACTCATAATTTTGTGTAAG
ATCTAGC
back to top

protein sequence of SMED30017333-orf-1

>SMED30017333-orf-1 ID=SMED30017333-orf-1|Name=SMED30017333-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=691bp
MNLLASNHSLNASGSLRPNFESESILELQKILADEKKRAAEHKFNYQQIK
SELNKFQENYARLEDEFAECSECRKIESAEYQIKISQLNRKLVDAQREIE
DLRINQVTEKRIEMIRLKIEEQFESVYHERLARCSSECEAIKTDMMKLRT
ENTFLKAEFDHQYKEHNRIIEEMKLIHQSEVNTLRSDKARLLASSLEIPQ
ESGSLKEVSKENNVLRSQIKALLNELHEARAKMEHDRANYDQELRAKLKQ
LSETSSTCRKMELEIESLKQQLVTSQKELASWNNENSNLQFNSNELDRAN
RMLQNRLDELTQKAKVDLTQLKLESAKQKGDIERQKDLLSARIEELEYQL
RLAGTKCGQLETQLQEREVSIARREASIKETEWARVQQLENEKLELESQV
SNLESTLREEKNSISGKLSNFEEKARNAEQKERVADKEREIAKHKYESSV
SEIKSLKVNLNEAKTKIIQQEAELDECYNRLAMSELTKKEKKDLQQQVTD
LTKQLKEITSQHENVMTDKDAQSFQDRSRFQQRIKELEEELSKSLEKTRL
LQDELRRKNKKHGNYFQKQQKQLQLITAMKDEMGAEMEILKRNVPAEDFQ
KLTRELKDLRKRHQEYRNIIMQSANPSSFSVDTPFHESRYEQSLEQLKRR
LEILDEKQQQQLPEVLQLQEVEKGDFEKPEAIYGPGGDNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029631Cep83
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0048278vesicle docking
Vocabulary: cellular component
TermDefinition
GO:0005814centriole
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 527..554
NoneNo IPR availableCOILSCoilCoilcoord: 637..657
NoneNo IPR availableCOILSCoilCoilcoord: 39..73
NoneNo IPR availableCOILSCoilCoilcoord: 484..511
NoneNo IPR availableCOILSCoilCoilcoord: 386..480
NoneNo IPR availableCOILSCoilCoilcoord: 251..285
NoneNo IPR availableCOILSCoilCoilcoord: 293..313
NoneNo IPR availableCOILSCoilCoilcoord: 78..105
NoneNo IPR availableCOILSCoilCoilcoord: 205..243
NoneNo IPR availableCOILSCoilCoilcoord: 329..349
NoneNo IPR availableCOILSCoilCoilcoord: 599..619
NoneNo IPR availablePANTHERPTHR23170NY-REN-58 ANTIGENcoord: 22..665
IPR029631Centrosomal protein of 83kDaPANTHERPTHR23170:SF2CENTROSOMAL PROTEIN OF 83 KDAcoord: 22..665