Mitochondria localized glutamic acid rich protein

Overview
NameMitochondria localized glutamic acid rich protein
Smed IDSMED30017321
Length (bp)921
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondria localized glutamic acid rich protein (SMED30017321) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondria localized glutamic acid rich protein (SMED30017321) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondria localized glutamic acid rich protein (SMED30017321) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondria localized glutamic acid rich protein (SMED30017321) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017321SMESG000000761.1 SmedASXL_008698SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017321SMESG000000761.1 dd_Smed_v4_6622_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017321SMESG000000761.1 dd_Smed_v4_6622_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017321SMESG000000761.1 dd_Smed_v4_6622_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017321SMESG000000761.1 dd_Smed_v6_6622_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30017321SMESG000000761.1 OX_Smed_1.0.17847ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017321SMESG000000761.1 dd_Smed_v4_6622_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017321SMESG000000761.1 dd_Smed_v4_6622_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Human
Match: C2orf73 (chromosome 2 open reading frame 73 [Source:HGNC Symbol;Acc:HGNC:26861])

HSP 1 Score: 65.4698 bits (158), Expect = 6.877e-12
Identity = 46/140 (32.86%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  261 HCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDAPRF--WKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIP 674
            +  F+  NART N P  ++  K    E +  W++H    + + +P +   STQRSDF+  K S        ++ ++K S  I+     G+ A     + E +SF HQY++R+ PN P++GKRHGAFV      G   ++P
Sbjct:   57 YAKFINTNARTYNEPFPYIDPK-KGPEIQGDWWSHGKALEPVFLPPYDSKSTQRSDFQ--KPSCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVP 193          
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Human
Match: C2orf73 (chromosome 2 open reading frame 73 [Source:HGNC Symbol;Acc:HGNC:26861])

HSP 1 Score: 65.4698 bits (158), Expect = 1.289e-11
Identity = 46/140 (32.86%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  261 HCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDAPRF--WKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIP 674
            +  F+  NART N P  ++  K    E +  W++H    + + +P +   STQRSDF+  K S        ++ ++K S  I+     G+ A     + E +SF HQY++R+ PN P++GKRHGAFV      G   ++P
Sbjct:   51 YAKFINTNARTYNEPFPYIDPKKG-PEIQGDWWSHGKALEPVFLPPYDSKSTQRSDFQ--KPSCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVP 187          
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Human
Match: C2orf73 (chromosome 2 open reading frame 73 [Source:HGNC Symbol;Acc:HGNC:26861])

HSP 1 Score: 56.9954 bits (136), Expect = 4.606e-9
Identity = 37/109 (33.94%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  354 WFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDAPRF--WKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIP 674
            W++H    + + +P +   STQRSDF+  K S        ++ ++K S  I+     G+ A     + E +SF HQY++R+ PN P++GKRHGAFV      G   ++P
Sbjct:   23 WWSHGKALEPVFLPPYDSKSTQRSDFQ--KPSCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVP 129          
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Xenopus
Match: mgarp (mitochondria localized glutamic acid rich protein [Source:Xenbase;Acc:XB-GENE-1014555])

HSP 1 Score: 72.7886 bits (177), Expect = 6.035e-14
Identity = 70/226 (30.97%), Postives = 101/226 (44.69%), Query Frame = 3
Query:   21 MSVNVTKNYAPQILQKKRVPNK-LPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGW---FNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDA--PRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIPAL 680
            +S  + ++    + +KK+VP + LPN+YR+  E+ Y+     N+  E      T +P V         P+   R++ P P +  FL  N+R L  P   ++T   K      W     H    K    P +   +TQRSDF  +  SS      S    K     I+      S    PR  +E +SF H YN+R   N P+RGKRHGAFVW      + ES PA+
Sbjct:   33 LSSTMYQSMEISMSRKKKVPTRFLPNTYRLFNENLYNV----NLHKET-----THLPDVYRKPEKLQHPRSPTRNNMPHPYYARFLRDNSRFLKEPIPHMETASTKHIQSEWWPRDEEHVAPHK----PSYDMMTTQRSDFLKFSYSSNPQTRYSAKPCKSPVCGIVPFAPPRSRTRLPRLLQEQISFIHNYNARSVTNEPIRGKRHGAFVWTEI---KTESGPAV 242          
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Xenopus
Match: mgarp (mitochondria localized glutamic acid rich protein [Source:Xenbase;Acc:XB-GENE-1014555])

HSP 1 Score: 72.4034 bits (176), Expect = 6.955e-14
Identity = 70/226 (30.97%), Postives = 101/226 (44.69%), Query Frame = 3
Query:   21 MSVNVTKNYAPQILQKKRVPNK-LPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGW---FNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDA--PRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIPAL 680
            +S  + ++    + +KK+VP + LPN+YR+  E+ Y+     N+  E      T +P V         P+   R++ P P +  FL  N+R L  P   ++T   K      W     H    K    P +   +TQRSDF  +  SS      S    K     I+      S    PR  +E +SF H YN+R   N P+RGKRHGAFVW      + ES PA+
Sbjct:   33 LSSTMYQSMEISMSRKKKVPTRFLPNTYRLFNENLYNV----NLHKET-----THLPDVYRKPEKLQHPRSPTRNNMPHPYYARFLRDNSRFLKEPIPHMETASTKHIQSEWWPRDEEHVAPHK----PSYDMMTTQRSDFLKFSYSSNPQTRYSAKPCKSPVCGIVPFAPPRSRTRLPRLLQEQISFIHNYNARSVTNEPIRGKRHGAFVWTEI---KTESGPAV 242          
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Mouse
Match: 4930505A04Rik (RIKEN cDNA 4930505A04 gene [Source:MGI Symbol;Acc:MGI:1922337])

HSP 1 Score: 65.0846 bits (157), Expect = 7.872e-12
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  261 HCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNII---SHNCYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIP 674
            +  F+  NART N P  ++  K    E +  W+ HN   K +  P +   S QRSDF+  K +        ++ ++K S  I+   S +  G     F  E +SF HQY++R+ PN P++GK+HG FV     +G +  +P
Sbjct:   51 YAKFIHTNARTYNEPVPYIDNK--GPEKQRKWWFHNEAPKHVSQPSYDTKSVQRSDFQ--KPACPLVLPVKHSRMQKPSCGIVPLTSLDVSGEHENNFV-EYISFIHQYDARRTPNEPIKGKKHGTFVQREIKLGAMPIVP 186          
BLAST of Mitochondria localized glutamic acid rich protein vs. UniProt/SwissProt
Match: sp|A6QQL5|CB073_BOVIN (Uncharacterized protein C2orf73 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.502e-12
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 3
Query:  222 PKRDLRHHNP-----QPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSIN-TRHSSNASIKKTSDNIISHNCYGSDAP--RFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIPALHGQPRVKSQDDFQHKLACNRQFSLKRNLVENVDSVSRLIQPDIDSREEKLALSVFTH 851
            P + ++H  P     +  +  F+  N RT N P  ++  K  + E++  W+ H    +    P +   STQRSDFK      ++  +HS    ++K S  I+      + A   R +KE++SF HQY++R+ PN P+RGKRHG FV      G   ++P        +++       +C+ + S K     + +  S++I P +  +  +  L   TH
Sbjct:   33 PGKSIQHSKPCVGRGRVYYAKFINTNVRTCNEPVPYIDVK-KEPENQGDWWPHGKGLENPFQPPYDTKSTQRSDFKKPTCPLVSPVKHSK---LQKPSYGIVPLVSPDASAELQRNFKEHISFIHQYDARKTPNEPIRGKRHGVFVQTEIKPGSRPTVPE-------RTEVLLNASGSCSSEQSKKTEKGNSAE--SKMISPGLCRQNSQELLETKTH 237          
BLAST of Mitochondria localized glutamic acid rich protein vs. UniProt/SwissProt
Match: sp|Q5SPV6|CB073_MOUSE (Uncharacterized protein C2orf73 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.507e-11
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  261 HCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNII---SHNCYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIP 674
            +  F+  NART N P  ++  K    E +  W+ HN   K +  P +   S QRSDF+  K +        ++ ++K S  I+   S +  G     F  E +SF HQY++R+ PN P++GK+HG FV     +G +  +P
Sbjct:   51 YAKFIHTNARTYNEPVPYIDNK--GPEKQRKWWFHNEAPKHVSQPSYDTKSVQRSDFQ--KPACPLVLPVKHSRMQKPSCGIVPLTSLDVSGEHENNFV-EYISFIHQYDARRTPNEPIKGKKHGTFVQREIKLGAMPIVP 186          
BLAST of Mitochondria localized glutamic acid rich protein vs. UniProt/SwissProt
Match: sp|Q8N5S3|CB073_HUMAN (Uncharacterized protein C2orf73 OS=Homo sapiens OX=9606 GN=C2orf73 PE=2 SV=3)

HSP 1 Score: 65.4698 bits (158), Expect = 6.191e-11
Identity = 46/140 (32.86%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  261 HCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDAPRF--WKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIP 674
            +  F+  NART N P  ++  K    E +  W++H    + + +P +   STQRSDF+  K S        ++ ++K S  I+     G+ A     + E +SF HQY++R+ PN P++GKRHGAFV      G   ++P
Sbjct:   51 YAKFINTNARTYNEPFPYIDPKKG-PEIQGDWWSHGKALEPVFLPPYDSKSTQRSDFQ--KPSCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVP 187          
BLAST of Mitochondria localized glutamic acid rich protein vs. TrEMBL
Match: A0A267FKK8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004965g2 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.133e-25
Identity = 78/212 (36.79%), Postives = 104/212 (49.06%), Query Frame = 3
Query:   36 TKNYAPQILQKKRVPNKL-PNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFN------HNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCY--GSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDR 644
            +K  AP   +KK V     PN+YR+LFEDAY    R +   ++  D+ TP+    P    + +PKRDLRHHNP P +   L  N  T+  P C V T+  KD+    W N      HN        P +SFDST R  F+ W++S      S        ++ I+  N     S   R W E +S+E QYNSR    YP RG+R GA V +R
Sbjct:   15 SKLLAPSFPRKKAVDGTYQPNTYRVLFEDAYYARPRDSQPLKEHQDHLTPV-YPKPPANRAPRPKRDLRHHNPCPWNASHLRENVATMLVPVCHVTTEATKDDQYCWWINDPGKVSHNR-------PNYSFDSTSRDAFRTWQSSDAGRGASFRQKFTDAANGIVPVNPLWEKSGQRRVWSEKISYEQQYNSRHPDIYPPRGRRQGALVLNR 218          
BLAST of Mitochondria localized glutamic acid rich protein vs. TrEMBL
Match: A0A267EXP8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022001g1 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.676e-25
Identity = 78/212 (36.79%), Postives = 104/212 (49.06%), Query Frame = 3
Query:   36 TKNYAPQILQKKRVPNK-LPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFN------HNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCY--GSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDR 644
            +K  AP   +KK V     PN+YR+LFEDAY    R +   ++  D+ TP+    P    + +PKRDLRHHNP P +   L  N  T+  P C V T+  KD+    W N      HN        P +SFDST R  F+ W++S      S        ++ I+  N     S   R W E +S+E QYNSR    YP RG+R GA V +R
Sbjct:   15 SKLLAPSFPRKKAVDGTHQPNTYRVLFEDAYYARPRDSQPLKEHQDHLTPV-YPKPPANRAPRPKRDLRHHNPCPWNASHLRENVATMLVPVCHVTTEATKDDQYCWWINDPGKVSHNR-------PNYSFDSTSRDAFRTWQSSDAGRGASFRQKFTDAANGIVPVNPLWEKSGQRRVWSEKISYEQQYNSRHPDIYPPRGRRQGALVLNR 218          
BLAST of Mitochondria localized glutamic acid rich protein vs. TrEMBL
Match: A0A267F3N6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004965g1 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.801e-25
Identity = 78/212 (36.79%), Postives = 104/212 (49.06%), Query Frame = 3
Query:   36 TKNYAPQILQKKRVPNK-LPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFN------HNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCY--GSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDR 644
            +K  AP   +KK V     PN+YR+LFEDAY    R +   ++  D+ TP+    P    + +PKRDLRHHNP P +   L  N  T+  P C V T+  KD+    W N      HN        P +SFDST R  F+ W++S      S        ++ I+  N     S   R W E +S+E QYNSR    YP RG+R GA V +R
Sbjct:   15 SKLLAPSFPRKKAVDGTHQPNTYRVLFEDAYYARPRDSQPLKEHQDHLTPV-YPKPPANRAPRPKRDLRHHNPCPWNASHLRENVATMLVPVCHVTTEATKDDQYCWWINDPGKVSHNR-------PNYSFDSTSRDAFRTWQSSDAGRGASFRQKFTDAANGIVPVNPLWEKSGQRRVWSEKISYEQQYNSRHPDIYPPRGRRQGALVLNR 218          
BLAST of Mitochondria localized glutamic acid rich protein vs. TrEMBL
Match: K1QLR4 (Uncharacterized protein C2orf73-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10009347 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 6.001e-25
Identity = 79/217 (36.41%), Postives = 112/217 (51.61%), Query Frame = 3
Query:   45 YAPQILQKKRVPNKL-PNSYRILFEDAYSWESRPNIIPEKVPDNFTPIP------LVIPDTINSF-----QPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSI--NTRHSSNASIKKTSDNIISHNCYGSDAP-RFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSN 650
            Y P + +KKRVPN+  P+S+R++ ++A +   R +  P   P    P P      + +P+  N       +P  D R +NP P  C FL H+ R LN P C V T +  DE +N W+      + L VP  + D+  RSD+    N  +   TRH SN+S       +  +     D   R ++E  SFEH YNSR+D NYP+RGKR G+FVWD  N
Sbjct:    4 YMPPLQRKKRVPNRYNPDSFRVISDEAETTRERFSGNPYYSP----PSPERFEKGISLPNIYNRSTQVLPKPVPDFRANNPHPRSCGFLRHDVRLLNEPICSVYTSVTHDE-QNQWWPSRTSDEPLQVPGKTKDTVYRSDYMREHNEPLHRTTRHESNSSRDAALGPVPVNFLTKRDGTQRIFQEKKSFEHDYNSRKDTNYPVRGKRLGSFVWDEMN 215          
BLAST of Mitochondria localized glutamic acid rich protein vs. TrEMBL
Match: A0A210PGZ3 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10575 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 6.828e-25
Identity = 83/225 (36.89%), Postives = 117/225 (52.00%), Query Frame = 3
Query:   45 YAPQILQKKRVPNKL-PNSYRILFEDAYSWESRPNIIPEKVPDNF-----TPIP-LVIPDTIN---SFQPKR--DLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDF---KDWKNSSINTRHSSNASIKKTSDNI-ISHNCYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESI 671
            Y P I +KKRV     P+S+R++  DA   E  P  +   + D+      TP   L +P+  N      PK   D R + P P  C FL HN R LN P C V T  + DE +N W+     ++ L VP  + D+  R D+    D   SS +TRHS+N         + ++     +D  RF+KE +S+EHQYNSR +PNYP R KRHG+FVWD+ +  E + +
Sbjct:    4 YMPPIARKKRVSGHYDPDSFRVISGDAE--EMHPKFVTTSIEDHADFRRETPAGGLTLPNIYNRQTEVLPKSVPDYRVNRPHPGSCGFLRHNVRVLNEPVCSVYTASSHDE-QNLWWPSRTSNEPLNVPPKTKDTVYRGDYMQDGDRIQSSGSTRHSANLHRDPALGTVPVNFLPARNDNKRFFKEKISYEHQYNSRLNPNYPTRAKRHGSFVWDQMSNAESKQM 225          
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Nematostella
Match: EDO36961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH54])

HSP 1 Score: 89.7373 bits (221), Expect = 1.018e-20
Identity = 47/138 (34.06%), Postives = 75/138 (54.35%), Query Frame = 3
Query:  237 RHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDW----KNSSINTRHSSNASIKKTSDNIISHNCYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVW 638
            R + PQP    FL  N R +  P C V T +N +E  + W+ +  + + +  P ++FDST R D++D     K     +R++ +++        +   C  + +     E +S+EHQYN+R DPN+P+RGKRHG FVW
Sbjct:   62 RKNKPQPTAVTFLRQNPRFICEPICHVDTSINTEELTHPWWPNESVERPVTQPHYTFDSTSRDDYRDTSSYIKQHKGYSRYNYDSTSNSKPTVGLVPGCSTTASNPSVIEKISYEHQYNARLDPNHPIRGKRHGCFVW 199          
BLAST of Mitochondria localized glutamic acid rich protein vs. Planmine SMEST
Match: SMESG000000761.1 (SMESG000000761.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 271/277 (97.83%), Postives = 273/277 (98.56%), Query Frame = 3
Query:   21 MSVNVTKNYAPQILQKKRVPNKLPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNCYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIPALHGQPRVKSQDDFQHKLACNRQFSLKRNLVENVDSVSRLIQPDIDSREEKLALSVFTH 851
            MSVNVTKNYAPQILQKKRVPNKLPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLI+KFL VPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHN YGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIPAL GQP+V SQDDFQHKLACNRQFSLKRNLVENVDSVSRLIQPDIDSREEKLALSVFTH
Sbjct:    1 MSVNVTKNYAPQILQKKRVPNKLPNSYRILFEDAYSWESRPNIIPEKVPDNFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVKTKLNKDEHENGWFNHNLINKFLTVPKFSFDSTQRSDFKDWKNSSINTRHSSNASIKKTSDNIISHNYYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKRHGAFVWDRSNIGELESIPALRGQPKVNSQDDFQHKLACNRQFSLKRNLVENVDSVSRLIQPDIDSREEKLALSVFTH 277          
The following BLAST results are available for this feature:
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C2orf736.877e-1232.86chromosome 2 open reading frame 73 [Source:HGNC Sy... [more]
C2orf731.289e-1132.86chromosome 2 open reading frame 73 [Source:HGNC Sy... [more]
C2orf734.606e-933.94chromosome 2 open reading frame 73 [Source:HGNC Sy... [more]
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mgarp6.035e-1430.97mitochondria localized glutamic acid rich protein ... [more]
mgarp6.955e-1430.97mitochondria localized glutamic acid rich protein ... [more]
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
4930505A04Rik7.872e-1231.91RIKEN cDNA 4930505A04 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A6QQL5|CB073_BOVIN6.502e-1227.06Uncharacterized protein C2orf73 homolog OS=Bos tau... [more]
sp|Q5SPV6|CB073_MOUSE5.507e-1131.91Uncharacterized protein C2orf73 homolog OS=Mus mus... [more]
sp|Q8N5S3|CB073_HUMAN6.191e-1132.86Uncharacterized protein C2orf73 OS=Homo sapiens OX... [more]
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FKK81.133e-2536.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EXP81.676e-2536.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F3N61.801e-2536.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1QLR46.001e-2536.41Uncharacterized protein C2orf73-like protein OS=Cr... [more]
A0A210PGZ36.828e-2536.89Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO369611.018e-2034.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondria localized glutamic acid rich protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000761.10.000e+097.83SMESG000000761.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017321 ID=SMED30017321|Name=Mitochondria localized glutamic acid rich protein|organism=Schmidtea mediterranea sexual|type=transcript|length=921bp
ATTAACTTGAACGATATTTAATGTCTGTAAATGTAACTAAAAATTACGCC
CCACAAATTTTACAAAAGAAAAGAGTACCCAATAAATTACCAAATAGTTA
TCGAATATTATTTGAAGATGCCTATTCTTGGGAATCAAGGCCTAACATTA
TTCCTGAAAAAGTACCAGATAATTTTACTCCAATTCCATTGGTTATTCCC
GATACTATAAATTCTTTTCAACCTAAGCGTGATTTAAGACATCACAATCC
TCAGCCAATTCATTGTCATTTTTTATTACACAACGCTAGAACACTAAATG
CTCCTCAATGCTTCGTTAAAACCAAATTGAACAAAGATGAACATGAAAAC
GGATGGTTTAATCATAATTTAATTAGCAAATTCTTACCGGTTCCAAAGTT
TTCATTTGACTCAACTCAAAGATCTGATTTCAAAGATTGGAAAAATTCAT
CAATTAACACGAGACATTCAAGCAACGCCAGCATAAAAAAGACATCAGAT
AATATTATAAGTCACAATTGTTACGGATCTGACGCTCCTAGATTTTGGAA
AGAAAATCTTTCATTTGAACATCAATACAATTCTAGGCAAGATCCAAACT
ATCCAATGAGAGGGAAGAGACATGGGGCATTTGTTTGGGACAGAAGTAAC
ATCGGTGAATTGGAGAGTATTCCAGCACTACATGGTCAACCAAGAGTCAA
AAGCCAAGACGATTTTCAACACAAATTGGCCTGTAATAGACAATTTTCTT
TAAAGAGAAATCTCGTTGAGAACGTTGATTCAGTGTCACGACTCATTCAA
CCTGATATTGACAGTCGCGAGGAAAAATTAGCTTTATCAGTTTTTACTCA
CTAATATTTCTGTTGACATAATTAATGGCTTCTGATAATTTTTTGTTATG
AAAAAGAGATTTGGTTTTAAA
back to top

protein sequence of SMED30017321-orf-1

>SMED30017321-orf-1 ID=SMED30017321-orf-1|Name=SMED30017321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MSVNVTKNYAPQILQKKRVPNKLPNSYRILFEDAYSWESRPNIIPEKVPD
NFTPIPLVIPDTINSFQPKRDLRHHNPQPIHCHFLLHNARTLNAPQCFVK
TKLNKDEHENGWFNHNLISKFLPVPKFSFDSTQRSDFKDWKNSSINTRHS
SNASIKKTSDNIISHNCYGSDAPRFWKENLSFEHQYNSRQDPNYPMRGKR
HGAFVWDRSNIGELESIPALHGQPRVKSQDDFQHKLACNRQFSLKRNLVE
NVDSVSRLIQPDIDSREEKLALSVFTH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR031365GDWWSH
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031365Protein of unknown function with motif GDWWSHPFAMPF15667GDWWSHcoord: 73..207
e-value: 1.2E-31
score: 110.1
IPR031365Protein of unknown function with motif GDWWSHPANTHERPTHR35087FAMILY NOT NAMEDcoord: 9..210