SMED30017325

Overview
NameSMED30017325
Smed IDSMED30017325
Length (bp)964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017325 (SMED30017325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017325 (SMED30017325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017325SMESG000071684.1 SmedASXL_073689SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017325SMESG000071684.1 SmedASXL_073690SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30017325SMESG000071684.1 dd_Smed_v4_22114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017325SMESG000071684.1 dd_Smed_v4_22114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017325SMESG000071684.1 dd_Smed_v4_22114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017325SMESG000071684.1 dd_Smed_v6_22114_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30017325 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014311:13749..16358 +4678
v31.003119:49923..54386 +4624
v31.024507:7194..8449 +3365
Homology
BLAST of SMED30017325 vs. Ensembl Xenopus
Match: insc (INSC, spindle orientation adaptor protein [Source:Xenbase;Acc:XB-GENE-995845])

HSP 1 Score: 56.6102 bits (135), Expect = 2.101e-9
Identity = 35/145 (24.14%), Postives = 72/145 (49.66%), Query Frame = 2
Query:  221 LSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFG 655
            L+++   R ++ ++ +  ++ AVDG+ +TD++ + C H+ +E+   WW V+L     +  +VI  R D CS+R+    I    DS+ N + +      +            II L+   +  + +G+  P   + + +CE +V+G
Sbjct:    3 LAQSGDVRQSSDYEPQYGAETAVDGIIETDISIHPCTHT-DEDYGPWWQVDLKKRYKVHTVVIVNRRDCCSERLLEAEIRVG-DSEDNDNPICDTITDV---------SQAIISLSCGGMEGRYVGVVIPGRSEYLTLCEVEVYG 136          
BLAST of SMED30017325 vs. Ensembl Xenopus
Match: ENSXETT00000056154.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:132567663:132575911:-1 gene:ENSXETG00000017677.1 transcript:ENSXETT00000056154.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 9.194e-9
Identity = 35/147 (23.81%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  221 LSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRM--SNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFG 655
            ++R    R ++ ++   +++ A+DG+ +TD++ + C H+ E+N   WW ++L  V  I  +++  R D CS+R+  + + +  S D+       +TN  Q              I L+   L+ + + +  P   + + +CE +VFG
Sbjct:  160 VARLGDVRQSSTYEPHYSAETAIDGIIETDISIHPCTHTFEDNP-AWWRLDLKKVYKIETVLLVNRRDCCSERLLGAEIRVGNSADNDNPVCGAITNVTQ------------ATISLSCDWLLGRYVSVVIPGRAEYLTLCEVEVFG 293          

HSP 2 Score: 56.225 bits (134), Expect = 3.863e-8
Identity = 38/166 (22.89%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  158 QMFQFFIYILAFRFALGLESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFG 655
            + +   +YILA   A        R    R ++ ++   +++ A+DG+ +TD++ + C H+ E+N   WW ++L  V  +  +VI  R D CS+R+    I    DS  N + +    + +             I +    L  + + +  P   + + +CE +V+G
Sbjct:    4 KSYMLDLYILAVNVA--------RLGDVRQSSTYEPHYSAETAIDGIIETDISIHPCTHTFEDNP-AWWRLDLKKVYKVDSVVIVNRRDCCSERLIGAQIRVG-DSADNNNPVCGTIFDV---------SKATITILCNGLEGRYVSVVIPGREEYLTLCEVEVYG 150          

HSP 3 Score: 53.9138 bits (128), Expect = 1.950e-7
Identity = 33/147 (22.45%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  221 LSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRM--SNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFG 655
            ++R    R ++ ++   +++ A+DG+ +TD++ + C H+ ++N   WW ++L  V  +  +VI  R D CS+R+  + + +  S D+       +TN  Q              I L+      + + +  P   + + +CE +V+G
Sbjct:  304 VARLGDVRQSSTYEPHYSAETAIDGIIETDISIHPCTHTFDDNP-AWWRLDLKKVYKVDSVVIVNRRDCCSERLLEAEIRVGNSADNDNPVCGNITNISQ------------ATITLHCNGTEGRYVSVVIPGRAEYLTLCEVEVYG 437          

HSP 4 Score: 52.373 bits (124), Expect = 6.504e-7
Identity = 33/147 (22.45%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  221 LSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRM--SNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFG 655
            ++R    R ++ ++   +++ A+DG+ +TD++ + C H+ E+N   WW ++L  V  +  +VI  R D CS+R+  + + +  S D+       +T+  +              I L    L  + + +  P   + + +CE +V+G
Sbjct:  448 VARLGDVRQSSTYEPHYSAETAIDGIIETDISIHPCTHTFEDNP-AWWRLDLKKVYKVDSVVIVNRRDCCSERLLGAEIRVGNSADNNNPVCGTVTDVSRAA------------ITLFCNWLEGRYVSVVIPGRAEYLSLCEVEVYG 581          
BLAST of SMED30017325 vs. Ensembl Xenopus
Match: ENSXETT00000056156.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:132580024:132587369:-1 gene:ENSXETG00000017677.1 transcript:ENSXETT00000056156.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.497e-7
Identity = 35/150 (23.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  221 LSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGYSYVK 670
            ++R    R ++ ++ +  ++ AVDGV +TD++ + C H++ +N   WW ++L    +I  +VI  R D CS+R+    I    DS  N + +      + +           I L+   +  + + +  P   + + +CE +V G    K
Sbjct:  295 VARLGDVRQSSTYEPQYGAETAVDGVKETDISIHPCTHTMNDNP-AWWRLDLKKRFIIESVVIVNRGDCCSERLLGAEIRVG-DSPDNNNPVCGTITDVSHSP---------ITLSCNGMEGRYVSVVIPGREEYLTLCEVEVNGEESTK 433          
BLAST of SMED30017325 vs. Ensembl Xenopus
Match: ENSXETT00000056155.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:132574908:132586876:-1 gene:ENSXETG00000017677.1 transcript:ENSXETT00000056155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.018e-7
Identity = 31/120 (25.83%), Postives = 59/120 (49.17%), Query Frame = 2
Query:  158 QMFQFFIYILAFRFALGLESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQI 517
            + +   +YILA   A        R    R ++ ++   +++ A+DG+ +TD++ + C H+ E+N   WW ++L  V  +  +VI  R D CS+R+    I    DS  N + +    + +
Sbjct:  452 ESYMLDLYILAVNVA--------RLGDVRQSSTYEPHYSAETAIDGIIETDISIHPCTHTFEDNP-AWWRLDLKKVYKVDSVVIVNRRDCCSERLIGAQIRVG-DSADNNNPVCGTIFDV 561          

HSP 2 Score: 50.8322 bits (120), Expect = 2.068e-6
Identity = 32/144 (22.22%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  221 LSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVF 652
            ++R    R ++ ++ +  ++ AVDGV +TD++ + C H++ +N   WW ++L    +I  +VI  R D CS+R+    I    DS  N + +      + +           I L+   +  + + +  P   + + +CE + +
Sbjct:  322 VARLGDVRQSSTYEPQYGAETAVDGVKETDISIHPCTHTMNDNP-AWWRLDLKKRFIIESVVIVNRGDCCSERLLGAEIRVG-DSPDNNNPVCGTITDVSHSP---------ITLSCNGMEGRYVSVVIPGREEYLTLCEVESY 454          
BLAST of SMED30017325 vs. Ensembl Xenopus
Match: ENSXETT00000033868.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:133949885:134039403:-1 gene:ENSXETG00000007052.1 transcript:ENSXETT00000033868.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.329e-6
Identity = 34/149 (22.82%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  233 RTTRAANYFDAR----MTSDKAVDGVYKTDVNQYSCYHSLEENKD--KWWLVELDVVSVITRIVIYWRTDDCSDRM--SNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFG 655
            R+ +A    D R    + +++A+DG+ +TD+N+  C H+   N+D   WW ++LD    +  +++  R D CS R+  + + +  S D+       +T+  Q              I ++   L  + + +  P   + + +CE +V+G
Sbjct:  178 RSGKARQSSDYRHPSVLMAERAIDGITETDLNKSPCTHT---NRDYQPWWQLDLDKRYQVKSVIVVNRRDCCSQRLLGAQIRVGDSADNNNPVCGTITDVSQAS------------ITVSCHGLEGRYVSVVIPGREEYLTLCEVEVYG 311          
BLAST of SMED30017325 vs. TrEMBL
Match: A0A3Q3GTZ1 (FTP domain-containing protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.706e-9
Identity = 41/150 (27.33%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRL-VAKTIGITKPLPYQSIDMCEFDVFGY 658
            E++  R + T++  Y  A  ++D A+DG   T+    SC H+L E  + WW V+L    ++T +VI  R D C++R++   I      + N          +G     P  ++  +++ FT+L V + + +T   P + + +CE +V+GY
Sbjct:   22 ENVALRGKATQSTRYLHAWSSADNAIDGNRDTNFGSGSCTHTLAE-ANPWWRVDLLESYIVTSLVITNRGDCCAERLNGAEIHIGHSLEDNG----VGNPLVGVISHVPAGRS--LKVTFTKLVVGRYVTVTLTGPEKILSLCEVEVYGY 164          
BLAST of SMED30017325 vs. TrEMBL
Match: G3PGL7 (Uncharacterized protein OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.913e-8
Identity = 42/150 (28.00%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLV-AKTIGITKPLPYQSIDMCEFDVFGY 658
            E++  R + T+++ YF+ R  +D A+DG   +D N  SC H+ EEN + WW V+L     +T IVI  R D  S R++   +               + Y  G        Q  +I L  T     + + +  P   +++ +CE +V+GY
Sbjct:  173 ENVALRGKATQSSRYFNVRAAADNAIDGNRNSDYNSGSCTHTEEEN-NPWWRVDLLYSYTVTSIVISNRADAASLRLNGAKVHVG-----------NSLYDNGAAN-KVTDQGALITLTLTEHAEGRYVTVVLPGSGKTLTLCEVEVYGY 309          
BLAST of SMED30017325 vs. TrEMBL
Match: A0A3Q3H252 (F5/8 type C domain-containing protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.792e-7
Identity = 39/150 (26.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRL-VAKTIGITKPLPYQSIDMCEFDVFGY 658
            E++  R + T++  +     ++D A+DG   T+    SC H+L E  + WW V+L    ++T +VI  R D C++R++   I      + N          +G     P  ++  +++ FT+L V + + +T   P + + +CE +V+GY
Sbjct:   22 ENVALRGKATQSTRHLHPWSSADNAIDGNRDTNSGSGSCTHTLVE-ANPWWRVDLLESYIVTSLVITNRGDCCAERLNGAEIHIGHSLEDNG----VGNPLVGVISHVPAGRS--LKVTFTKLVVGRYVTVTLTGPEKILSLCEVEVYGY 164          
BLAST of SMED30017325 vs. TrEMBL
Match: A0A3Q3GWB8 (F5/8 type C domain-containing protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.844e-7
Identity = 39/150 (26.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRL-VAKTIGITKPLPYQSIDMCEFDVFGY 658
            E++  R + T++  +     ++D A+DG   T+    SC H+L E  + WW V+L    ++T +VI  R D C++R++   I      + N          +G     P  ++  +++ FT+L V + + +T   P + + +CE +V+GY
Sbjct:   34 ENVALRGKATQSTRHLHPWSSADNAIDGNRDTNSGSGSCTHTLVE-ANPWWRVDLLESYIVTSLVITNRGDCCAERLNGAEIHIGHSLEDNG----VGNPLVGVISHVPAGRS--LKVTFTKLVVGRYVTVTLTGPEKILSLCEVEVYGY 176          
BLAST of SMED30017325 vs. TrEMBL
Match: A0A3Q3E6D4 (F5/8 type C domain-containing protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 5.355e-7
Identity = 41/165 (24.85%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRL-VAKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKT 703
            E++  R + T++  +     ++D A+DG   T+    SC H+L E  + WW V+L    ++T +VI  R D C++R++   I      + N          +G     P  ++  +++ FT+L V + + +T   P + + +CE +V+GY     E    +   T
Sbjct:   32 ENVALRGKATQSTRHLHPWSSADNAIDGNRDTNSGSGSCTHTLVE-ANPWWRVDLLESYIVTSLVITNRGDCCAERLNGAEIHIGHSLEDNG----VGNPLVGVISHVPAGRS--LKVTFTKLVVGRYVTVTLTGPEKILSLCEVEVYGYHAPTGENLALQGQAT 189          
BLAST of SMED30017325 vs. Ensembl Cavefish
Match: ENSAMXT00000050908.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30949256:30953032:-1 gene:ENSAMXG00000032389.1 transcript:ENSAMXT00000050908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 5.606e-8
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  284 AVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRM--SNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVF 652
            AVDG   TD  + SC H+L E  + WW VEL  V  +T + I  R D CSDR+  + + I  S  ++ N + L+     IG     P +    +   F     + + I  P   + + +CE  VF
Sbjct:  165 AVDGNTDTDSRRGSCSHTLTE-ANPWWRVELPGVCNVTSVTIVNREDCCSDRIKGAQIHIGNSLKNKGNDNKLVA---VIG-----PTLSEITMTYKFKATRGRFVNIFLPGEDKILSLCEVKVF 280          
BLAST of SMED30017325 vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 4.533e-7
Identity = 40/153 (26.14%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  209 LESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFY---QIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGY 658
            +++L  R + T+++  FD   +  KA+D    T+ +Q SC H++ + ++ WW V+L     IT IVI  R D C+ R+    I          +SL+ N     ++   +  P  ++    L    +  + + +  P   Q + +CE +VFGY
Sbjct:  174 VKNLAPRGKATQSSLAFDGHPS--KAIDKNKDTNYHQGSCTHTVIQ-QNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEIHVG-------NSLINNGNGNPRVEVIKSIPAGKSQTFHLK-KEVSGRYVNLIIPGSNQILTLCEVEVFGY 315          
BLAST of SMED30017325 vs. Planmine SMEST
Match: SMESG000071684.1 (SMESG000071684.1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.489e-147
Identity = 197/199 (98.99%), Postives = 198/199 (99.50%), Query Frame = 2
Query:  269 MTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQFSI 865
            MTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKT+GITKPLP QSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQFSI
Sbjct:    1 MTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTVGITKPLPDQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQFSI 199          
BLAST of SMED30017325 vs. Planmine SMEST
Match: SMESG000024496.1 (SMESG000024496.1)

HSP 1 Score: 187.193 bits (474), Expect = 6.044e-58
Identity = 95/223 (42.60%), Postives = 140/223 (62.78%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFD-------ARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQF 859
            E LLS+NR T ++N +        A M    AVDG    D+ Q SCYHS  E  +KWWLV LD VSVITR+VI+ RTD C +R S L+I+ S++++ N+S+  + FYQI ++ GPP      + +   R+V +TI I KP+  ++I+ CE +V+GY Y +  P IYK   T     +I +IQ    RS+I CA++C+E+++CVSF+ + + +C+ YNH GG F
Sbjct:   18 EILLSKNRITNSSNVYRTDEGDGIASMVPSNAVDGNTNGDIKQNSCYHSKGEMFEKWWLVCLDDVSVITRVVIHSRTDCCYNRTSFLSIYTSYENETNFSTFSSLFYQINFFPGPPSGDKLAVAILLRRVVGRTIVIFKPIKEEAINFCEVEVYGYPYYRSNPSIYKLLGTYPLYSNIPAIQYRTCRSSIECARVCKELESCVSFTFDNNRLCNVYNHAGGNF 240          
BLAST of SMED30017325 vs. Planmine SMEST
Match: SMESG000046835.1 (SMESG000046835.1)

HSP 1 Score: 179.489 bits (454), Expect = 5.756e-53
Identity = 95/218 (43.58%), Postives = 133/218 (61.01%), Query Frame = 2
Query:  218 LLSRNRTTRAANYFD--ARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQFSI 865
            LLSR+R T AAN        TSDKAVDG Y  +++   CYHS E N  KWWLV LD +SV+TR+VIY RT+ C+ R S L+ + S+ +  + S+   +F  I YY GPP    FI  LNFTRL  +T+ I+KP   Q++++CE +V+GY+++K    I+K +       S+ +   F  +SNI CA +C +   C+SFSV   + C  Y H GG+FSI
Sbjct:  191 LLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGYCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYYVGPPPPGEFITTLNFTRLYMRTLAISKPFGEQALNICELEVYGYTFIKKMSMIFKYFGRQSLYDSLGNFGTFPVQSNIDCAIICLQEAKCLSFSVQFGVSCFIYAHIGGEFSI 408          
BLAST of SMED30017325 vs. Planmine SMEST
Match: SMESG000046841.1 (SMESG000046841.1)

HSP 1 Score: 173.711 bits (439), Expect = 1.015e-52
Identity = 91/228 (39.91%), Postives = 131/228 (57.46%), Query Frame = 2
Query:  182 ILAFRFALGLESLLSRNRTTRAANYFDAR--MTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQF 859
            +  F+      +LLSR R T AAN  D +   +SDKAVDG Y  ++    CYHS E N  KWWL+ LD +SV+TR+VIY RT+ C+ R S L+ + S+ +  + S+   +F  + YY G P    FI  LNFTRL A+T+ I+KP   Q  ++CE +V+GY ++K  P  +K  +      S+ +I  F   SN+  A +C +   C+SFSV   + C  Y H GG+F
Sbjct:   13 LFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDGNMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFTNVSYYPGSPPPGEFITTLNFTRLYARTLAISKPFAEQPFNLCELEVYGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDSAMICLQEAKCISFSVQFSVKCFIYAHIGGEF 240          
BLAST of SMED30017325 vs. Planmine SMEST
Match: SMESG000055463.1 (SMESG000055463.1)

HSP 1 Score: 170.629 bits (431), Expect = 1.833e-51
Identity = 87/216 (40.28%), Postives = 130/216 (60.19%), Query Frame = 2
Query:  212 ESLLSRNRTTRAANYFDARMTSDKAVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCSDRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLVAKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSIQQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQF 859
            E LLSRNR T AAN F ++ + DKAVDG Y  ++    CYHS E N  KWWLV LD VSVI RI+IY RTD  ++R   LT++ASF  +LN+S+    FY+  +Y+GPP      +EL++ RL+A+T+ ++KP   ++I++CE +V+GY  +      Y +   GE   S    +    ++NI C  +C     C+SF+   +  C  Y++ GG++
Sbjct:   30 EILLSRNRQTIAANSFYSQYSPDKAVDGEYDGNMFHNKCYHSREINSVKWWLVILDKVSVIKRILIYTRTDGNAERTKTLTLYASFYKELNFSN-EPKFYEFDFYKGPPKSSEIKVELSYLRLIARTVVLSKPFYEEAINICELEVYGYEVLPSLTMTYSSIGFGEKYASTPPFKSEMTKTNIKCGHICSVTLQCLSFTWGNNFQCQLYDNAGGKY 244          
The following BLAST results are available for this feature:
BLAST of SMED30017325 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insc2.101e-924.14INSC, spindle orientation adaptor protein [Source:... [more]
ENSXETT00000056154.19.194e-923.81pep primary_assembly:Xenopus_tropicalis_v9.1:6:132... [more]
ENSXETT00000056156.11.497e-723.33pep primary_assembly:Xenopus_tropicalis_v9.1:6:132... [more]
ENSXETT00000056155.13.018e-725.83pep primary_assembly:Xenopus_tropicalis_v9.1:6:132... [more]
ENSXETT00000033868.13.329e-622.82pep primary_assembly:Xenopus_tropicalis_v9.1:6:133... [more]
back to top
BLAST of SMED30017325 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3GTZ12.706e-927.33FTP domain-containing protein OS=Labrus bergylta O... [more]
G3PGL76.913e-828.00Uncharacterized protein OS=Gasterosteus aculeatus ... [more]
A0A3Q3H2524.792e-726.00F5/8 type C domain-containing protein OS=Labrus be... [more]
A0A3Q3GWB84.844e-726.00F5/8 type C domain-containing protein OS=Labrus be... [more]
A0A3Q3E6D45.355e-724.85F5/8 type C domain-containing protein OS=Labrus be... [more]
back to top
BLAST of SMED30017325 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000050908.15.606e-831.20pep primary_assembly:Astyanax_mexicanus-2.0:2:3094... [more]
ENSAMXT00000008051.24.533e-726.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30017325 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017325 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071684.11.489e-14798.99SMESG000071684.1[more]
SMESG000024496.16.044e-5842.60SMESG000024496.1[more]
SMESG000046835.15.756e-5343.58SMESG000046835.1[more]
SMESG000046841.11.015e-5239.91SMESG000046841.1[more]
SMESG000055463.11.833e-5140.28SMESG000055463.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017325 ID=SMED30017325|Name=SMED30017325|organism=Schmidtea mediterranea sexual|type=transcript|length=964bp
TGGATGCAAAAAGCAGTTGAAGGAATTTCTTATAACAATAGATGATTCAC
AGTTAGTCTATTTATAAAAAATTATTTAAAAAAAATCATTTTCTTTCAAA
TGAAATTTGATTGGTTAAAAAGTTTCCATAAAAATGTGCAAATTATTAAA
TTTTAATCAAATGTTTCAATTTTTTATTTATATTTTAGCTTTTCGTTTTG
CATTGGGGTTAGAATCTTTGCTGTCACGTAATAGAACCACCAGGGCTGCT
AATTACTTTGATGCAAGGATGACTTCTGACAAAGCTGTTGATGGGGTTTA
TAAAACAGACGTGAACCAATATTCTTGTTATCATAGTCTAGAAGAAAATA
AAGATAAATGGTGGCTCGTTGAGTTGGACGTGGTCTCGGTAATAACGAGA
ATAGTTATTTATTGGAGGACGGATGACTGCAGTGACCGAATGAGCAATCT
TACTATTTTTGCGAGTTTTGATAGTCAGTTGAACTATTCGTCATTGTTAA
CAAACTTTTATCAAATCGGATATTATCAAGGCCCCCCTTTAATGCAAAAT
TTTATTATTGAATTAAATTTTACGAGACTGGTAGCAAAAACTATTGGAAT
AACAAAACCGTTACCATATCAGTCCATAGATATGTGTGAATTCGATGTAT
TCGGATACAGCTATGTAAAATATGAACCATACATCTATAAAAATTATAAA
ACCGGTGAACCAGAATTCAGTATATATTCCATCCAACAATTCAAAGCCAG
ATCAAACATTCACTGCGCAAAGCTGTGTAGAGAAATACAAAATTGCGTAT
CATTCTCGGTAAACAAGGATCTCATTTGCTCTTTTTATAATCATGGCGGT
GGTCAATTCTCGATATGAGATCATTAGACTTTGAATTTCTCGATCTTAAA
CTTAATATTAATAAACTATTTATTTTAATTAGTAGTACACTATGAGCGCA
CCAGTCCACTACCC
back to top

protein sequence of SMED30017325-orf-1

>SMED30017325-orf-1 ID=SMED30017325-orf-1|Name=SMED30017325-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MCKLLNFNQMFQFFIYILAFRFALGLESLLSRNRTTRAANYFDARMTSDK
AVDGVYKTDVNQYSCYHSLEENKDKWWLVELDVVSVITRIVIYWRTDDCS
DRMSNLTIFASFDSQLNYSSLLTNFYQIGYYQGPPLMQNFIIELNFTRLV
AKTIGITKPLPYQSIDMCEFDVFGYSYVKYEPYIYKNYKTGEPEFSIYSI
QQFKARSNIHCAKLCREIQNCVSFSVNKDLICSFYNHGGGQFSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000421FA58C
IPR008979Galactose-bd-like_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 30..176
e-value: 4.5E-22
score: 80.5
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 23..176
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 40..235
NoneNo IPR availableTMHMMTMhelixcoord: 10..32