E3 ubiquitin-protein ligase TRAF7

Overview
NameE3 ubiquitin-protein ligase TRAF7
Smed IDSMED30017322
Length (bp)378
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase TRAF7 (SMED30017322) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRAF7 (SMED30017322) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase TRAF7 (SMED30017322) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRAF7 (SMED30017322) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017322

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017322SMESG000069927.1 dd_Smed_v4_14318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017322SMESG000069927.1 dd_Smed_v4_14318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: MAPKBP1 (mitogen-activated protein kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:29536])

HSP 1 Score: 48.1358 bits (113), Expect = 8.825e-7
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLI 183
            T   +KN+ IF+ ++GE + ++ GH   V G+  ++   HL+SV+ D CI +W L  +  I
Sbjct:  672 TSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTI 732          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: MAPKBP1 (mitogen-activated protein kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:29536])

HSP 1 Score: 48.1358 bits (113), Expect = 8.918e-7
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLI 183
            T   +KN+ IF+ ++GE + ++ GH   V G+  ++   HL+SV+ D CI +W L  +  I
Sbjct:  672 TSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTI 732          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: MAPKBP1 (mitogen-activated protein kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:29536])

HSP 1 Score: 48.1358 bits (113), Expect = 8.919e-7
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLI 183
            T   +KN+ IF+ ++GE + ++ GH   V G+  ++   HL+SV+ D CI +W L  +  I
Sbjct:  678 TSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTI 738          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: PLRG1 (pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HGNC:9089])

HSP 1 Score: 47.3654 bits (111), Expect = 1.125e-6
Identity = 25/101 (24.75%), Postives = 53/101 (52.48%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  212 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 306          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: PLRG1 (pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HGNC:9089])

HSP 1 Score: 47.3654 bits (111), Expect = 1.128e-6
Identity = 25/101 (24.75%), Postives = 53/101 (52.48%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  221 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 315          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Match: lis-1 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9NDC9])

HSP 1 Score: 54.6842 bits (130), Expect = 1.438e-9
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGS-DAEIKIY 282
            +G+ +++I+ +NINTG+ LF+L  H   V GL       +L+SVADD  + +WEL  +  +++I    ++ +           I GS D   K++
Sbjct:  307 SGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVW 401          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 49.6766 bits (117), Expect = 8.373e-8
Identity = 22/71 (30.99%), Postives = 42/71 (59.15%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYC 213
            +G+ +K I+I++++ G  L +L+GH   V GL       +LVS +DD  I +W+L  K  ++++    ++C
Sbjct:  314 SGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFC 384          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0304747)

HSP 1 Score: 49.6766 bits (117), Expect = 8.373e-8
Identity = 22/71 (30.99%), Postives = 42/71 (59.15%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYC 213
            +G+ +K I+I++++ G  L +L+GH   V GL       +LVS +DD  I +W+L  K  ++++    ++C
Sbjct:  314 SGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFC 384          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087240)

HSP 1 Score: 49.6766 bits (117), Expect = 8.373e-8
Identity = 22/71 (30.99%), Postives = 42/71 (59.15%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYC 213
            +G+ +K I+I++++ G  L +L+GH   V GL       +LVS +DD  I +W+L  K  ++++    ++C
Sbjct:  314 SGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFC 384          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087236)

HSP 1 Score: 49.6766 bits (117), Expect = 8.373e-8
Identity = 22/71 (30.99%), Postives = 42/71 (59.15%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYC 213
            +G+ +K I+I++++ G  L +L+GH   V GL       +LVS +DD  I +W+L  K  ++++    ++C
Sbjct:  314 SGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFC 384          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: Prp19 (gene:FBgn0261119 transcript:FBtr0086723)

HSP 1 Score: 47.7506 bits (112), Expect = 4.034e-7
Identity = 22/93 (23.66%), Postives = 46/93 (49.46%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSI--IGDVLFICGSDAEI 273
            TGT +  ++I+++    ++ +  GH   ++ +  +    +L + ADD C+ +W+L +    ++I +   Y  K +     G  L I GSD  +
Sbjct:  367 TGTVDSQVKIWDLKEQSNVANFPGHTGPISAISFSENGYYLATAADDACVKLWDLRKLKNFKTIQLDDGYEVKDLCFDQSGTYLAIAGSDVRV 459          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 48.9062 bits (115), Expect = 3.034e-7
Identity = 22/55 (40.00%), Postives = 33/55 (60.00%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWEL 165
            T   +KNI IF+  TGE + ++ GH   V G+  T+   HL++V+ D CI +W L
Sbjct:  678 TSCSDKNISIFDFYTGECVATMFGHSEVVTGMKFTNDCRHLITVSGDSCIFVWRL 732          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 46.595 bits (109), Expect = 1.354e-6
Identity = 25/96 (26.04%), Postives = 53/96 (55.21%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+    ++ + Y       I DVL  C  DA  +++
Sbjct:  212 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTI-DVLVTCSRDATARVW 306          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 46.595 bits (109), Expect = 1.356e-6
Identity = 25/96 (26.04%), Postives = 53/96 (55.21%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+    ++ + Y       I DVL  C  DA  +++
Sbjct:  218 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTI-DVLVTCSRDATARVW 312          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: wdr62 (WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-060503-291])

HSP 1 Score: 46.2098 bits (108), Expect = 2.255e-6
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRK 174
            T   +KNI +F+  +GE + +L GH   V G+  +    HL++V+ D C+ +W LD +
Sbjct:  683 TSCSDKNICVFDYESGECVATLFGHSEIVTGMKFSQDCRHLITVSGDSCVFVWRLDSQ 740          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: wdr62 (WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-060503-291])

HSP 1 Score: 46.2098 bits (108), Expect = 2.257e-6
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRK 174
            T   +KNI +F+  +GE + +L GH   V G+  +    HL++V+ D C+ +W LD +
Sbjct:  683 TSCSDKNICVFDYESGECVATLFGHSEIVTGMKFSQDCRHLITVSGDSCVFVWRLDSQ 740          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 46.9802 bits (110), Expect = 1.771e-6
Identity = 25/101 (24.75%), Postives = 52/101 (51.49%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++    +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  186 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 280          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 46.9802 bits (110), Expect = 1.782e-6
Identity = 25/101 (24.75%), Postives = 52/101 (51.49%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++    +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  206 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 300          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 46.9802 bits (110), Expect = 1.787e-6
Identity = 25/101 (24.75%), Postives = 52/101 (51.49%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++    +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  214 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 308          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 46.9802 bits (110), Expect = 1.792e-6
Identity = 25/101 (24.75%), Postives = 52/101 (51.49%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++    +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  224 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 318          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 46.9802 bits (110), Expect = 1.805e-6
Identity = 25/101 (24.75%), Postives = 52/101 (51.49%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++    +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  250 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIW 344          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1347004])

HSP 1 Score: 48.1358 bits (113), Expect = 6.121e-7
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLI 183
            T   +KN+ IF+ ++GE + ++ GH   V G+  ++   HL+SV+ D CI +W L  +  I
Sbjct:  673 TSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTI 733          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1347004])

HSP 1 Score: 48.1358 bits (113), Expect = 6.122e-7
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLI 183
            T   +KN+ IF+ ++GE + ++ GH   V G+  ++   HL+SV+ D CI +W L  +  I
Sbjct:  679 TSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTI 739          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Plrg1 (pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI:1858197])

HSP 1 Score: 47.3654 bits (111), Expect = 7.350e-7
Identity = 25/101 (24.75%), Postives = 53/101 (52.48%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  220 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIW 314          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Plrg1 (pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI:1858197])

HSP 1 Score: 47.3654 bits (111), Expect = 7.721e-7
Identity = 25/101 (24.75%), Postives = 53/101 (52.48%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  211 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIW 305          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Plrg1 (pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI:1858197])

HSP 1 Score: 47.3654 bits (111), Expect = 7.742e-7
Identity = 25/101 (24.75%), Postives = 53/101 (52.48%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIG-------DVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ +++   +L S  +D  +  W+L+   +I+      +Y     ++ G       DVL  C  D+  +I+
Sbjct:  220 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR------HYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIW 314          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q42384|PRL1_ARATH (Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana OX=3702 GN=PRL1 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.514e-9
Identity = 29/96 (30.21%), Postives = 56/96 (58.33%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ TG    +L GH+ QV GL +++  T++ S  DD  +  W+L++  +I+S   ++   YC  A+    DVL   G D+  +++
Sbjct:  193 TGSADRTIKIWDVATGVLKLTLTGHIEQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCL-ALHPTLDVLLTGGRDSVCRVW 287          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q39190|PRL2_ARATH (Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana OX=3702 GN=PRL2 PE=2 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 1.246e-8
Identity = 28/96 (29.17%), Postives = 56/96 (58.33%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ TG    +L GH+ QV GL +++  T++ S  DD  +  W+L++  +I+S   ++   YC  A+    DV+   G D+  +++
Sbjct:  187 TGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLHGVYCL-ALHPTLDVVLTGGRDSVCRVW 281          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|A8XZJ9|LIS1_CAEBR (Lissencephaly-1 homolog OS=Caenorhabditis briggsae OX=6238 GN=lis-1 PE=3 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 1.370e-8
Identity = 30/95 (31.58%), Postives = 53/95 (55.79%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGS-DAEIKIY 282
            +G+ +++I+ +NI+TGE +F+L+ H   V GL       +LVSVADD  + IWEL  +  +++I    ++ +       +   I GS D   K++
Sbjct:  293 SGSRDRSIKAWNISTGEVIFTLSAHENWVRGLAFHPKGKYLVSVADDKMMRIWELSAQRCMKAIEAHEHFVSTVAFHQTNPYVITGSVDMSCKVW 387          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q9NDC9|LIS1_CAEEL (Lissencephaly-1 homolog OS=Caenorhabditis elegans OX=6239 GN=lis-1 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.829e-8
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGS-DAEIKIY 282
            +G+ +++I+ +NINTG+ LF+L  H   V GL       +L+SVADD  + +WEL  +  +++I    ++ +           I GS D   K++
Sbjct:  307 SGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVW 401          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q17N69|LIS1_AEDAE (Lissencephaly-1 homolog OS=Aedes aegypti OX=7159 GN=AAEL000770 PE=3 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 1.528e-7
Identity = 26/95 (27.37%), Postives = 52/95 (54.74%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGS-DAEIKIY 282
            +G+ +K I+++++N+G  LF+L GH   V G+       +++S +DD  + IW+L  K  ++++   S++C            I GS D  +K++
Sbjct:  312 SGSRDKTIRVWDVNSGLCLFTLVGHDNWVRGIVFHPGGKYMLSASDDKTLRIWDLRNKRCMKTLYAHSHFCTSLDMHKSHPYVISGSVDTTVKVW 406          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A2C9L330 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068930 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.603e-10
Identity = 35/96 (36.46%), Postives = 56/96 (58.33%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRY 288
            +GTYN+NI IFNI+T E + +L GH+  V  L ++ +   L S + D  I +W L++   IQ+++        A+++ GD L     D EIK++RY
Sbjct:  491 SGTYNQNIHIFNIDTHEFVLNLCGHLGTVTTLVISPSGRFLFSASHDSNIQMWGLEKLLPIQTLSRHQG-SVNALTLHGDFLLSGSEDHEIKVFRY 585          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A1S3I5A2 (E3 ubiquitin-protein ligase TRAF7 OS=Lingula unguis OX=7574 GN=LOC106161133 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.044e-10
Identity = 34/98 (34.69%), Postives = 56/98 (57.14%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRM 297
            GTYN+ +Q+F++N+ EH  SL GH+  V GL ++ +   L + +DD  I +W L+    I S++        A+S+ GD L     D EIK++++  M
Sbjct:  451 GTYNRCVQLFDVNSYEHTQSLKGHIGCVRGLVVSPSGRFLFTASDDHTIQVWNLENNLPIMSLSRHEG-PVNALSLHGDFLLSGSDDTEIKVFKHFEM 547          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A2C9L378 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068930 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.724e-10
Identity = 35/95 (36.84%), Postives = 55/95 (57.89%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRY 288
            GTYN+NI IFNI+T E + +L GH+  V  L ++ +   L S + D  I +W L++   IQ+++        A+++ GD L     D EIK++RY
Sbjct:  489 GTYNQNIHIFNIDTHEFVLNLCGHLGTVTTLVISPSGRFLFSASHDSNIQMWGLEKLLPIQTLSRHQG-SVNALTLHGDFLLSGSEDHEIKVFRY 582          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: K1RIF0 (E3 ubiquitin-protein ligase TRAF7 OS=Crassostrea gigas OX=29159 GN=CGI_10011877 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.450e-10
Identity = 36/92 (39.13%), Postives = 53/92 (57.61%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKI 279
            GTYN+NIQ+FN++  +H+FSL GH+  V  L +T +   LVS + D  I IW L+    IQ+++   +    AV +  D L     D EIK+
Sbjct:  487 GTYNRNIQVFNLSNNQHVFSLRGHIGVVTSLTVTPSGHFLVSSSSDQTIMIWNLENMLPIQTLHRHES-GVNAVILFRDFLLSGSEDNEIKV 577          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A1S3I5C6 (E3 ubiquitin-protein ligase TRAF7-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106161152 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 8.032e-10
Identity = 33/98 (33.67%), Postives = 56/98 (57.14%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRM 297
            GTYN+ +Q+F++N+ EH  SL GH+  V GL ++ +   L + +DD  I +W L+    I S++        A+++ GD L     D EIK++++  M
Sbjct:  497 GTYNRCVQLFDVNSYEHTQSLKGHIGCVRGLVVSPSGRFLFTASDDHTIQVWNLENNLPIMSLSRHEG-PVNALTLHGDFLLSGSDDTEIKVFKHFEM 593          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:103030470])

HSP 1 Score: 49.6766 bits (117), Expect = 1.059e-7
Identity = 23/62 (37.10%), Postives = 37/62 (59.68%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQ 186
            T   +KNI IF+  +GE + ++ GH   V G+  T+   HL+SV+ D CI +W L+ +  I+
Sbjct:  672 TSCSDKNISIFDFYSGECVATMFGHSELVTGMKFTNDCKHLISVSGDSCIFVWRLNPELTIK 733          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:103030470])

HSP 1 Score: 49.6766 bits (117), Expect = 1.059e-7
Identity = 23/62 (37.10%), Postives = 37/62 (59.68%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQ 186
            T   +KNI IF+  +GE + ++ GH   V G+  T+   HL+SV+ D CI +W L+ +  I+
Sbjct:  678 TSCSDKNISIFDFYSGECVATMFGHSELVTGMKFTNDCKHLISVSGDSCIFVWRLNPELTIK 739          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: plrg1 (pleiotropic regulator 1 [Source:NCBI gene;Acc:103042237])

HSP 1 Score: 48.1358 bits (113), Expect = 3.766e-7
Identity = 26/96 (27.08%), Postives = 53/96 (55.21%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++S   +L S  +D  +  W+L+   +I+    ++ + Y       I DVL  C  DA  +++
Sbjct:  202 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTI-DVLVTCSRDATARVW 296          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: plrg1 (pleiotropic regulator 1 [Source:NCBI gene;Acc:103042237])

HSP 1 Score: 48.1358 bits (113), Expect = 3.788e-7
Identity = 26/96 (27.08%), Postives = 53/96 (55.21%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++S   +L S  +D  +  W+L+   +I+    ++ + Y       I DVL  C  DA  +++
Sbjct:  221 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTI-DVLVTCSRDATARVW 315          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: ENSAMXT00000006286.2 (mitogen-activated protein kinase-binding protein 1-like [Source:NCBI gene;Acc:103025404])

HSP 1 Score: 47.3654 bits (111), Expect = 7.709e-7
Identity = 22/55 (40.00%), Postives = 32/55 (58.18%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWEL 165
            T   +KNI + + +TGE L ++ GH   +  +  TS   HL+SV+ D CI IW L
Sbjct:  676 TSCSDKNISLLDFSTGECLATMFGHSEIITSIKFTSDCRHLISVSGDSCIFIWRL 730          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 53.9138 bits (128), Expect = 6.425e-10
Identity = 30/96 (31.25%), Postives = 54/96 (56.25%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSI--IGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+ + TG+   SL GH++ V G+ ++S   +L S  +D  I  W+L+   +I+  + G    A A+ +    DVL  CG DA  +++
Sbjct:  230 TGSADRTIKIWELATGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYH-GHLSAAYALDLHPTIDVLVTCGRDATARVW 324          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 43.1282 bits (100), Expect = 4.701e-6
Identity = 20/55 (36.36%), Postives = 31/55 (56.36%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWEL 165
            T   +KN+ +F+  TGE + S  GH   V G+  +    HL+SV+ D C+ +W L
Sbjct:  641 TSCSDKNLTLFDFYTGECVASAFGHSEIVTGMKFSHDCKHLISVSGDSCMFLWRL 695          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 45.8246 bits (107), Expect = 2.630e-7
Identity = 26/96 (27.08%), Postives = 54/96 (56.25%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSI--IGDVLFICGSDAEIKIY 282
            TG+ +  ++++++ TG+   +LAGHV  V  + ++    +L SV++D  +  W+L++  +I+    G     + VSI    D++   G D+ IK++
Sbjct:  157 TGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDY-YGHLSGVRTVSIHPTLDLIATAGRDSVIKLW 251          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Match: DIP2 (Nucleolar protein; specifically associated with the U3 snoRNA, part of the large ribonucleoprotein complex known as the small subunit (SSU) processome, required for 18S rRNA biogenesis, part of the active pre-rRNA processing complex [Source:SGD;Acc:S000004119])

HSP 1 Score: 42.3578 bits (98), Expect = 4.784e-6
Identity = 24/97 (24.74%), Postives = 50/97 (51.55%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYD 291
            +G+ + NI ++++     L+ L  H   + G      E  L+S + DG I +W+L     I++    +  C   +++  D+L   G+D+++KI++ D
Sbjct:  138 SGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTGECW-GLAVKDDLLITTGTDSQVKIWKLD 232          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO33344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI1])

HSP 1 Score: 54.299 bits (129), Expect = 1.038e-9
Identity = 28/96 (29.17%), Postives = 54/96 (56.25%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V GL ++    +L S  +D  +  W+L+   +I+    ++ + Y A     I DVL  CG DA  +++
Sbjct:  226 TGSADRTIKIWDLGSGKLKLSLTGHISTVRGLVVSPRHPYLFSAGEDKLVKCWDLEYNKVIRHYHGHLSAVYDADIHPTI-DVLLTCGRDATTRVW 320          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO46331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB4])

HSP 1 Score: 47.3654 bits (111), Expect = 2.273e-7
Identity = 27/95 (28.42%), Postives = 47/95 (49.47%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTST-ETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            T + +K + +++  TG  +  L GH + VN  C +     ++VS +DD  I +W+  ++   Q+        A A S   D +F  G D EIK++
Sbjct:  118 TASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKLWDTRKRGCAQTFQNVFQVTAVAFSDASDQIFSGGIDNEIKVW 212          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO37089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGX8])

HSP 1 Score: 46.595 bits (109), Expect = 4.226e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDR 294
            GTYN+NI +F++N  +H+ +L  H   V GL ++     L S + D  + +W LD    +Q+++         V +  D+L     D EIK  R  R
Sbjct:  409 GTYNQNIHVFDVNGLQHVKALTTHFGTVTGLVVSG--RLLFSASYDTTVQVWNLDTMLPMQTLS-RHEASVNCVVVHKDLLLSGSEDTEIKESRKLR 502          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 45.8246 bits (107), Expect = 6.643e-7
Identity = 25/96 (26.04%), Postives = 54/96 (56.25%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVG--SNYCAKAVSIIGDVLFICGSDAEIKIY 282
            + + ++ ++I+N+ T  H+ +L GH   V  +C +  +   +S ++D  + IW+L+    ++S+ VG  S+  A AV+  G  +   G D ++K++
Sbjct:  156 SASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSL-VGHTSDIFAVAVTPDGSKVISSGDDTQVKVW 250          

HSP 2 Score: 42.743 bits (99), Expect = 9.430e-6
Identity = 19/56 (33.93%), Postives = 33/56 (58.93%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELD 168
            + +Y+K ++I+++ T   + SL GH   V G+ +TS    LVS + D  + IW L+
Sbjct:  114 SSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLE 169          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO47404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLW2])

HSP 1 Score: 46.2098 bits (108), Expect = 7.483e-7
Identity = 22/94 (23.40%), Postives = 48/94 (51.06%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TGT +  I+I+++    ++    GH   ++ +  +    +L + ADD  + +W+L +    ++IN+   +  KA+S      ++  +  EI+IY
Sbjct:  371 TGTSDSIIKIWDLKERTNVAKFPGHSGPISDITFSENGYYLATSADDSVVKLWDLRKLKNFKTINLADRFEVKALSFDQSGTYLAVAGTEIQIY 464          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: wdr62 (WD repeat-containing protein 62 [Source:NCBI gene;Acc:101162822])

HSP 1 Score: 49.6766 bits (117), Expect = 1.215e-7
Identity = 25/56 (44.64%), Postives = 33/56 (58.93%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELD 168
            T   NKNI++F+  TGE + SL GH   V  L  +   T LVS + D CI +W+LD
Sbjct:  681 TSCSNKNIEVFDYETGECVASLFGHSEAVTCLRFSWDCTRLVSASADSCIFVWKLD 736          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: plrg1 (pleiotropic regulator 1 [Source:NCBI gene;Acc:101163300])

HSP 1 Score: 48.521 bits (114), Expect = 2.814e-7
Identity = 26/96 (27.08%), Postives = 53/96 (55.21%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSI--NVGSNYCAKAVSIIGDVLFICGSDAEIKIY 282
            TG+ ++ I+I+++ +G+   SL GH++ V G+ ++S   +L S  +D  +  W+L+   +I+    ++ + Y       I DVL  C  DA  +++
Sbjct:  217 TGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTI-DVLMTCSRDATARVW 311          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 46.2098 bits (108), Expect = 2.033e-6
Identity = 21/62 (33.87%), Postives = 35/62 (56.45%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQ 186
            T   +KNI IF+  +GE + ++ GH   + GL  +    HL++V+ D CI +W L  +  I+
Sbjct:  679 TSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIR 740          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 46.2098 bits (108), Expect = 2.035e-6
Identity = 21/62 (33.87%), Postives = 35/62 (56.45%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQ 186
            T   +KNI IF+  +GE + ++ GH   + GL  +    HL++V+ D CI +W L  +  I+
Sbjct:  679 TSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIR 740          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 46.2098 bits (108), Expect = 2.036e-6
Identity = 21/62 (33.87%), Postives = 35/62 (56.45%), Query Frame = 1
Query:    1 TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQ 186
            T   +KNI IF+  +GE + ++ GH   + GL  +    HL++V+ D CI +W L  +  I+
Sbjct:  685 TSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIR 746          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 208.764 bits (530), Expect = 1.081e-65
Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMFS 303
            GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMFS
Sbjct:  478 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMFS 577          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.472e-65
Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:    4 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMFS 303
            GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMFS
Sbjct:  482 GTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMFS 581          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.052e-9
Identity = 29/61 (47.54%), Postives = 35/61 (57.38%), Query Frame = 1
Query:    1 TGTY------NKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWEL 165
            +GTY      +K I I N  TGE L S+AGH     GLC      HLVSV+ DGCI +W+L
Sbjct: 1123 SGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKL 1183          

HSP 2 Score: 44.2838 bits (103), Expect = 7.775e-6
Identity = 29/90 (32.22%), Postives = 43/90 (47.78%), Query Frame = 1
Query:    1 TGTYNKN--IQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVA--DDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICG 258
            TG   K+  ++I+++ T   LF  +GH  +V  L  +     +VSV   +D  IN+WEL+  T + S  V S   A A S  G      G
Sbjct:  530 TGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVG 619          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.090e-9
Identity = 29/61 (47.54%), Postives = 35/61 (57.38%), Query Frame = 1
Query:    1 TGTY------NKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWEL 165
            +GTY      +K I I N  TGE L S+AGH     GLC      HLVSV+ DGCI +W+L
Sbjct: 1092 SGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKL 1152          

HSP 2 Score: 44.2838 bits (103), Expect = 7.695e-6
Identity = 29/90 (32.22%), Postives = 43/90 (47.78%), Query Frame = 1
Query:    1 TGTYNKN--IQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVA--DDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICG 258
            TG   K+  ++I+++ T   LF  +GH  +V  L  +     +VSV   +D  IN+WEL+  T + S  V S   A A S  G      G
Sbjct:  499 TGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVG 588          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.094e-9
Identity = 29/61 (47.54%), Postives = 35/61 (57.38%), Query Frame = 1
Query:    1 TGTY------NKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCINIWEL 165
            +GTY      +K I I N  TGE L S+AGH     GLC      HLVSV+ DGCI +W+L
Sbjct: 1160 SGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKL 1220          

HSP 2 Score: 44.2838 bits (103), Expect = 7.707e-6
Identity = 29/90 (32.22%), Postives = 43/90 (47.78%), Query Frame = 1
Query:    1 TGTYNKN--IQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVA--DDGCINIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICG 258
            TG   K+  ++I+++ T   LF  +GH  +V  L  +     +VSV   +D  IN+WEL+  T + S  V S   A A S  G      G
Sbjct:  567 TGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVG 656          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPKBP18.825e-734.43mitogen-activated protein kinase binding protein 1... [more]
MAPKBP18.918e-734.43mitogen-activated protein kinase binding protein 1... [more]
MAPKBP18.919e-734.43mitogen-activated protein kinase binding protein 1... [more]
PLRG11.125e-624.75pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HG... [more]
PLRG11.128e-624.75pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lis-11.438e-930.53Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lis-18.373e-830.99gene:FBgn0015754 transcript:FBtr0087241[more]
Lis-18.373e-830.99gene:FBgn0015754 transcript:FBtr0304747[more]
Lis-18.373e-830.99gene:FBgn0015754 transcript:FBtr0087240[more]
Lis-18.373e-830.99gene:FBgn0015754 transcript:FBtr0087236[more]
Prp194.034e-723.66gene:FBgn0261119 transcript:FBtr0086723[more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapkbp13.034e-740.00mitogen-activated protein kinase binding protein 1... [more]
plrg11.354e-626.04pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
plrg11.356e-626.04pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
wdr622.255e-634.48WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
wdr622.257e-634.48WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stam1.771e-624.75signal transducing adaptor molecule [Source:Xenbas... [more]
stam1.782e-624.75signal transducing adaptor molecule [Source:Xenbas... [more]
stam1.787e-624.75signal transducing adaptor molecule [Source:Xenbas... [more]
stam1.792e-624.75signal transducing adaptor molecule [Source:Xenbas... [more]
stam1.805e-624.75signal transducing adaptor molecule [Source:Xenbas... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapkbp16.121e-734.43mitogen-activated protein kinase binding protein 1... [more]
Mapkbp16.122e-734.43mitogen-activated protein kinase binding protein 1... [more]
Plrg17.350e-724.75pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI... [more]
Plrg17.721e-724.75pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI... [more]
Plrg17.742e-724.75pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q42384|PRL1_ARATH3.514e-930.21Protein pleiotropic regulatory locus 1 OS=Arabidop... [more]
sp|Q39190|PRL2_ARATH1.246e-829.17Protein pleiotropic regulator PRL2 OS=Arabidopsis ... [more]
sp|A8XZJ9|LIS1_CAEBR1.370e-831.58Lissencephaly-1 homolog OS=Caenorhabditis briggsae... [more]
sp|Q9NDC9|LIS1_CAEEL1.829e-830.53Lissencephaly-1 homolog OS=Caenorhabditis elegans ... [more]
sp|Q17N69|LIS1_AEDAE1.528e-727.37Lissencephaly-1 homolog OS=Aedes aegypti OX=7159 G... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9L3302.603e-1036.46Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3I5A23.044e-1034.69E3 ubiquitin-protein ligase TRAF7 OS=Lingula ungui... [more]
A0A2C9L3783.724e-1036.84Uncharacterized protein OS=Biomphalaria glabrata O... [more]
K1RIF07.450e-1039.13E3 ubiquitin-protein ligase TRAF7 OS=Crassostrea g... [more]
A0A1S3I5C68.032e-1033.67E3 ubiquitin-protein ligase TRAF7-like isoform X1 ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapkbp11.059e-737.10mitogen-activated protein kinase-binding protein 1... [more]
mapkbp11.059e-737.10mitogen-activated protein kinase-binding protein 1... [more]
plrg13.766e-727.08pleiotropic regulator 1 [Source:NCBI gene;Acc:1030... [more]
plrg13.788e-727.08pleiotropic regulator 1 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000006286.27.709e-740.00mitogen-activated protein kinase-binding protein 1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plrg16.425e-1031.25pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
mapkbp14.701e-636.36mitogen-activated protein kinase binding protein 1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PRP462.630e-727.08Member of the NineTeen Complex (NTC); this complex... [more]
DIP24.784e-624.74Nucleolar protein; specifically associated with th... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333441.038e-929.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463312.273e-728.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370894.226e-730.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497676.643e-726.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474047.483e-723.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr621.215e-744.64WD repeat-containing protein 62 [Source:NCBI gene;... [more]
plrg12.814e-727.08pleiotropic regulator 1 [Source:NCBI gene;Acc:1011... [more]
mapkbp12.033e-633.87mitogen-activated protein kinase-binding protein 1... [more]
mapkbp12.035e-633.87mitogen-activated protein kinase-binding protein 1... [more]
mapkbp12.036e-633.87mitogen-activated protein kinase-binding protein 1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069927.11.081e-65100.00SMESG000069927.1[more]
SMESG000069927.11.472e-65100.00SMESG000069927.1[more]
SMESG000080852.12.052e-947.54SMESG000080852.1[more]
SMESG000080852.12.090e-947.54SMESG000080852.1[more]
SMESG000080852.12.094e-947.54SMESG000080852.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017322 ID=SMED30017322|Name=E3 ubiquitin-protein ligase TRAF7|organism=Schmidtea mediterranea sexual|type=transcript|length=378bp
ACAGGTACATATAACAAGAATATTCAAATCTTTAATATTAATACTGGAGA
GCATTTGTTTTCTCTGGCGGGACATGTTGCCCAAGTAAATGGATTATGTT
TGACGTCCACTGAAACTCATTTGGTCTCTGTTGCTGATGATGGATGTATT
AATATCTGGGAATTAGATCGAAAAACTCTCATACAATCAATTAATGTTGG
ATCAAATTATTGTGCTAAGGCAGTTTCTATTATTGGGGATGTTTTATTTA
TTTGCGGCAGCGATGCCGAAATAAAAATTTATCGGTATGATCGAATGTTC
TCTTAGCTTTCCATTATTTACTATTAAAATTTCTATTGTCGGTGATTATA
GAGCGATTTATTTAACGATATTTATCTG
back to top

protein sequence of SMED30017322-orf-1

>SMED30017322-orf-1 ID=SMED30017322-orf-1|Name=SMED30017322-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
TGTYNKNIQIFNINTGEHLFSLAGHVAQVNGLCLTSTETHLVSVADDGCI
NIWELDRKTLIQSINVGSNYCAKAVSIIGDVLFICGSDAEIKIYRYDRMF
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0000132establishment of mitotic spindle orientation
GO:0006810transport
GO:0007018microtubule-based movement
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0007100mitotic centrosome separation
GO:0007275multicellular organism development
GO:0007281germ cell development
GO:0007399nervous system development
GO:0008090retrograde axonal transport
GO:0009792embryo development ending in birth or egg hatching
GO:0022008neurogenesis
GO:0030154cell differentiation
GO:0035046pronuclear migration
GO:0040011locomotion
GO:0043652engulfment of apoptotic cell
GO:0047496vesicle transport along microtubule
GO:0048477oogenesis
GO:0048489synaptic vesicle transport
GO:0051026chiasma assembly
GO:0051225spindle assembly
GO:0051301cell division
GO:0051932synaptic transmission, GABAergic
GO:2000574regulation of microtubule motor activity
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0034511U3 snoRNA binding
GO:0046872metal ion binding
GO:0005515protein binding
GO:0008017microtubule binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005818aster
GO:0005856cytoskeleton
GO:0005868cytoplasmic dynein complex
GO:0005874microtubule
GO:0005875microtubule associated complex
GO:0005938cell cortex
GO:0045202synapse
GO:0048471perinuclear region of cytoplasm
GO:1904115axon cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 57..95
e-value: 66.0
score: 5.5
coord: 15..54
e-value: 4.5E-5
score: 32.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 22..63
score: 11.979
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..99
e-value: 1.2E-17
score: 65.8
NoneNo IPR availablePANTHERPTHR44129:SF1LISSENCEPHALY-1 HOMOLOGcoord: 1..95
NoneNo IPR availablePANTHERPTHR44129FAMILY NOT NAMEDcoord: 1..95
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 41..55
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1..63
score: 15.241
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 1..96