Coiled-coil domain-containing protein 189

Overview
NameCoiled-coil domain-containing protein 189
Smed IDSMED30017312
Length (bp)1575
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 189 (SMED30017312) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 189 (SMED30017312) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 189 (SMED30017312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 189 (SMED30017312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017312

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017312h1SMcG0005959 SmedASXL_010982SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017312h1SMcG0005959 dd_Smed_v4_12703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017312h1SMcG0005959 dd_Smed_v4_12703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017312h1SMcG0005959 dd_Smed_v4_12703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017312h1SMcG0005959 dd_Smed_v4_12703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017312h1SMcG0005959 dd_Smed_v6_12703_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017312h1SMcG0005959 dd_Smed_v4_12703_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Human
Match: CCDC189 (coiled-coil domain containing 189 [Source:HGNC Symbol;Acc:HGNC:28078])

HSP 1 Score: 119.398 bits (298), Expect = 3.467e-29
Identity = 74/276 (26.81%), Postives = 135/276 (48.91%), Query Frame = 1
Query:   82 LLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGY---------PNITEEVKEAEIKVEPEITA--DEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            + +W  + +  +     +  N  +R  L ++  +   +  ++  I LDLF +   FC+   FS EQ S   +L+Q++HK    +   N E  +++F   L  H V                     RPPFS+++F  EQ   + +Y+++TYFRHFK+YKY FT +V LDL + Y         P    E +E++   E  +T   +E+ETV   +               +   I +LR +I++ ++ E+++++G +++RLK  +E ++SKL  ++
Sbjct:   76 ICMWKYLDVHSMHQLEKT-TNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSLEQTSAACALLQDLHKACIATPLGNVEECYRYFTSVLFCHGVR--------------------RPPFSIDLFKEEQLLALEDYVVNTYFRHFKLYKYVFTPQVRLDLSLTYMGLQPPKLWPESETEKEESKEMEEQAVTPQKEELETVAPPEP--------------EPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALE 316          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Human
Match: CCDC189 (coiled-coil domain containing 189 [Source:HGNC Symbol;Acc:HGNC:28078])

HSP 1 Score: 108.997 bits (271), Expect = 3.714e-25
Identity = 80/321 (24.92%), Postives = 143/321 (44.55%), Query Frame = 1
Query:   82 LLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVH----------------VNNFFSEI*QIYML----------NI**F*-------------------RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGY---------PNITEEVKEAEIKVEPEITA--DEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            + +W  + +  +     +  N  +R  L ++  +   +  ++  I LDLF +   FC+   FS EQ S   +L+Q++HK    +   N E  +++F   L  H V                 V+   S I   Y+L              F                    RPPFS+++F  EQ   + +Y+++TYFRHFK+YKY FT +V LDL + Y         P    E +E++   E  +T   +E+ETV   +               +   I +LR +I++ ++ E+++++G +++RLK  +E ++SKL  ++
Sbjct:   76 ICMWKYLDVHSMHQLEKT-TNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSLEQTSAACALLQDLHKACIATPLGNVEECYRYFTSVLFCHGVRVSSPGTFWKLYPSPDKVSPSLSHIHHPYLLVKTPVGSPCSCCWAFGGKARAPEGSQGSNSESPPQRPPFSIDLFKEEQLLALEDYVVNTYFRHFKLYKYVFTPQVRLDLSLTYMGLQPPKLWPESETEKEESKEMEEQAVTPQKEELETVAPPEP--------------EPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALE 381          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Human
Match: CCDC189 (coiled-coil domain containing 189 [Source:HGNC Symbol;Acc:HGNC:28078])

HSP 1 Score: 82.0333 bits (201), Expect = 7.150e-18
Identity = 49/182 (26.92%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  331 SSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            +   N E  +++F   L  H V                     RPPFS+++F  EQ   + +Y+++TYFRHFK+YKY FT +V LDL + Y           + ++P     E ET                        I +LR +I++ ++ E+++++G +++RLK  +E ++SKL  ++
Sbjct:    2 TPLGNVEECYRYFTSVLFCHGVR--------------------RPPFSIDLFKEEQLLALEDYVVNTYFRHFKLYKYVFTPQVRLDLSLTY-----------MGLQPPKLWPESET----------------------GHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALE 130          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Zebrafish
Match: si:ch73-81k8.2 (si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20])

HSP 1 Score: 129.413 bits (324), Expect = 1.832e-33
Identity = 82/281 (29.18%), Postives = 140/281 (49.82%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVK-EAEIKVEPEITADEIET----------VDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVDID 882
            K R+LLW+D+  S ++    S   ++I   L +    +  +S+ KQ ++L+L+    +FC+  NF+ EQ SV +S+++NVH+ N+E+S +N++    + +E L+ H V                     RPPFS+++FNSEQ   I  Y I+TY RH+ +YKY FT EV LD+ + Y  I E+   E   K + E  ADE             V Q     E  T   ++ N    S   LR  +   + +E+ ++   +   LK   + +N+ ++ ++ +
Sbjct:   25 KARVLLWADLKHSDMEEIEKSKSTQDIERILCRALVAD--ESQPKQRVLLELYTNLVRFCREQNFNREQTSVLISIIKNVHQFNTETSLNNTDDCLTYCSELLICHSVR--------------------RPPFSIDLFNSEQVTHILYYFINTYMRHYFLYKYIFTPEVQLDISLSYTGIPEDTDIEPTAKSQSESPADEERETERETEMDGEVQQSSELPEMKTTEIKSPNPGLSSKSDLRTIVEKEVRNEVMRLSAQLQQELKNSADQLNNAISQLETN 283          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Zebrafish
Match: si:ch73-81k8.2 (si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20])

HSP 1 Score: 116.316 bits (290), Expect = 4.628e-29
Identity = 72/241 (29.88%), Postives = 121/241 (50.21%), Query Frame = 1
Query:  193 DSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVK-EAEIKVEPEITADEIET----------VDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVDID 882
            +S+ KQ ++L+L+    +FC+  NF+ EQ SV +S+++NVH+ N+E+S +N++    + +E L+ H V                     RPPFS+++FNSEQ   I  Y I+TY RH+ +YKY FT EV LD+ + Y  I E+   E   K + E  ADE             V Q     E  T   ++ N    S   LR  +   + +E+ ++   +   LK   + +N+ ++ ++ +
Sbjct:   25 ESQPKQRVLLELYTNLVRFCREQNFNREQTSVLISIIKNVHQFNTETSLNNTDDCLTYCSELLICHSVR--------------------RPPFSIDLFNSEQVTHILYYFINTYMRHYFLYKYIFTPEVQLDISLSYTGIPEDTDIEPTAKSQSESPADEERETERETEMDGEVQQSSELPEMKTTEIKSPNPGLSSKSDLRTIVEKEVRNEVMRLSAQLQQELKNSADQLNNAISQLETN 245          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Xenopus
Match: ENSXETT00000022479.1 (coiled-coil domain containing 189 [Source:NCBI gene;Acc:100493957])

HSP 1 Score: 137.502 bits (345), Expect = 6.469e-37
Identity = 67/195 (34.36%), Postives = 109/195 (55.90%), Query Frame = 1
Query:   70 QKPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPE 654
            +KP++ LW D+S+  +++   +   ++I   L  + +++   S+ +  ++LDL++Y  +FC+   F+ EQ S   S+V+  H   +++   N +A +Q+F E LL H VH                    RPPFSLE+F  +Q   IS Y+++TYFRHFK+YKY FT +V LDL I Y    E + EAE+  + E
Sbjct:   21 RKPQICLWRDLSLHDVETLEKAKGADDIHRALSHILHLDCDASDPRASVILDLYYYTVRFCQDCGFNREQTSCLFSIVKETHAACTDTPLSNIDACYQYFKELLLCHSVH--------------------RPPFSLELFTQQQILQISSYMMNTYFRHFKLYKYVFTPQVHLDLSILY----EGMAEAEVASDRE 191          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Mouse
Match: Ccdc189 (coiled-coil domain containing 189 [Source:MGI Symbol;Acc:MGI:2685012])

HSP 1 Score: 135.191 bits (339), Expect = 4.446e-35
Identity = 73/268 (27.24%), Postives = 136/268 (50.75%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            +PR+ +W  + I  +     +   E +R  L ++  +   +  ++  I+LDLF +   FC+   FS EQ S   +++Q++HK    +   N E  +++F   L  H +                     RPPFS+++F  EQ   +++Y+++TYFRHFK+YKY FT +V LDL + Y  +       E     E   +E+  V+Q  +  E    +     +Q   + +L+ +I+S LS E+++++  +++RLK  +E ++SKL  ++
Sbjct:   76 QPRICMWKYLDIHSMHRLEKAATVEKMREVLAELLELGFPEQSLRDAIILDLFSHALIFCRQQGFSPEQTSAACAMLQDLHKACVATPLGNVEECYRYFTSVLFCHGIR--------------------RPPFSIDLFKEEQLLALADYVVNTYFRHFKLYKYVFTPQVRLDLSLTYTGLQPLTLWPE-----EKENEEMMVVEQVATPQEEEPETVTEPEQQPSEVCILQTYIKSQLSKELRQLQQLVEERLKESEERLSSKLAALE 318          
BLAST of Coiled-coil domain-containing protein 189 vs. UniProt/SwissProt
Match: sp|Q6NZQ0|CC189_MOUSE (Coiled-coil domain-containing protein 189 OS=Mus musculus OX=10090 GN=Ccdc189 PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 3.110e-34
Identity = 73/268 (27.24%), Postives = 136/268 (50.75%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            +PR+ +W  + I  +     +   E +R  L ++  +   +  ++  I+LDLF +   FC+   FS EQ S   +++Q++HK    +   N E  +++F   L  H +                     RPPFS+++F  EQ   +++Y+++TYFRHFK+YKY FT +V LDL + Y  +       E     E   +E+  V+Q  +  E    +     +Q   + +L+ +I+S LS E+++++  +++RLK  +E ++SKL  ++
Sbjct:   76 QPRICMWKYLDIHSMHRLEKAATVEKMREVLAELLELGFPEQSLRDAIILDLFSHALIFCRQQGFSPEQTSAACAMLQDLHKACVATPLGNVEECYRYFTSVLFCHGIR--------------------RPPFSIDLFKEEQLLALADYVVNTYFRHFKLYKYVFTPQVRLDLSLTYTGLQPLTLWPE-----EKENEEMMVVEQVATPQEEEPETVTEPEQQPSEVCILQTYIKSQLSKELRQLQQLVEERLKESEERLSSKLAALE 318          
BLAST of Coiled-coil domain-containing protein 189 vs. UniProt/SwissProt
Match: sp|A1A4V9|CC189_HUMAN (Coiled-coil domain-containing protein 189 OS=Homo sapiens OX=9606 GN=CCDC189 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.665e-28
Identity = 74/276 (26.81%), Postives = 135/276 (48.91%), Query Frame = 1
Query:   82 LLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGY---------PNITEEVKEAEIKVEPEITA--DEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            + +W  + +  +     +  N  +R  L ++  +   +  ++  I LDLF +   FC+   FS EQ S   +L+Q++HK    +   N E  +++F   L  H V                     RPPFS+++F  EQ   + +Y+++TYFRHFK+YKY FT +V LDL + Y         P    E +E++   E  +T   +E+ETV   +               +   I +LR +I++ ++ E+++++G +++RLK  +E ++SKL  ++
Sbjct:   76 ICMWKYLDVHSMHQLEKT-TNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSLEQTSAACALLQDLHKACIATPLGNVEECYRYFTSVLFCHGVR--------------------RPPFSIDLFKEEQLLALEDYVVNTYFRHFKLYKYVFTPQVRLDLSLTYMGLQPPKLWPESETEKEESKEMEEQAVTPQKEELETVAPPEP--------------EPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKLTALE 316          
BLAST of Coiled-coil domain-containing protein 189 vs. TrEMBL
Match: A0A2T7PHW0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08450 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 3.514e-48
Identity = 91/264 (34.47%), Postives = 154/264 (58.33%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKL 864
            K ++++WSD+S+  +D  N S   ++++  L  +F+++ +  + +Q I++DL++Y  +F + +NF+ E+ S F S+++N+H    E+ F N E  F++F + +L H V+                    RPPFS+E+FN+E+ + ISEY I+TYFRHFKMYKYAFT  V LDL I Y  +        +   P +  DE+ T   E S  +  T   +   E+S +   LR  I+++L++E+KKVK  ++ +LK  ++S+N KL
Sbjct:   27 KAKVVVWSDLSVDDVDRLNESLSVDHVKQVLADIFHLDSWQEDPRQAIVMDLYYYTLQFAQDNNFNREKTSTFFSIIKNIHSACVETPFGNLEHTFRYFKDLILCHSVN--------------------RPPFSIELFNAEEIQKISEYTINTYFRHFKMYKYAFTPVVRLDLAITYQGVP-------VSPRPSV-GDELTTEGTEVSPEDEQTAEHKPKEEESGARKELRAMIQTYLAEEIKKVKATVEQQLKATEDSVNRKL 262          
BLAST of Coiled-coil domain-containing protein 189 vs. TrEMBL
Match: A0A210Q7V5 (Coiled-coil domain-containing protein C16orf93-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16583 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.625e-46
Identity = 90/278 (32.37%), Postives = 163/278 (58.63%), Query Frame = 1
Query:   55 IMLLSQKPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEI----TADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            I   S + ++ +W+D+++  +D  N S +  +I+  L +VF ++ +   +K  I+LDL++Y  +F K + F++E++S   S+V+  H++  E+ F N +  F +F E +L H V+                    RPPFS+E+F +++ + I+EY+I+TYFRHFKMYKYAFT  V LDL + Y  +     ++E+  +P++    +A+++   D E   GE          E+SD+   LR  I++FLS+E+KK+K  +++++K  +E++N KL+T +
Sbjct:   20 IQPRSHRAKVCVWADLTVDDVDRINESDNAAHIKQVLAEVFQLSDHRDNLKAGIILDLYYYTIQFAKENGFNKEKLSTLFSIVKKTHEVCIETPFGNVDQTFNYFKELVLCHSVN--------------------RPPFSIELFTADEIRSITEYVINTYFRHFKMYKYAFTPLVRLDLSLTYAGMPPSPPQSEVG-DPDVPIEESAEDLVPEDTERGTGEGEQEEKTPEPEESDARKELRSMIQTFLSEEVKKMKVSVEEQIKTTEETLNKKLDTAE 276          
BLAST of Coiled-coil domain-containing protein 189 vs. TrEMBL
Match: A0A1S3HCT1 (coiled-coil domain-containing protein 189 OS=Lingula unguis OX=7574 GN=LOC106153508 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 9.801e-44
Identity = 88/277 (31.77%), Postives = 160/277 (57.76%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINL-YDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGY-------PNITEEVKEAEIKVEP-EITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            K ++L+W+D++++ +DS   +   ++I+N LR    +N   D  +K +I+LDL++Y  +F + +NF++EQ S F S+V+ VH + +E+ F N E  F+ F + +L H V                     RPPFS+++F+ ++ + +++Y+I TYFRH+K+YKYAFT  V LDL + Y       P  +E  ++  ++ EP E T  E +  +Q     E      +   E+S+S   LR  I++ L++EM K++  +++++KV  E++N KL+ ++
Sbjct:   19 KAKVLVWADLTVADMDSLEEASTVDDIKNILRTTASLNTNGDDTLKTDILLDLYYYTIQFARDNNFTKEQTSAFFSIVKRVHDVATETPFGNVEQCFKLFKDLILCHAVK--------------------RPPFSIDLFSPDELRKVTDYVIHTYFRHYKLYKYAFTPMVRLDLSMNYIGVPVTSPAPSEAGEDVAVETEPTEGTEGEAQDAEQAPEPQEE-----QPQTEESESAKELRSMIQAHLTEEMNKLRLSMEEQIKVTDEALNKKLSALE 270          
BLAST of Coiled-coil domain-containing protein 189 vs. TrEMBL
Match: V3ZUX7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_214955 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 8.300e-41
Identity = 93/280 (33.21%), Postives = 159/280 (56.79%), Query Frame = 1
Query:   55 IMLLSQKPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIK-VEPEITA-DEIETVDQEDSAGESFTVSTETSN----EQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            I     K ++ +W+D+++  +D  N S + ++ +  L  +F I  Y   +K  + +DL++Y  +F + + F++E++S   S+++  H++  E+ F N +  F++F + LL H V                     RPP S++++N+++ + I+EY I+TYFRHFKMYKYAFT  V LDL + Y  I E  +  E   VE E  A DE++ VD +    E  T +TET N    E+S +   LR  I+SFLS+E+KK+K  +++++K  +E ++ KL  V+
Sbjct:   17 IQPREHKAKICVWADLTVDDVDKLNESLNADHNKQVLANIFGIEDYKENLKSGVTIDLYYYTLQFARENGFNKEKLSAVFSIIKKTHEVCIETPFGNLDQTFKYFRDLLLCHAVK--------------------RPPHSIDLYNADEVRKITEYTINTYFRHFKMYKYAFTPLVRLDLAMNYIGIPESPRPEEAGDVEGEGQADDELKDVDDQI---EGQTENTETQNTPEIEESPARKELRTMIQSFLSEEIKKMKLSVEEQIKSSEEVLHHKLEAVE 273          
BLAST of Coiled-coil domain-containing protein 189 vs. TrEMBL
Match: M3XGG7 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 GN=CCDC189 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 4.864e-39
Identity = 85/271 (31.37%), Postives = 148/271 (54.61%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITE--EVKEAEIKVEPEITADEIETVD-QEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            K ++ LWSD+++S +D    +   E +R+ L  +  +  Y S+ + EI+LD++F+   F + H F++EQ S  +S+++ VH    E+   N +  F +F E L  H V                     RPPFS+++FN +Q  LI++Y+++TYFRHFK+YKY FT +V  DL   Y  + E  EV+      EPE  +  +E  D QE+       + T+   E  D +  LRK+I+S + +++++++   + RL+  +E +++KL  V+
Sbjct:   13 KAKICLWSDLTVSGMDLLETTNTAEQLRDILGGLLGLENYASDPRVEILLDVYFHAVLFAREHGFNQEQTSTLVSIIKRVHGACVETPLGNRDLCFNYFTELLFCHSVR--------------------RPPFSIDLFNMDQVTLITDYIVNTYFRHFKLYKYIFTPQVKKDLTFSYVGLPELSEVQ------EPEEESQILEAPDFQEE-------IETDAGEENKDPVAELRKYIQSQVGEQIQQLRVSFETRLRASEEELSAKLTAVE 250          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Sea Lamprey
Match: si:ch73-81k8.2 (si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20])

HSP 1 Score: 141.354 bits (355), Expect = 6.553e-39
Identity = 77/268 (28.73%), Postives = 138/268 (51.49%), Query Frame = 1
Query:   73 KPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            K R+ LW+D++++ +D    +     +R  L  V  +  +  E + ++ LDL+FY  +F + HNF++EQ SV  ++V+  H++ +E+   N E  F +F E +L H V                     RPPFS+++FN+E+ KLI +Y+++TYFRH+K+YKY FT  V LDL I Y  + EE   +     P          +   S+  S + +  T    +     L+ +I+  LS ++  V   I +++K  ++ +  +L +++
Sbjct:    1 KARICLWADLTVNNMDLLEQAVTAHQLRETLSDVLGLRQHMDEERTQVELDLYFYTVQFAREHNFNKEQTSVLFTIVKRTHEVCTETPLGNLEQCFSYFRELVLCHAVR--------------------RPPFSIDLFNAEEVKLIMDYVVNTYFRHYKLYKYVFTPTVRLDLSISYTGLDEESPSSPDGKFPLF-------WNGLHSSSVSLSTAQYTHPHATQEKTDLKSYIQRELSAQLSHVHATIAEQMKQSEQQLAERLASIE 241          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Sea Lamprey
Match: si:ch73-81k8.2 (si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20])

HSP 1 Score: 132.494 bits (332), Expect = 1.357e-35
Identity = 76/267 (28.46%), Postives = 137/267 (51.31%), Query Frame = 1
Query:  100 ISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITAD-EIETVDQEDSA---GESFTVSTETSNEQSDSI----LLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            ++++ +D    +     +R  L  V  +  +  E + ++ LDL+FY  +F + HNF++EQ SV  ++V+  H++ +E+   N E  F +F E +L H V                     RPPFS+++FN+E+ KLI +Y+++TYFRH+K+YKY FT  V LDL I Y  +       EIK +     D E + V Q+      G    ++ E   + + S+      L+ +I+  LS ++  V   I +++K  ++ +  +L +++
Sbjct:    1 LTVNNMDLLEQAVTAHQLRETLSDVLGLRQHMDEERTQVELDLYFYTVQFAREHNFNKEQTSVLFTIVKRTHEVCTETPLGNLEQCFSYFRELVLCHAVR--------------------RPPFSIDLFNAEEVKLIMDYVVNTYFRHYKLYKYVFTPTVRLDLSISYTGLD------EIKADANEGGDNEGDKVSQDTGCMEQGPPAVIANEVPEQPASSVEEEKTDLKSYIQRELSAQLSHVHATIAEQMKQSEQQLAERLASIE 241          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Sea Lamprey
Match: si:ch73-81k8.2 (si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20])

HSP 1 Score: 130.183 bits (326), Expect = 7.319e-35
Identity = 77/264 (29.17%), Postives = 138/264 (52.27%), Query Frame = 1
Query:  100 ISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAE-----IKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVD 876
            ++++ +D    +     +R  L  V  +  +  E + ++ LDL+FY  +F + HNF++EQ SV  ++V+  H++ +E+   N E  F +F E +L H V                     RPPFS+++FN+E+ KLI +Y+++TYFRH+K+YKY FT  V LDL I Y  + EE   +       KV   + A+E+   +Q  S+ E          E++D    L+ +I+  LS ++  V   I +++K  ++ +  +L +++
Sbjct:    1 LTVNNMDLLEQAVTAHQLRETLSDVLGLRQHMDEERTQVELDLYFYTVQFAREHNFNKEQTSVLFTIVKRTHEVCTETPLGNLEQCFSYFRELVLCHAVR--------------------RPPFSIDLFNAEEVKLIMDYVVNTYFRHYKLYKYVFTPTVRLDLSISYTGLDEESPSSPDEHNYCKVIIPVIANEVP--EQPASSVE---------EEKTD----LKSYIQRELSAQLSHVHATIAEQMKQSEQQLAERLASIE 229          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Nematostella
Match: EDO36882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHF5])

HSP 1 Score: 50.0618 bits (118), Expect = 1.075e-6
Identity = 41/164 (25.00%), Postives = 73/164 (44.51%), Query Frame = 1
Query:   85 LLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAE 576
            L W  +S  Q  S       E +   + ++  I  Y   + +  +LD +   + F K  NF+ +Q S F+++++ + +   E      E++ +F N   LL  + V N                      LE F+  Q KLI++Y  ++ F+H+K+YK+ FT E
Sbjct:   43 LAWKVLSEEQTLSLKELTVTE-LEAKMAEILGIENYHISLPEACVLDYYVSGFWFTKEQNFNTQQCSAFVTVLKILLENIKEKQLSLVESLKEFRN---LLVGIGVENCSKT----------------GGLECFDVSQAKLITDYFTESLFKHYKLYKFLFTQE 186          
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Medaka
Match: ENSORLT00000038446.1 (coiled-coil domain containing 189 [Source:NCBI gene;Acc:101166089])

HSP 1 Score: 91.6633 bits (226), Expect = 6.027e-20
Identity = 64/217 (29.49%), Postives = 106/217 (48.85%), Query Frame = 1
Query:   67 SQKPRLLLWSDISISQIDSFNNSYDNENIRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIE------TVDQEDSA 699
            S K +++LW DIS   ++  +      ++ + L ++F I+L   E K+ ++L+L+     F +   F +EQ S  LS+++++H+ N  +   + E  F +  E LL H V                     RPPFS+ IF  EQ   I +YL + Y ++ K+YKY FT +  LDL + Y  + E+   A   VE    AD +E      T DQ+ ++
Sbjct:  103 SLKAKVMLWRDISYHDMEIIDQIKSVPDLESALCRLFGIDL--PEPKRGVVLELYVQAVLFGRKQRFKKEQASALLSIIKSIHEANVGNILKDEEECFHYCVELLLCHSVR--------------------RPPFSINIFTFEQANSILKYLDNVYLKYCKLYKYIFTPQHRLDLFLTYSGMEEDASSA---VEDRDVADLMEETKERLTTDQQGAS 294          
BLAST of Coiled-coil domain-containing protein 189 vs. Planmine SMEST
Match: SMESG000046576.1 (SMESG000046576.1)

HSP 1 Score: 384.8 bits (987), Expect = 8.202e-133
Identity = 198/222 (89.19%), Postives = 199/222 (89.64%), Query Frame = 1
Query:  217 MLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVDID 882
            MLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVH                    RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKI YPNITEEVKEAEIK E EITA+EIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVDID
Sbjct:    1 MLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVH--------------------RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIDYPNITEEVKEAEIKEELEITANEIETVDQEDSAGESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKESINSKLNTVDID 202          
BLAST of Coiled-coil domain-containing protein 189 vs. Planmine SMEST
Match: SMESG000046576.1 (SMESG000046576.1)

HSP 1 Score: 234.187 bits (596), Expect = 3.088e-75
Identity = 121/142 (85.21%), Postives = 121/142 (85.21%), Query Frame = 1
Query:  217 MLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*QIYMLNI**F*RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIGYPNITEEVKEAEIK 642
            MLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVH                    RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKI YPNITEEVKEAEIK
Sbjct:    1 MLDLFFYCYKFCKTHNFSEEQISVFLSLVQNVHKLNSESSFDNSEAVFQFFNESLLLHCVH--------------------RPPFSLEIFNSEQFKLISEYLIDTYFRHFKMYKYAFTAEVLLDLKIDYPNITEEVKEAEIK 122          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CCDC1893.467e-2926.81coiled-coil domain containing 189 [Source:HGNC Sym... [more]
CCDC1893.714e-2524.92coiled-coil domain containing 189 [Source:HGNC Sym... [more]
CCDC1897.150e-1826.92coiled-coil domain containing 189 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch73-81k8.21.832e-3329.18si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20... [more]
si:ch73-81k8.24.628e-2929.88si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000022479.16.469e-3734.36coiled-coil domain containing 189 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc1894.446e-3527.24coiled-coil domain containing 189 [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q6NZQ0|CC189_MOUSE3.110e-3427.24Coiled-coil domain-containing protein 189 OS=Mus m... [more]
sp|A1A4V9|CC189_HUMAN1.665e-2826.81Coiled-coil domain-containing protein 189 OS=Homo ... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PHW03.514e-4834.47Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210Q7V51.625e-4632.37Coiled-coil domain-containing protein C16orf93-lik... [more]
A0A1S3HCT19.801e-4431.77coiled-coil domain-containing protein 189 OS=Lingu... [more]
V3ZUX78.300e-4133.21Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
M3XGG74.864e-3931.37Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-81k8.26.553e-3928.73si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20... [more]
si:ch73-81k8.21.357e-3528.46si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20... [more]
si:ch73-81k8.27.319e-3529.17si:ch73-81k8.2 [Source:ZFIN;Acc:ZDB-GENE-130531-20... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO368821.075e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000038446.16.027e-2029.49coiled-coil domain containing 189 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 189 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000046576.18.202e-13389.19SMESG000046576.1[more]
SMESG000046576.13.088e-7585.21SMESG000046576.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017312 ID=SMED30017312|Name=Coiled-coil domain-containing protein 189|organism=Schmidtea mediterranea sexual|type=transcript|length=1575bp
CTGCACTTAGCAACATATAGTTATTTTTATTTAAATTTTCACGAGATTTA
TGAAATAATGTTGCTGTCACAAAAACCTAGACTTCTATTATGGAGTGATA
TTTCAATATCGCAAATAGATTCTTTTAATAATTCTTACGATAATGAAAAT
ATTCGAAATAACTTACGAAAGGTTTTTTATATCAATCTCTACGACTCAGA
AATTAAACAAGAAATTATGTTGGATTTATTTTTCTATTGTTACAAATTCT
GCAAAACTCATAATTTTTCCGAAGAACAAATATCAGTATTTTTGTCATTG
GTGCAAAATGTGCACAAATTGAATTCAGAATCATCCTTTGACAATTCTGA
AGCCGTGTTTCAATTCTTTAATGAATCTTTGTTATTGCATTGTGTTCATG
TGAATAATTTTTTTTCCGAAATTTGACAAATATATATGTTAAACATTTAA
TGATTTTAGAGACCTCCATTTAGTTTAGAAATTTTCAATTCGGAACAATT
CAAATTAATTTCAGAATATTTAATTGATACTTACTTTAGGCATTTCAAAA
TGTATAAATACGCTTTCACTGCTGAGGTTTTGCTGGATTTGAAAATTGGT
TATCCCAATATTACCGAGGAAGTAAAGGAAGCGGAAATTAAAGTGGAACC
GGAAATTACTGCAGATGAAATTGAAACAGTTGATCAAGAAGATTCAGCAG
GAGAATCTTTTACAGTTTCAACAGAAACTTCAAATGAGCAATCTGATTCA
ATTCTACTGTTAAGAAAATTTATAAGATCATTTCTGTCAGATGAAATGAA
AAAGGTCAAAGGAGACATCGATGATCGTTTAAAGGTTGTCAAAGAATCGA
TTAATTCAAAATTAAATACGGTGGATATTGATTCTGCAACTAAAGGAAAG
AAATCAGCCAAAGGTTCGGCAAATAAAGGAAAAAAGAAATAGTTTAGTAT
CAGATATATTATATATTGATTCAAGCGATAATTTTTTAAACAGAATGTCA
AAAAATTAAAAAGTTTGCAAAAATTCGATTTGTTTTATCATTTGTTGTCT
TGGCGTCGATCTCTATACCACCTTCAAATGGTATCATATCATTAAAATAA
AAAATTAAATATTTAGAGTAAATCGACCAGGAAAGTGATTTTGAATGAAA
GCGAGTATAAGGAATGAAATTATGGGAATGAAATTATACAAATGCATAAT
TAAGTACAAAATGCACAGAAATATTGATTTACAAAAAATCAATAAGTAGT
GAAATATTCAGCATAATTTTTCGTGGATCGAATCAGTGGCGCAACAATGG
GCTAGCAAGAGCCAATAGTGTGCTGCATGAATTGGTTTTAAATTGATAAA
TGACATTTTCTTTTTTTCAAAAGCACTACAAGAAAAATCAATTAAAAAAT
TAAAATATTTTTCTGTGTTGGGGCTAGTAACCGGTGGCAAATGAAAATTT
GAAGAGGTATAAAGTAACTTTTATTTAAATTTAATTTATAGTCCAACAAT
AAAAATTTTTTTAATTTGATTAGATGTTCCTTAGCCCGGCCAATTTTGAA
ATAGAAAATTTTTATTTTACATTGC
back to top

protein sequence of SMED30017312-orf-1

>SMED30017312-orf-1 ID=SMED30017312-orf-1|Name=SMED30017312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MYKYAFTAEVLLDLKIGYPNITEEVKEAEIKVEPEITADEIETVDQEDSA
GESFTVSTETSNEQSDSILLLRKFIRSFLSDEMKKVKGDIDDRLKVVKES
INSKLNTVDIDSATKGKKSAKGSANKGKKK*
back to top

protein sequence of SMED30017312-orf-2

>SMED30017312-orf-2 ID=SMED30017312-orf-2|Name=SMED30017312-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
LHLATYSYFYLNFHEIYEIMLLSQKPRLLLWSDISISQIDSFNNSYDNEN
IRNNLRKVFYINLYDSEIKQEIMLDLFFYCYKFCKTHNFSEEQISVFLSL
VQNVHKLNSESSFDNSEAVFQFFNESLLLHCVHVNNFFSEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032727CLAMP
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032727Flagellar C1a complex subunit C1a-32PFAMPF14769CLAMPcoord: 80..135
e-value: 1.2E-10
score: 41.7
IPR032727Flagellar C1a complex subunit C1a-32PANTHERPTHR28457FAMILY NOT NAMEDcoord: 24..141
NoneNo IPR availablePANTHERPTHR28457:SF1COILED-COIL DOMAIN-CONTAINING PROTEIN 189coord: 24..141