c-SKI_SMAD_bind domain-containing protein

Overview
Namec-SKI_SMAD_bind domain-containing protein
Smed IDSMED30017315
Length (bp)1314
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of c-SKI_SMAD_bind domain-containing protein (SMED30017315) t-SNE clustered cells

Violin plots show distribution of expression levels for c-SKI_SMAD_bind domain-containing protein (SMED30017315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of c-SKI_SMAD_bind domain-containing protein (SMED30017315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for c-SKI_SMAD_bind domain-containing protein (SMED30017315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017315SMESG000070642.1 SmedASXL_004727SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017315SMESG000070642.1 dd_Smed_v4_19617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017315SMESG000070642.1 dd_Smed_v6_19617_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Human
Match: SKI (SKI proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10896])

HSP 1 Score: 114.775 bits (286), Expect = 9.504e-27
Identity = 63/210 (30.00%), Postives = 98/210 (46.67%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +             + ++ +L +      + + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E        LD++K  F
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKF 311          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 110.153 bits (274), Expect = 2.916e-25
Identity = 65/223 (29.15%), Postives = 101/223 (45.29%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F     K+ ++K
Sbjct:  147 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSK 366          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 110.153 bits (274), Expect = 2.916e-25
Identity = 65/223 (29.15%), Postives = 101/223 (45.29%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F     K+ ++K
Sbjct:  147 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSK 366          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 110.153 bits (274), Expect = 2.982e-25
Identity = 65/223 (29.15%), Postives = 101/223 (45.29%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F     K+ ++K
Sbjct:  147 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSK 366          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 110.153 bits (274), Expect = 3.175e-25
Identity = 65/223 (29.15%), Postives = 101/223 (45.29%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F     K+ ++K
Sbjct:  127 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSK 346          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0343409)

HSP 1 Score: 130.183 bits (326), Expect = 4.889e-32
Identity = 76/216 (35.19%), Postives = 109/216 (50.46%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSL----FVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKI-NHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKL 719
            T+LE   +  F+ G  +++ +P  + +   D     IN++   L I C QCT +QL      KIL SDV   GLI + DA+RLC   +H ++  S     SL        + H CFG+ +    PD+Y      CIKC  C   F+  +FV H H K  NH  T HWGF S NW  ++++ +   DVE  +   +ILD +K   LKE M K + +L
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALLHRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFENH--TCHWGFDSRNWHDYLHVAL---DVENREKYQIILDQLKEVELKE-MHKAQREL 328          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0112717)

HSP 1 Score: 130.183 bits (326), Expect = 4.889e-32
Identity = 76/216 (35.19%), Postives = 109/216 (50.46%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSL----FVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKI-NHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKL 719
            T+LE   +  F+ G  +++ +P  + +   D     IN++   L I C QCT +QL      KIL SDV   GLI + DA+RLC   +H ++  S     SL        + H CFG+ +    PD+Y      CIKC  C   F+  +FV H H K  NH  T HWGF S NW  ++++ +   DVE  +   +ILD +K   LKE M K + +L
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALLHRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFENH--TCHWGFDSRNWHDYLHVAL---DVENREKYQIILDQLKEVELKE-MHKAQREL 328          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0112719)

HSP 1 Score: 130.183 bits (326), Expect = 4.889e-32
Identity = 76/216 (35.19%), Postives = 109/216 (50.46%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSL----FVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKI-NHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKL 719
            T+LE   +  F+ G  +++ +P  + +   D     IN++   L I C QCT +QL      KIL SDV   GLI + DA+RLC   +H ++  S     SL        + H CFG+ +    PD+Y      CIKC  C   F+  +FV H H K  NH  T HWGF S NW  ++++ +   DVE  +   +ILD +K   LKE M K + +L
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALLHRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFENH--TCHWGFDSRNWHDYLHVAL---DVENREKYQIILDQLKEVELKE-MHKAQREL 328          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0112718)

HSP 1 Score: 130.183 bits (326), Expect = 4.889e-32
Identity = 76/216 (35.19%), Postives = 109/216 (50.46%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSL----FVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKI-NHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKL 719
            T+LE   +  F+ G  +++ +P  + +   D     IN++   L I C QCT +QL      KIL SDV   GLI + DA+RLC   +H ++  S     SL        + H CFG+ +    PD+Y      CIKC  C   F+  +FV H H K  NH  T HWGF S NW  ++++ +   DVE  +   +ILD +K   LKE M K + +L
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALLHRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFENH--TCHWGFDSRNWHDYLHVAL---DVENREKYQIILDQLKEVELKE-MHKAQREL 328          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Fly
Match: fuss (gene:FBgn0039932 transcript:FBtr0301336)

HSP 1 Score: 70.8626 bits (172), Expect = 1.099e-12
Identity = 42/134 (31.34%), Postives = 66/134 (49.25%), Query Frame = 3
Query:  141 KILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYC-FGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTH 539
            ++ +  +  +  +   Y  I+     L I C QCTP QL IL     +     +CG+I + +A+RLCK     N T  R     F   + H C +G + +FL P  Y  S ++CIKC+ C   F+  +F+ H+H
Sbjct:   46 RLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDN-TPPRLPDD-FAFNVQHKCAWGCRGSFL-PSRYNSSRAKCIKCSYCGMFFSPNKFIFHSH 176          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Zebrafish
Match: skia (v-ski avian sarcoma viral oncogene homolog a [Source:ZFIN;Acc:ZDB-GENE-990715-9])

HSP 1 Score: 121.324 bits (303), Expect = 3.599e-29
Identity = 66/208 (31.73%), Postives = 96/208 (46.15%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLF----------VIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ +  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +         S   L+             I H CFG+ +  L P+LY   N+ CI+C  C  ++ T +FV H+H  + +  T HWGF S NWR ++ +       E       +LD+IK  F
Sbjct:   86 TVLEGETISCFVVGGEKRLCLPQILNTVLRDFSLQQINSVCDDLHIYCSRCTADQLEILKVMGILPFAAPSCGLITKTDAERLCNALIYGGTYPPHSKKELYGSIELELTEKSFKIYHECFGKCKGLLVPELYTSPNAPCIQCMDCRLMYPTHKFVVHSHKSLEN-RTCHWGFDSANWRAYVLLSPDYTGKEEKARLEQLLDDIKEKF 292          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Zebrafish
Match: skib (v-ski avian sarcoma viral oncogene homolog b [Source:ZFIN;Acc:ZDB-GENE-990715-10])

HSP 1 Score: 117.087 bits (292), Expect = 1.162e-27
Identity = 69/211 (32.70%), Postives = 102/211 (48.34%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLT---------SIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNAD-VEYHKNATL--ILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI + DA+RLC   I+              SI    +     + H CFG+ +    P+LY   N+ CI+C  C  +F T +FV H+H ++ +  T HWGF S NWR +I   + + D  E  +N+TL  +L  +K  F
Sbjct:   82 TVLERETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDDLHIYCSRCTADQLEILKVMGILPFSAPSCGLITQTDAERLCNALIYGGTFPPHADKELSCSIELERTEKSFKVYHECFGKCKGLFVPELYTSPNAACIQCLDCRLMFPTHKFVVHSHKRLEN-RTCHWGFDSSNWRAYI---LLDQDYSEKEENSTLQQLLTELKGKF 288          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Zebrafish
Match: skilb (SKI-like proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-080723-40])

HSP 1 Score: 105.916 bits (263), Expect = 4.130e-24
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query:   72 SKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSI------RSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYI---YIFNADVEYHKNATLILDNIKSAFLKE 692
            S  + +  LE   +  F+ G  +++ +P L+ +  +D     IN +   L + C +C   QL IL    IL      CGLI   DA+RLC  + +     +      +         + H C G+ Q    P LY   ++ C++C+ C  +F T  FV H+H + +   T HWGF S  W  ++ +   ++  AD E  + +   L+++K+ F +E
Sbjct:  120 STDLSMCSLEGESISCFSVGGELRLCLPQLLNTILRDFSLQQINSVCDQLYLYCSRCDATQLHILKVLGILPPGTPSCGLITLTDAQRLCNTLLHPGEEPLDREQEEKDGEESGGFWVEHQCLGKCQGLFVPQLYSSPDAPCVRCSQCRMLFCTERFVMHSHRQPDK-RTCHWGFDSAKWACYLQLAQRHLGTADEEKLQQS---LEDMKAKFQQE 331          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Zebrafish
Match: skilb (SKI-like proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-080723-40])

HSP 1 Score: 105.916 bits (263), Expect = 4.130e-24
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query:   72 SKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSI------RSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYI---YIFNADVEYHKNATLILDNIKSAFLKE 692
            S  + +  LE   +  F+ G  +++ +P L+ +  +D     IN +   L + C +C   QL IL    IL      CGLI   DA+RLC  + +     +      +         + H C G+ Q    P LY   ++ C++C+ C  +F T  FV H+H + +   T HWGF S  W  ++ +   ++  AD E  + +   L+++K+ F +E
Sbjct:  120 STDLSMCSLEGESISCFSVGGELRLCLPQLLNTILRDFSLQQINSVCDQLYLYCSRCDATQLHILKVLGILPPGTPSCGLITLTDAQRLCNTLLHPGEEPLDREQEEKDGEESGGFWVEHQCLGKCQGLFVPQLYSSPDAPCVRCSQCRMLFCTERFVMHSHRQPDK-RTCHWGFDSAKWACYLQLAQRHLGTADEEKLQQS---LEDMKAKFQQE 331          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Zebrafish
Match: skila (SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-070912-548])

HSP 1 Score: 103.219 bits (256), Expect = 1.281e-23
Identity = 58/209 (27.75%), Postives = 94/209 (44.98%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFI--HNTNLTS-----------IRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            LE   +  F  G   ++ +P ++ S  +D     IN +   L + C +C  EQL IL    IL  +   CGLI   DA+RLC  +     N+++           ++ + + F   + H C G+ Q    P  YV+ ++ CI+C  C  +F+   FV H+H K     T HWGF S  W  ++ +   +   +       +LD +K  F
Sbjct:  159 LEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINAVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGANISADPNSKLPGQGLLKESDASFQ--VEHQCLGKCQGLFVPHFYVQPDAPCIQCMECQLLFSPQNFVMHSH-KSPDKRTCHWGFDSAKWPCYLQLGRKHEGTQEEPQLKQLLDEMKEKF 364          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000042147.1 (SKI-like proto-oncogene [Source:NCBI gene;Acc:100492636])

HSP 1 Score: 113.62 bits (283), Expect = 2.056e-26
Identity = 66/219 (30.14%), Postives = 101/219 (46.12%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHNT-------NLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKK 704
            TELE   +  F  G   ++ +P ++ S  +D     IN +   + I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N        +L  ++ T S F +   H C G+ Q    P L+ + ++ CI+C  C  +F+T  FV H+H   +   T HWGF S  W  ++++     D    K    +L  +K  F K++  K
Sbjct:  129 TELEGESISCFMVGGEKRLCLPQVLNSVLRDFSLQQINIVCDEMYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPQTFPQNGSLLPAKNSLAQLKETGSAFEVE--HDCLGKCQGLFAPHLFSQPDAPCIQCLECYGMFSTQTFVMHSHRSPDK-RTCHWGFDSAKWHCYVHLSPKYLDTPEGKKMNALLKEMKEKFNKKNQPK 344          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Xenopus
Match: SKI (SKI proto-oncogene [Source:NCBI gene;Acc:100486949])

HSP 1 Score: 110.153 bits (274), Expect = 3.132e-25
Identity = 61/212 (28.77%), Postives = 93/212 (43.87%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIP-------------IIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADV---EYHKNATLILDNIKSAF 683
            LE   +  F  G   ++ +P ++ S  +D     IN +   L + C +CT +QL IL    IL      CGLI K DA+RLC  +        R        P             + H CFG+ +    P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +   N      E     + +L+ +K  F
Sbjct:   88 LEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHVYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGSYPPRCAKKSDFPPGPLELELTESSFRVYHECFGKCRGLFVPELYGHPSAPCIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLARDNPGAGGEEEQARLSRLLEEMKEKF 298          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Xenopus
Match: arg1 (arginase 1 [Source:Xenbase;Acc:XB-GENE-966913])

HSP 1 Score: 69.3218 bits (168), Expect = 1.410e-12
Identity = 39/143 (27.27%), Postives = 63/143 (44.06%), Query Frame = 3
Query:  111 LISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTH 539
            ++S       ++ +  +  +  ++  Y  I+     L I C QCTP QL IL     +     +CG+I K +A+RLCK     N          F   + H C    +    P  Y  S ++CIKC  C+  F+  +F+ H+H
Sbjct:   51 IVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGENRPP--KLPDNFAFDVSHECAWGCRGSFIPARYNSSRAKCIKCTYCNMYFSPNKFIFHSH 191          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Xenopus
Match: SKOR1 (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:100491438])

HSP 1 Score: 70.4774 bits (171), Expect = 2.669e-12
Identity = 53/203 (26.11%), Postives = 90/203 (44.33%), Query Frame = 3
Query:  111 LISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCK-FIHNTNLTSIRSTSSLFVIPIIHYC-FGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKN 713
            ++S       ++ +  +  +  +   Y  I+     L I C QCTP QL IL     +     +CG+I K +A+RLCK F+       +      F   + H C +G + +F+ P  Y  S ++CIKCA C   F+  +F+ H+H   +   T     +  +WR  + +           N T   D++  ++  ED+K M N
Sbjct:   47 IVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHRPPKLPEN---FAFDVAHECAWGCRGSFI-PARYNSSRAKCIKCAYCGLYFSPNKFIFHSHRTPDSKYTQPDAANFNSWRRHLRL-----------NDTTPSDDLSHSW--EDVKAMFN 232          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Xenopus
Match: SKOR1 (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:100491438])

HSP 1 Score: 70.0922 bits (170), Expect = 2.840e-12
Identity = 53/203 (26.11%), Postives = 90/203 (44.33%), Query Frame = 3
Query:  111 LISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCK-FIHNTNLTSIRSTSSLFVIPIIHYC-FGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKN 713
            ++S       ++ +  +  +  +   Y  I+     L I C QCTP QL IL     +     +CG+I K +A+RLCK F+       +      F   + H C +G + +F+ P  Y  S ++CIKCA C   F+  +F+ H+H   +   T     +  +WR  + +           N T   D++  ++  ED+K M N
Sbjct:   47 IVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHRPPKLPEN---FAFDVAHECAWGCRGSFI-PARYNSSRAKCIKCAYCGLYFSPNKFIFHSHRTPDSKYTQPDAANFNSWRRHLRL-----------NDTTPSDDLSHSW--EDVKAMFN 232          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Mouse
Match: Ski (ski sarcoma viral oncogene homolog (avian) [Source:MGI Symbol;Acc:MGI:98310])

HSP 1 Score: 119.013 bits (297), Expect = 2.595e-28
Identity = 73/256 (28.52%), Postives = 113/256 (44.14%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKRKD 821
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +             + ++ +L +      + + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E        LD++K  F  +   K K ++P      R++ PP S            P    KD
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKF--DYANKYKRRVP------RVSEPPASIRPKTDDTSSQSPASSEKD 349          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Mouse
Match: Ski (ski sarcoma viral oncogene homolog (avian) [Source:MGI Symbol;Acc:MGI:98310])

HSP 1 Score: 117.472 bits (293), Expect = 8.323e-28
Identity = 71/253 (28.06%), Postives = 111/253 (43.87%), Query Frame = 3
Query:   99 ENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKRKD 821
            E   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +             + ++ +L +      + + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E        LD++K  F  +   K K ++P      R++ PP S            P    KD
Sbjct:   54 EGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKF--DYANKYKRRVP------RVSEPPASIRPKTDDTSSQSPASSEKD 297          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Mouse
Match: Skil (SKI-like [Source:MGI Symbol;Acc:MGI:106203])

HSP 1 Score: 112.849 bits (281), Expect = 1.949e-26
Identity = 65/223 (29.15%), Postives = 103/223 (46.19%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F   + K++++K
Sbjct:   64 TLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQSK 283          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Mouse
Match: Skil (SKI-like [Source:MGI Symbol;Acc:MGI:106203])

HSP 1 Score: 112.464 bits (280), Expect = 3.523e-26
Identity = 65/223 (29.15%), Postives = 103/223 (46.19%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F   + K++++K
Sbjct:  144 TLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQSK 363          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Mouse
Match: Skil (SKI-like [Source:MGI Symbol;Acc:MGI:106203])

HSP 1 Score: 112.079 bits (279), Expect = 4.690e-26
Identity = 65/223 (29.15%), Postives = 103/223 (46.19%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-------KFIHN-------TNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            T LE   +  F  G   ++ +P ++ S  ++     IN +   L I C +CT +QL IL    IL  +   CGLI   DA+RLC        F  N       ++L  ++ T S F +   H C G+ Q    P  YV+ ++ CI+C  C  +F    FV H+H   +   T HWGF S  W  ++++          K   +IL+ +K  F   + K++++K
Sbjct:  144 TLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVE--HECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK-RTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQSK 363          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. UniProt/SwissProt
Match: sp|Q60698|SKI_MOUSE (Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.696e-27
Identity = 73/256 (28.52%), Postives = 113/256 (44.14%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKRKD 821
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +             + ++ +L +      + + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E        LD++K  F  +   K K ++P      R++ PP S            P    KD
Sbjct:  101 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKF--DYANKYKRRVP------RVSEPPASIRPKTDDTSSQSPASSEKD 347          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. UniProt/SwissProt
Match: sp|P12755|SKI_HUMAN (Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.564e-26
Identity = 63/210 (30.00%), Postives = 98/210 (46.67%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +             + ++ +L +      + + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E        LD++K  F
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKF 311          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. UniProt/SwissProt
Match: sp|P17863|SKI_AVIES (Transforming protein Ski OS=Avian erythroblastosis virus (strain Sloan-Kettering) OX=11862 GN=V-SKI PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 9.351e-26
Identity = 73/246 (29.67%), Postives = 111/246 (45.12%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFVIP----IIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEM 797
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +               ST  L +      + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E       +LD +K  F  +   K K K P   ++ R+ +      + N +F+ M
Sbjct:   65 TILEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGTYPPHCKKEFSSTIELELTEKSFKVYHECFGKCKGLLVPELYSNPSAACIQCLDCRLMYPPHKFVVHSHKSLEN-RTCHWGFDSANWRSYILLSQDYTGKEEKARLGQLLDEMKEKF--DYNNKYKRKAPRNRESPRVQL------RRNKMFKTM 301          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9TUG2|SKI_HORSE (Ski oncogene OS=Equus caballus OX=9796 GN=SKI PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.907e-25
Identity = 70/243 (28.81%), Postives = 111/243 (45.68%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINI-PPISTNKVN 779
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L   C +CT +QL IL    IL      CGLI K DA+RLC  +             + ++ +L +      + + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E        LD++K  F  +   K K ++P      R++  PP S  K +
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHTYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALEN-RTCHWGFDSANWRAYILLSQDYTGKEEQTRLGRCLDDVKEKF--DYGNKYKRRVP------RVSSEPPASIRKTD 336          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. UniProt/SwissProt
Match: sp|P49140|SKI_CHICK (Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.917e-25
Identity = 63/208 (30.29%), Postives = 95/208 (45.67%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFI------------HNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC  +              ++   +  T   F   + H CFG+ +  L P+LY   ++ CI+C  C  ++   +FV H+H  + +  T HWGF S NWR +I +       E       +LD +K  F
Sbjct:   88 LEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGTYPPHCKKEFSSTIELELTEKSFK--VYHECFGKCKGLLVPELYSNPSAACIQCLDCRLMYPPHKFVVHSHKSLEN-RTCHWGFDSANWRSYILLSQDYTGKEEKARLGQLLDEMKEKF 292          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. TrEMBL
Match: A0A1Y1MFT2 (c-SKI_SMAD_bind domain-containing protein OS=Photinus pyralis OX=7054 GN=PPYR_13790 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.527e-33
Identity = 75/199 (37.69%), Postives = 101/199 (50.75%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ S  +D     INQ    L I C +CTPEQL +L    IL S    CGLI K DA+RLC   +H     S+R         + H CFG+ +    PDLY   ++RCI+C  CS  FT  +FV H H  + +  TVHWGF S NWR +++I     D   H+  T  LD IK  +
Sbjct:   72 TTLEGETISCFVVGGEKRLCLPQVLNSVLRDFSLMQINQECDQLQIYCSRCTPEQLNVLKNQGILPSSAPSCGLITKTDAERLCSALLHCQVYPSLRPPKGTLSFTVYHECFGKCRGICVPDLYTGKDARCIECMDCSGAFTPQQFVCHVHRDLEN-RTVHWGFDSSNWRSYLHICKDQID---HERLTKYLDVIKDQY 266          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. TrEMBL
Match: A0A482VDX3 (Ski Sno and/or c-SKI SMAD bind domain containing protein OS=Asbolus verrucosus OX=1661398 GN=BDFB_011750 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.225e-33
Identity = 76/234 (32.48%), Postives = 112/234 (47.86%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWR-PKNL--------RINIPPI 761
            T LE   +  F  G   ++ +P ++ S  +D   P IN     L I C +CTPEQL +L    IL S     GLI K DA+RLC   +H  ++  IR         + H CFG+ +   +P+L+   N++CI+C  C   F+  +FV H H   +   TVHWGF S NWR ++ +     D + H+     +D +K  F          K+P+  P+N+          NIPPI
Sbjct:   73 TILEGETISCFVVGGEKRLCLPQVLNSVLRDFSLPQINHECDQLQIYCSRCTPEQLNVLKNGGILPSGAASSGLITKTDAERLCSALLHGQDIPQIRPRKGSVSFTVYHKCFGKCRGVCFPELFTSKNAKCIECTECRGGFSPQQFVCHVHKHFSENRTVHWGFDSANWRVYLRVA---KDQQDHEQCVKYIDELKEQF--------DGKMPFPLPQNIYAGIKRKQHPNIPPI 295          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. TrEMBL
Match: A0A1Z5LAJ0 (Transforming protein Ski (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.433e-32
Identity = 70/240 (29.17%), Postives = 119/240 (49.58%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPI 806
            T LENH +  F  G   ++ +P ++ +  +D     IN +   L I C +C  EQL +L  +++L S    CGLI K DA+RLC + +H++      +    F +P+ H CFG     L+PD Y + ++ C++C+ CS +F+   FV H H +     T HWGF S NWR ++ +       +     T ++D++K+ F+ +  +K              N PP+  +K     ++  P+
Sbjct:   94 TILENHTISCFCVGGERRLCLPQILTTVLRDFTLQQINGVCDDLQIFCSRCNAEQLEVLKVSRVLPSCAPSCGLITKTDAERLCAELLHSSGDPVDETVLGTFQVPVYHECFGGTHGDLFPDAYTEYDAACVRCSECSAMFSPRRFVCHAH-RGRENRTCHWGFDSANWRAYVLLDEEQVGGQDVVRLTRVMDDVKAKFVTDGKRKQ-------------NPPPVEASKKKMRAEDEAPL 319          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. TrEMBL
Match: A0A1B6GH89 (c-SKI_SMAD_bind domain-containing protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.22114 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.102e-32
Identity = 72/212 (33.96%), Postives = 107/212 (50.47%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIR--STSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKL 719
            T LE   +  F  G   ++ +PH++ S  +D   P INQ+   L I C +C PEQL  L  + IL S    CGLI K DA+RLC  + + N  S R    +    I + H CFG+ +    P+LY  ++++CI+C  C  +FT   FV H H  + +  T HWGF S NWR ++ +     D   H+    +LD  K  F   +  K + ++
Sbjct:   87 TVLEGESISCFVVGGEKRLCLPHILNSVLRDFSLPQINQVCDELQIFCSRCNPEQLEELKVSGILPSTAPSCGLITKTDAERLCSALLHRNAPSARLLDKAVTIQIKVYHECFGKCRGVCMPELYTDTSAQCIECTECHGLFTPQTFVCHAHRYLEN-RTCHWGFDSSNWRAYLLLVEDQPD---HERRAKLLDFFKEQFTDPEHNKKRKEM 294          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. TrEMBL
Match: A0A484B881 (c-SKI_SMAD_bind domain-containing protein OS=Drosophila navojoa OX=7232 GN=AWZ03_009060 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.583e-32
Identity = 76/224 (33.93%), Postives = 113/224 (50.45%), Query Frame = 3
Query:   87 LTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSL----FVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLR 743
            +T LE   +  F+ G  +++ +P  + +   D     IN +   L I C QCTPEQL      KIL SDV   GLI + DA+RLC   +H ++  S     SL        + H CFG+ +    PD+Y      CI+C  C+  F+  +FV H H K+ +  T HWGF S NW  ++++ +   DVE  +    ILD +K   LKE M K + +L  + + +R
Sbjct:   95 VTRLEGKAIGCFSMGGEMRLCLPQFLNNVLSDFTLDQINGIFEDLGISCSQCTPEQLVEFKAAKILPSDVKGSGLITRTDAERLCAALLHRSDRNSYVPVESLGKGALSFQVYHKCFGKCEGICTPDMYSYQKPTCIQCLECNCWFSPQKFVGHVHRKVEN-RTCHWGFDSRNWHDYLHVAL---DVENREKYQRILDQLKEVELKE-MHKAQCELDHKKRKVR 313          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Cavefish
Match: skib (ski oncogene-like [Source:NCBI gene;Acc:103031474])

HSP 1 Score: 125.561 bits (314), Expect = 1.704e-30
Identity = 65/205 (31.71%), Postives = 97/205 (47.32%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ +  +D     IN +   L + C +CT EQL +L    +L      CGLI + DA+RLC   +H   L S    ++L +      +P+ H CFGR      P+LY    + C++CA C  +F    FV H+H +  +  T HWGF S NWR +I +    A    H      LD +K  F
Sbjct:   83 TVLERETISCFVVGGEKRLCLPQILNTVLRDFSLQQINAVCDELHVYCSRCTAEQLEVLKVVGVLPFSAPSCGLITQTDAERLCNALVHGGALPSRGGPAALELATTDKSVPVYHECFGRCDGVFVPELYSGPGAACVQCADCGLMFPARRFVVHSHRRREN-RTCHWGFDSANWRAYILLDRDRAPPTEHTELQRRLDRLKEKF 286          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Cavefish
Match: skib (ski oncogene-like [Source:NCBI gene;Acc:103031474])

HSP 1 Score: 124.79 bits (312), Expect = 2.629e-30
Identity = 65/205 (31.71%), Postives = 97/205 (47.32%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNLTSIRSTSSLFV------IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ +  +D     IN +   L + C +CT EQL +L    +L      CGLI + DA+RLC   +H   L S    ++L +      +P+ H CFGR      P+LY    + C++CA C  +F    FV H+H +  +  T HWGF S NWR +I +    A    H      LD +K  F
Sbjct:   83 TVLERETISCFVVGGEKRLCLPQILNTVLRDFSLQQINAVCDELHVYCSRCTAEQLEVLKVVGVLPFSAPSCGLITQTDAERLCNALVHGGALPSRGGPAALELATTDKSVPVYHECFGRCDGVFVPELYSGPGAACVQCADCGLMFPARRFVVHSHRRREN-RTCHWGFDSANWRAYILLDRDRAPPTEHTELQRRLDRLKEKF 286          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Cavefish
Match: skia (ski oncogene [Source:NCBI gene;Acc:103046211])

HSP 1 Score: 116.701 bits (291), Expect = 1.331e-27
Identity = 58/186 (31.18%), Postives = 85/186 (45.70%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC-KFIHNTNL-----------TSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYI 611
            T LE   +  F  G   ++ +P ++ +  +++    IN +   L I C +CT EQL IL    +L      CGLI K DA+RLC   +H                 +    +   I + H CFGR    L P+LY   ++ CI+CA C  +     FV H H    +  T HWGF S NWR ++ +
Sbjct:  108 TVLEGETISCFVVGGEKRLCLPQILNTVLRELSLQQINSVCDQLHIYCSRCTAEQLEILKVVGVLPFSAPSCGLITKTDAERLCNALVHGAGYPGKLAQEQEVEAEVHEGKAEAGIKVYHECFGRCAGVLLPELYTSPSAPCIRCAHCGLLLAPRRFVAHAHGTPEN-RTCHWGFDSDNWRAYVLL 292          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Cavefish
Match: skila (SKI like proto-oncogene [Source:NCBI gene;Acc:103032490])

HSP 1 Score: 106.301 bits (264), Expect = 3.477e-24
Identity = 58/213 (27.23%), Postives = 94/213 (44.13%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL------TSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNK 716
            LE   +  F  G   ++ +P ++ S  +D     IN +   L + C +C  EQL IL    IL  +   CGLI   DA+RLC  +           + +++  S     + H C G+ Q    P  YV+ ++ CI+C  C  +F+   FV H+H   +   T HWGF S  W  ++ +               +LD +K+ F    +K+  +K
Sbjct:  154 LEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINAVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGTAIHVEQSMLKAKDSEAGFQVEHQCLGKCQGLFVPQFYVQPDAPCIRCMECQLLFSPQNFVMHSHCSPDK-RTCHWGFDSAKWACYLQLSRRYQGAAEEPKLRQLLDEMKNKFHSPTLKRTLDK 365          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Cavefish
Match: skilb (ski-like protein [Source:NCBI gene;Acc:103027845])

HSP 1 Score: 99.3673 bits (246), Expect = 6.275e-22
Identity = 65/247 (26.32%), Postives = 106/247 (42.91%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIP-------------------IIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVN 779
            LE   +  F+ G  +++ +P ++ +  +D     IN +   L + C +C   QL++L    +L      CGLI   DA+RLC    NT L    S +   V+                    + H C G+ Q    P  Y    S CI+C+ C ++F    FV H+H + +   T HWGF S  W  ++ +         ++ AT      + A LK+ ++ MK K  +R   L   +P + T +V 
Sbjct:  162 LEGETISCFSVGGELRLCLPQVLNTVLRDFSLHQINSVCDQLYLYCSRCDASQLQVLKILGVLPPGAPSCGLITLTDAQRLC----NTLLHPGESNAPAGVLKGHSVGEDEEKEAEEGGAFWVEHQCLGKCQGLFVPRFYASPGSPCIRCSQCRRLFCPERFVMHSHWQPDK-RTCHWGFDSAKWACYLQLG------RRYQGAT------EEARLKQLLETMKMK--FRGIPLEAKLPHLETAQVQ 389          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001301.1 (pep scaffold:Pmarinus_7.0:GL481803:9978:11426:-1 gene:ENSPMAG00000001172.1 transcript:ENSPMAT00000001301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.516e-12
Identity = 37/144 (25.69%), Postives = 65/144 (45.14%), Query Frame = 3
Query:  111 LISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCK-FIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTH 539
            ++S       ++ +  +  +  +   Y  I+     L I C QCTP QL +L     +     +CG+I + +A+RLCK F+ +     +      F   + H C    +    P  Y  S ++CIKC+ C   F+  +F+ H+H
Sbjct:   18 IVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLELLRRAGAMPVSSRRCGMITRREAERLCKSFLGDHEPPRLPEN---FAFDVTHECAWGCRGSFVPARYNSSRAKCIKCSLCGLFFSPNKFIFHSH 158          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Nematostella
Match: EDO41836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S373])

HSP 1 Score: 83.9593 bits (206), Expect = 3.457e-19
Identity = 48/160 (30.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  141 KILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVI---PIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYI 611
            ++    L+    +      IN     L I C +CTP+QL +L    +L       GLI K DA RL   +  +N+      S LF +    + H CFG     L  +LY    + C+ C+ C  +F+   FV H H     ++T HWGF S NW+ ++ +
Sbjct:    4 RLCYKELVEKILKGFSSQVINATRDRLQIFCPRCTPQQLEVLKLAGVLPWSCASAGLIAKSDAFRLIGALTGSNVP--HRNSRLFSVDSLEVYHECFGGCVGTLEIELYTDPYAECVTCSQCDGVFSPRTFVTHHHTS-GEVHTCHWGFDSANWKLYLML 160          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Medaka
Match: skib (ski oncogene [Source:NCBI gene;Acc:101171238])

HSP 1 Score: 121.324 bits (303), Expect = 3.691e-29
Identity = 66/207 (31.88%), Postives = 99/207 (47.83%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFI--------H-NTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ S  +D     IN +   L I C +CT +QL IL    IL      CGLI + DA+RLC  +        H N +L S+    +     + H CFGR +    P+LY    + CI+C  C  +F   +FV H+H ++ +  TVHWGF S NWR ++ +     D E   +   +L  +K  F
Sbjct:   81 TVLEREPISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDDLHIYCSRCTADQLEILKVVGILPFSAPSCGLITQTDAERLCNALIYGGTYPPHCNKDLGSLELERTERSFKVYHECFGRCKGLFVPELYSSPAAACIQCMDCRLMFPPHKFVVHSHKRLEN-RTVHWGFDSSNWRVYVLLDADYTDKEEKSHLEQLLKELKGKF 286          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Medaka
Match: skia (SKI proto-oncogene [Source:NCBI gene;Acc:101164645])

HSP 1 Score: 120.553 bits (301), Expect = 6.216e-29
Identity = 68/212 (32.08%), Postives = 96/212 (45.28%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC--------------KFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ +  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC              K +       ++ T   F   + H CFG+ +  L P+LY   ++ CI+C  C  ++ T +FV H+H K     T HWGF S NWR +I +       E       ILD IK  F
Sbjct:   82 TVLEGETISCFVVGGEKRLCLPQILNTVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALIYGGAFPPRAKKELGGAGALELQLTDRSFK--VYHECFGKCKGLLVPELYGSPSAACIQCLDCRLMYPTHKFVVHSH-KAQENRTCHWGFDSANWRAYILLSQDYTGKEEKARLEQILDEIKEKF 290          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Medaka
Match: skia (SKI proto-oncogene [Source:NCBI gene;Acc:101164645])

HSP 1 Score: 120.553 bits (301), Expect = 6.482e-29
Identity = 68/212 (32.08%), Postives = 96/212 (45.28%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLC--------------KFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            T LE   +  F  G   ++ +P ++ +  +D     IN +   L I C +CT +QL IL    IL      CGLI K DA+RLC              K +       ++ T   F   + H CFG+ +  L P+LY   ++ CI+C  C  ++ T +FV H+H K     T HWGF S NWR +I +       E       ILD IK  F
Sbjct:   82 TVLEGETISCFVVGGEKRLCLPQILNTVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALIYGGAFPPRAKKELGGAGALELQLTDRSFK--VYHECFGKCKGLLVPELYGSPSAACIQCLDCRLMYPTHKFVVHSH-KAQENRTCHWGFDSANWRAYILLSQDYTGKEEKARLEQILDEIKEKF 290          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Medaka
Match: skila (SKI like proto-oncogene [Source:NCBI gene;Acc:111949033])

HSP 1 Score: 103.605 bits (257), Expect = 2.764e-23
Identity = 58/206 (28.16%), Postives = 89/206 (43.20%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFI----------HNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAF 683
            LE   +  F  G   ++ +P ++ S  +D     IN +   L + C +C  EQL IL    IL  +   CGLI   DA+RLC  +           +  L+ ++ + + F   + H C G  Q    P  Y +  + CI+C  C  +F+   FV H+H K     T HWGF S  W  ++ +              L+LD +K  F
Sbjct:  152 LEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINTVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGAVLPPDPSGKLSVLKESETSFQ--VEHQCLGMCQGLFAPQFYSQPEAPCIQCVECQLLFSPQTFVMHSH-KSPDKRTCHWGFDSAKWPCYLQLARKYQGTAEEPKLKLLLDEVKEKF 354          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Medaka
Match: skor1b (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:101171078])

HSP 1 Score: 69.707 bits (169), Expect = 2.781e-12
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  111 LISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYC-FGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTH 539
            ++S       ++ +  +  +  ++  Y  I+     L I C QCTP QL IL     +     +CG+I K +A+RLCK     +  S       F   + H C +G + +F+ P  Y  S ++CIKC+ C+  F+  +F+ H+H
Sbjct:   56 IVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGAH--SPPKLPENFAFDVSHECAWGSRGSFI-PARYNSSRAKCIKCSYCNMYFSPNKFIFHSH 196          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Planmine SMEST
Match: SMESG000070642.1 (SMESG000070642.1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 412/413 (99.76%), Postives = 413/413 (100.00%), Query Frame = 3
Query:   66 MESKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKRKDVIRSNTDQITFIPNVYIDSKDNXXXXXXXXXXXXXXXXXXXXXXNKESKLNSLANISEERLNILQKINEYKRIISTEKSKNYLGRHSTKFCNRKFQPKYILLSRFQKNESDKMETEIGPSTNKCTYEMSFHIRNQLHKSVFEKLNYLMQITEQRKQRKSAR 1304
            MESKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKRKDVIRSNTDQITFIPNVYIDSKDNLSCDSLTDSVLDDDDDEYEDLSNKESKLNSLANISEERLNILQKINEYKRIISTEKSKNYLGRHSTKFCNRKFQPKYILLSRFQKNES+KMETEIGPSTNKCTYEMSFHIRNQLHKSVFEKLNYLMQITEQRKQRKSAR
Sbjct:    1 MESKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKRKDVIRSNTDQITFIPNVYIDSKDNLSCDSLTDSVLDDDDDEYEDLSNKESKLNSLANISEERLNILQKINEYKRIISTEKSKNYLGRHSTKFCNRKFQPKYILLSRFQKNESEKMETEIGPSTNKCTYEMSFHIRNQLHKSVFEKLNYLMQITEQRKQRKSAR 413          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Planmine SMEST
Match: SMESG000018825.1 (SMESG000018825.1)

HSP 1 Score: 168.318 bits (425), Expect = 5.843e-46
Identity = 106/291 (36.43%), Postives = 155/291 (53.26%), Query Frame = 3
Query:   96 LENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIH--NTNLTSIRST----SSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHI-NTVHWGFHSLNWRYFIYIYI--FNADVEYHKNATLILDNIKSAFLKEDMKKMKN---KLPWRP-KNLRINIPPISTNKVNSIFQEMKPIFKR---KDVIRSNT---------DQIT---FIPNVYIDSKD 884
            +EN  +  F      +I +P L+R    + D   I+Q +T L I C QC  +Q+++LH  +I    + +CGLI K DA+RLCK++   N N ++I  T    S    I ++H CFG Q+  LYP LY  S+++CIKCA+C   F T EFV HTH K++ + NT HWGF S NWR  + IY    N +VE   +   ILD +K+ + ++++KK       L WRP +  ++  PP    K N  F   KP   R    DV R  +         D+++   F+PNVY+   D
Sbjct:    2 IENELIAGFNVWGERRICLPQLLRFVLPEFDINVIDQAVTDLRINCFQCNNQQIKMLHDNEIFPKHIVRCGLIRKSDAERLCKYLFQPNQNYSTISETNQKLSQQESIQVVHTCFGEQRGILYPVLYNSSDAKCIKCATCENFFKTFEFVGHTH-KLDEVSNTFHWGFDSNNWRLLLQIYTDPENGNVEMLNDKKSILDKVKALYYEDEIKKRNQTNINLVWRPSRKFKLPNPP----KPN--FNSPKPPHLRDGLADVYRKTSNSSLNVSKFDKLSNNNFVPNVYLQPPD 285          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Planmine SMEST
Match: SMESG000067290.1 (SMESG000067290.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.962e-27
Identity = 61/194 (31.44%), Postives = 101/194 (52.06%), Query Frame = 3
Query:   90 TELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFI-------------HNTNLTSIRSTSSLFV---IPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHL----KINHINTVHWGFHSLNWRYFIYI 611
            T L   ++ SF N     + +P ++ +  ++ID   IN+ +  + I C +C  E+L +LH   IL   V  CGLI + +A+R+ KF              +N  +TS + TS       I + H CFG+Q+  ++P  Y  +N++CI+C  CS++ +  +FV HTH     K +     HWGF S NWR+++ +
Sbjct:  116 TLLNKTYIASFNNDGEKLLCLPQIL-NLLKNIDISDINEAINSMGIICTECDEERLSVLHKHNILPKQVTCCGLISQSNAERMLKFFTSIGIDINSSEMNNNNTITSDKITSDSAAYHQIRVTHDCFGQQKGIIFPLKYTHANAQCIECLECSKMMSPSDFVGHTHQEFGSKWSETEVCHWGFDSSNWRWYLRL 308          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Planmine SMEST
Match: SMESG000002232.1 (SMESG000002232.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.746e-19
Identity = 60/191 (31.41%), Postives = 96/191 (50.26%), Query Frame = 3
Query:  162 IRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTN-----LTSIRSTSSLFVIPIIHYCFGR---QQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYI--FNADVEYHKNATLILDNIKSAFLKEDMKK 704
            +R    + D+  I+Q++T L I C QC  +Q+++L   +I    + +CG+I K DA+RLCK++   N     +T   +  + F +      F R    +  LYP LY  S+++CIKCA       T E            NT  WGF S NWR  + IY    N +VE   +   +LD +K+ + ++++KK
Sbjct:    1 MRLTLPEFDFNVIDQVVTDLRINCFQCNNQQIKMLRDNEIFLKHIVRCGIIRKSDAERLCKYLFQPNQNYSTITKCLANKNRFRL------FTRVLENKVVLYPVLYSSSDAKCIKCA-------TYEVS----------NTFRWGFDSNNWRLLLQIYTDPENGNVEMINDMKSVLDKVKALYYEDEIKK 168          
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Planmine SMEST
Match: SMESG000037051.1 (SMESG000037051.1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.470e-18
Identity = 57/169 (33.73%), Postives = 84/169 (49.70%), Query Frame = 3
Query:  303 CGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKINHI-NTVHWGFHSLNWRYFIYIYI--FNADVEYHKNATLILDNIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMK 800
            CG I K D +  CK+     L  + + + L    + H   G Q+  L+P LY  S+++CI CA C  +F T EF+ HTH K++ + NT HWGF S NWR  + +Y+   NA VE       +L+++KS   K  M K +        +  +N   +  NKV      MK
Sbjct:   13 CGPIRKSDTECSCKY-----LPLLSNPTKLQQNQVAHPYPGEQRGVLHPMLYNSSDAKCINCAMCENLFKTFEFIDHTH-KLDEVSNTFHWGFCSNNWRLLLQVYVDPENAIVE-------VLNDMKSILQKTAMMKCEVTFTENGNDEMLNDMKLILNKVKYCITRMK 168          
The following BLAST results are available for this feature:
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SKI9.504e-2730.00SKI proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10... [more]
SKIL2.916e-2529.15SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
SKIL2.916e-2529.15SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
SKIL2.982e-2529.15SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
SKIL3.175e-2529.15SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snoo4.889e-3235.19gene:FBgn0085450 transcript:FBtr0343409[more]
Snoo4.889e-3235.19gene:FBgn0085450 transcript:FBtr0112717[more]
Snoo4.889e-3235.19gene:FBgn0085450 transcript:FBtr0112719[more]
Snoo4.889e-3235.19gene:FBgn0085450 transcript:FBtr0112718[more]
fuss1.099e-1231.34gene:FBgn0039932 transcript:FBtr0301336[more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
skia3.599e-2931.73v-ski avian sarcoma viral oncogene homolog a [Sour... [more]
skib1.162e-2732.70v-ski avian sarcoma viral oncogene homolog b [Sour... [more]
skilb4.130e-2426.85SKI-like proto-oncogene b [Source:ZFIN;Acc:ZDB-GEN... [more]
skilb4.130e-2426.85SKI-like proto-oncogene b [Source:ZFIN;Acc:ZDB-GEN... [more]
skila1.281e-2327.75SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000042147.12.056e-2630.14SKI-like proto-oncogene [Source:NCBI gene;Acc:1004... [more]
SKI3.132e-2528.77SKI proto-oncogene [Source:NCBI gene;Acc:100486949... [more]
arg11.410e-1227.27arginase 1 [Source:Xenbase;Acc:XB-GENE-966913][more]
SKOR12.669e-1226.11SKI family transcriptional corepressor 1 [Source:N... [more]
SKOR12.840e-1226.11SKI family transcriptional corepressor 1 [Source:N... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ski2.595e-2828.52ski sarcoma viral oncogene homolog (avian) [Source... [more]
Ski8.323e-2828.06ski sarcoma viral oncogene homolog (avian) [Source... [more]
Skil1.949e-2629.15SKI-like [Source:MGI Symbol;Acc:MGI:106203][more]
Skil3.523e-2629.15SKI-like [Source:MGI Symbol;Acc:MGI:106203][more]
Skil4.690e-2629.15SKI-like [Source:MGI Symbol;Acc:MGI:106203][more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60698|SKI_MOUSE1.696e-2728.52Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 ... [more]
sp|P12755|SKI_HUMAN4.564e-2630.00Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 S... [more]
sp|P17863|SKI_AVIES9.351e-2629.67Transforming protein Ski OS=Avian erythroblastosis... [more]
sp|Q9TUG2|SKI_HORSE1.907e-2528.81Ski oncogene OS=Equus caballus OX=9796 GN=SKI PE=2... [more]
sp|P49140|SKI_CHICK1.917e-2530.29Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 ... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y1MFT22.527e-3337.69c-SKI_SMAD_bind domain-containing protein OS=Photi... [more]
A0A482VDX33.225e-3332.48Ski Sno and/or c-SKI SMAD bind domain containing p... [more]
A0A1Z5LAJ01.433e-3229.17Transforming protein Ski (Fragment) OS=Ornithodoro... [more]
A0A1B6GH893.102e-3233.96c-SKI_SMAD_bind domain-containing protein (Fragmen... [more]
A0A484B8814.583e-3233.93c-SKI_SMAD_bind domain-containing protein OS=Droso... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
skib1.704e-3031.71ski oncogene-like [Source:NCBI gene;Acc:103031474][more]
skib2.629e-3031.71ski oncogene-like [Source:NCBI gene;Acc:103031474][more]
skia1.331e-2731.18ski oncogene [Source:NCBI gene;Acc:103046211][more]
skila3.477e-2427.23SKI like proto-oncogene [Source:NCBI gene;Acc:1030... [more]
skilb6.275e-2226.32ski-like protein [Source:NCBI gene;Acc:103027845][more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001301.13.516e-1225.69pep scaffold:Pmarinus_7.0:GL481803:9978:11426:-1 g... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO418363.457e-1930.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
skib3.691e-2931.88ski oncogene [Source:NCBI gene;Acc:101171238][more]
skia6.216e-2932.08SKI proto-oncogene [Source:NCBI gene;Acc:101164645... [more]
skia6.482e-2932.08SKI proto-oncogene [Source:NCBI gene;Acc:101164645... [more]
skila2.764e-2328.16SKI like proto-oncogene [Source:NCBI gene;Acc:1119... [more]
skor1b2.781e-1228.47SKI family transcriptional corepressor 1 [Source:N... [more]
back to top
BLAST of c-SKI_SMAD_bind domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070642.10.000e+099.76SMESG000070642.1[more]
SMESG000018825.15.843e-4636.43SMESG000018825.1[more]
SMESG000067290.11.962e-2731.44SMESG000067290.1[more]
SMESG000002232.11.746e-1931.41SMESG000002232.1[more]
SMESG000037051.17.470e-1833.73SMESG000037051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017315 ID=SMED30017315|Name=c-SKI_SMAD_bind domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1314bp
GAAAAATATCATATCTATTAGTATTTTATATTCATAATATATTACTTAAA
ATATAAAGCTTACTAATGGAATCAAAAATAATCCAACTAACTGAACTGGA
AAATCATTTCCTCATCTCTTTTGCAAATGGATCTAATATCAAAATCCTCA
TGCCACATCTAATAAGATCTTTCTTTCAAGACATAGATTATCCAACAATA
AACCAACTACTAACGTTTCTTAGTATCAAATGTTGTCAATGTACCCCAGA
ACAACTTCGAATTCTTCATACAACAAAGATTCTCTCATCCGATGTCAACC
AGTGTGGTCTTATTGACAAAGTCGATGCAAAGAGACTGTGTAAATTTATC
CATAACACCAATCTCACCTCTATTAGATCTACTTCATCTTTATTTGTCAT
ACCGATTATACATTATTGTTTTGGAAGACAACAAGCATTTCTTTATCCCG
ACCTCTACGTGAAATCGAATTCAAGATGTATAAAATGTGCCTCGTGTTCT
CAGATCTTTACCACCTGTGAGTTCGTCAAACATACCCATTTGAAAATTAA
TCATATCAACACTGTACATTGGGGATTTCATTCACTAAATTGGAGATATT
TTATTTACATATACATTTTCAATGCCGACGTAGAGTACCACAAAAATGCG
ACACTAATATTAGATAACATCAAATCTGCCTTTCTCAAAGAAGACATGAA
AAAAATGAAAAATAAATTACCCTGGAGACCGAAAAATTTAAGAATCAACA
TTCCACCTATTTCTACAAACAAAGTAAATTCAATTTTTCAAGAAATGAAA
CCTATTTTCAAAAGAAAAGACGTCATCAGATCAAACACAGATCAAATAAC
ATTTATACCGAATGTTTATATTGACTCGAAAGACAATTTAAGTTGTGATT
CTCTCACAGATTCGGTTCTTGATGACGATGATGATGAATATGAAGATCTG
TCAAATAAAGAATCAAAATTGAATTCACTGGCAAACATATCAGAGGAAAG
ATTAAATATTTTACAAAAGATAAATGAATACAAAAGAATCATATCAACAG
AAAAATCAAAAAATTATTTAGGAAGGCATTCTACAAAGTTCTGCAACCGG
AAATTTCAACCAAAATATATCCTTTTATCAAGATTTCAAAAAAATGAATC
AGATAAAATGGAAACTGAGATTGGGCCGTCGACAAATAAATGTACCTACG
AAATGAGTTTCCACATTCGAAATCAACTGCATAAATCAGTTTTCGAAAAA
CTGAACTATTTAATGCAAATTACGGAGCAGCGAAAACAGAGAAAAAGTGC
TCGATAAAATTTAG
back to top

protein sequence of SMED30017315-orf-1

>SMED30017315-orf-1 ID=SMED30017315-orf-1|Name=SMED30017315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MESKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLT
FLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNL
TSIRSTSSLFVIPIIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTT
CEFVKHTHLKINHINTVHWGFHSLNWRYFIYIYIFNADVEYHKNATLILD
NIKSAFLKEDMKKMKNKLPWRPKNLRINIPPISTNKVNSIFQEMKPIFKR
KDVIRSNTDQITFIPNVYIDSKDNLSCDSLTDSVLDDDDDEYEDLSNKES
KLNSLANISEERLNILQKINEYKRIISTEKSKNYLGRHSTKFCNRKFQPK
YILLSRFQKNESDKMETEIGPSTNKCTYEMSFHIRNQLHKSVFEKLNYLM
QITEQRKQRKSAR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR014890c-SKI_SMAD4-bd_dom
IPR003380SKI/SNO/DAC
IPR010919SAND-like_dom_sf
IPR009061DNA-bd_dom_put_sf
Vocabulary: molecular function
TermDefinition
GO:0046332SMAD binding