SMED30017309

Overview
NameSMED30017309
Smed IDSMED30017309
Length (bp)3631
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30017309 (SMED30017309) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30017309 (SMED30017309) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017309 (SMED30017309) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017309 (SMED30017309) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30017309 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 65.0846 bits (157), Expect = 5.780e-10
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = -1
Query: 2207 DKDKFTKIK*TMHKAELKLFNSVLYEWF*C*ESLSNANNLVPSS-----------LNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAF 2551
            D +K  + + T+H  +L+  + VLYEWF     L   +  VP S             ++ ++         VFS  WL RF ++HGI+K D S EK+SA   A  ++C        ++ L+ EQVYNA ET  
Sbjct:   70 DSNKALEQRRTLHTPKLEHLDRVLYEWF-----LGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPC------VFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGL 191          
BLAST of SMED30017309 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 65.0846 bits (157), Expect = 5.780e-10
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = -1
Query: 2207 DKDKFTKIK*TMHKAELKLFNSVLYEWF*C*ESLSNANNLVPSS-----------LNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAF 2551
            D +K  + + T+H  +L+  + VLYEWF     L   +  VP S             ++ ++         VFS  WL RF ++HGI+K D S EK+SA   A  ++C        ++ L+ EQVYNA ET  
Sbjct:   70 DSNKALEQRRTLHTPKLEHLDRVLYEWF-----LGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPC------VFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGL 191          
BLAST of SMED30017309 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 65.0846 bits (157), Expect = 5.971e-10
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = -1
Query: 2207 DKDKFTKIK*TMHKAELKLFNSVLYEWF*C*ESLSNANNLVPSS-----------LNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAF 2551
            D +K  + + T+H  +L+  + VLYEWF     L   +  VP S             ++ ++         VFS  WL RF ++HGI+K D S EK+SA   A  ++C        ++ L+ EQVYNA ET  
Sbjct:   70 DSNKALEQRRTLHTPKLEHLDRVLYEWF-----LGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPC------VFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGL 191          
BLAST of SMED30017309 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 65.0846 bits (157), Expect = 5.971e-10
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = -1
Query: 2207 DKDKFTKIK*TMHKAELKLFNSVLYEWF*C*ESLSNANNLVPSS-----------LNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAF 2551
            D +K  + + T+H  +L+  + VLYEWF     L   +  VP S             ++ ++         VFS  WL RF ++HGI+K D S EK+SA   A  ++C        ++ L+ EQVYNA ET  
Sbjct:   70 DSNKALEQRRTLHTPKLEHLDRVLYEWF-----LGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPC------VFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGL 191          
BLAST of SMED30017309 vs. Ensembl Xenopus
Match: MPHOSPH9 (M-phase phosphoprotein 9 [Source:NCBI gene;Acc:100037862])

HSP 1 Score: 61.2326 bits (147), Expect = 1.076e-8
Identity = 56/203 (27.59%), Postives = 98/203 (48.28%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQK------RCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLET------KLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRR 1391
            + ++  YYE+EI  LK+QL  +  +I P+ + L K      RC  LE+ L ++      L  +   L+ Q+  W +R        ++L+   E++R  N++ +N I  L   +K  E       +L E      ++E+   + L+ EY+ L K+++ +K      E KL  +    N+L   V  LE +I++VE E H +K R
Sbjct:  578 LADLHDYYESEISSLKQQL--LVRNISPSSEELNKINSLSERCSQLEAALTEASTRIRLLENKNHELEMQVAEWRDRHETANNTCKTLQEHTEELRARNKENENSISRLQSRLKEKEEAFEKSFRLSEEMDARNKKEQKKFKNLLSEYESLGKEHERVKDTLHFTENKLSVAHDEINELKRSVAKLEGQIKQVEHE-HMVKLR 777          
BLAST of SMED30017309 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 61.6178 bits (148), Expect = 5.370e-9
Identity = 39/115 (33.91%), Postives = 59/115 (51.30%), Query Frame = -1
Query: 2204 TMHKAELKLFNSVLYEWF*C*--ESLSNANNLVPSSLNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAFV 2521
            T+H  +L+  + VLYEWF     E +  +  ++          M L +    VFS  WL RF ++HGI+K D S EK++A   A  ++C        ++ L+ EQVY+A ET  V
Sbjct:   80 TLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTE--PCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLV 192          
BLAST of SMED30017309 vs. UniProt/SwissProt
Match: sp|O75564|JERKY_HUMAN (Jerky protein homolog OS=Homo sapiens OX=9606 GN=JRK PE=1 SV=3)

HSP 1 Score: 65.0846 bits (157), Expect = 2.868e-9
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = -1
Query: 2207 DKDKFTKIK*TMHKAELKLFNSVLYEWF*C*ESLSNANNLVPSS-----------LNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAF 2551
            D +K  + + T+H  +L+  + VLYEWF     L   +  VP S             ++ ++         VFS  WL RF ++HGI+K D S EK+SA   A  ++C        ++ L+ EQVYNA ET  
Sbjct:   70 DSNKALEQRRTLHTPKLEHLDRVLYEWF-----LGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPC------VFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGL 191          
BLAST of SMED30017309 vs. UniProt/SwissProt
Match: sp|Q60976|JERKY_MOUSE (Jerky protein OS=Mus musculus OX=10090 GN=Jrk PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 3.756e-8
Identity = 39/115 (33.91%), Postives = 59/115 (51.30%), Query Frame = -1
Query: 2204 TMHKAELKLFNSVLYEWF*C*--ESLSNANNLVPSSLNKLNISMAL*K*LNRVFSNCWLGRF*SKHGIRKFDISGEKKSAYETATSEYC-------VKYHLTREQVYNAYETAFV 2521
            T+H  +L+  + VLYEWF     E +  +  ++          M L +    VFS  WL RF ++HGI+K D S EK++A   A  ++C        ++ L+ EQVY+A ET  V
Sbjct:   80 TLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTE--PCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLV 192          
BLAST of SMED30017309 vs. TrEMBL
Match: V9KY28 (M-phase phosphoprotein 9 (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.670e-14
Identity = 61/204 (29.90%), Postives = 114/204 (55.88%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQV--GYSIMPNEDALQ---KRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLET------KLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLG 1397
            + ++R YYE EI  LK+QL+ V   ++++  E   Q    RC  LE  L ++ +   +L  +   ++ QL  WP R   +    ++L+ R+E++R  N+++ N I++L+  +K+LE       K  ++     +QE   LQ L+ EY+ L K+++ +K      E KL+++ +  +DL   V+ LE++IR+V+ E +++K R G
Sbjct:   10 VADIRAYYEAEINSLKQQLETVNGSFTLIEAEKKHQNLLARCEQLERALTEAGSHIRALENKNHLMEMQLGDWPGRYDAVSTAAQALQQRLEEMRKGNKEKDNTINKLNARLKDLEQAFQKAYKHSDNKEARMKQEHKMLQDLLVEYESLGKEHERVKETLNITEDKLFDANSQISDLKRVVSKLEAQIRQVDHERNYMKGRSG 213          
BLAST of SMED30017309 vs. TrEMBL
Match: A0A4W3JRL9 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=mphosph9 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.176e-14
Identity = 61/204 (29.90%), Postives = 114/204 (55.88%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQV--GYSIMPNEDALQ---KRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLET------KLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLG 1397
            + ++R YYE EI  LK+QL+ V   ++++  E   Q    RC  LE  L ++ +   +L  +   ++ QL  WP R   +    ++L+ R+E++R  N+++ N I++L+  +K+LE       K  ++     +QE   LQ L+ EY+ L K+++ +K      E KL+++ +  +DL   V+ LE++IR+V+ E +++K R G
Sbjct:  640 VADIRAYYEAEINSLKQQLETVNGSFTLIEAEKKHQNLLARCEQLERALTEAGSHIRALENKNHLMEMQLGDWPGRYDAVSTAAQALQQRLEEMRKGNKEKDNTINKLNARLKDLEQAFQKAYKHSDNKEARMKQEHKMLQDLLVEYESLGKEHERVKETLNITEDKLFDANSQISDLKRVVSKLEAQIRQVDHERNYMKGRSG 843          
BLAST of SMED30017309 vs. TrEMBL
Match: A0A401QAP7 (Uncharacterized protein (Fragment) OS=Scyliorhinus torazame OX=75743 GN=scyTo_0022331 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.593e-12
Identity = 63/203 (31.03%), Postives = 112/203 (55.17%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQV-GYSIM-----PNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLET------KLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRR 1391
            + ++R YYE EI  LK++L  + G S +      NE+ L KRC  LE  L ++ N   +L  +   ++ QL  WP R   +   +++L+ R++++R  N+ + N I +L+  +K+LE       K  ++     +QE   LQ L+ EY  L K+Y+ +K    + E KL ++ +  ++L   V+ LE++IR+VE E +++K R
Sbjct:   51 VADIRAYYEAEINSLKEKLDTLNGSSTIFEAEKRNENLL-KRCEQLERALTEAANRIRNLENKNYLMEMQLADWPGRYDAVSATSQALQQRLDEMRKDNKDKDNMIGKLNSRLKDLEEAFEKAYKHSDNKDARMKQEHKILQNLLTEYKSLGKEYEQVKETLNTTEDKLLDANSQISELKRVVSKLEAQIRQVEHERNYMKVR 252          
BLAST of SMED30017309 vs. TrEMBL
Match: A0A3B5ALX2 (M-phase phosphoprotein 9 OS=Stegastes partitus OX=144197 GN=MPHOSPH9 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.858e-12
Identity = 64/238 (26.89%), Postives = 119/238 (50.00%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVL--KKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESS------TGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYRGWARSTYP-----PTLAGFEPEVSPR 1493
            + +++ YYE+EI +L  K +L+ +   +  +  AL +RC  LE+ L ++    + L    S L+ +L  WP R        +SL+ R+E+ + + +++   +  L   V+ LE    ++          +++E   LQ L+ EYD L+K+++ MK N +S E KL ++    ++L   ++ LES+++++E EN    R      S  N+   G     +P     PT    EP+V+ R
Sbjct:  653 VADLKAYYESEIQILRDKLKLRDLPQDLETSNQALTERCKHLENALAEATGRIQELEATNSSLEKKLAEWPERYAVAGATVKSLQQRLEESKRLGKEKDTLVARLKTRVRQLEEAAQKACREADEKEARREREYKMLQDLLGEYDSLMKEHEGMKNNLVSTENKLVDANDKISELKRVISKLESQVKQLEHENQARARY----ASHCNTQPSGAGLFHHPDLLLSPTKCKAEPDVTRR 886          
BLAST of SMED30017309 vs. TrEMBL
Match: A0A4U5VAF9 (M-phase phosphoprotein 9 OS=Collichthys lucidus OX=240159 GN=D9C73_018225 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 6.084e-12
Identity = 57/198 (28.79%), Postives = 101/198 (51.01%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVL--KKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESST------GNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKR 1388
            + +++ YYE+EI +L  K +L+ +   +     AL KRC  L+  L ++ N  + L    S L+ +L  WP R        +SL+ R+E+ +   + +      L   V+ LE    ++          +++E   LQ L+ EYD L+K ++ +K N MS E KLY++    +DL   ++ LES+++++E EN    R
Sbjct:  569 VADLKAYYESEIQILRDKLKLRDLPQDLEKTNQALTKRCKHLDQALAEATNRIQELEAANSSLENKLAEWPERYAVAGATVKSLQQRLEESKRSGKDKDALAARLKNHVRQLEESAQKACREADEKEARREREYKMLQDLLGEYDSLVKAHEALKNNLMSTENKLYDASDQISDLKRVISKLESQVKQLEHENQARAR 766          
BLAST of SMED30017309 vs. Ensembl Cavefish
Match: MPHOSPH9 (M-phase phosphoprotein 9 [Source:NCBI gene;Acc:103034795])

HSP 1 Score: 78.1814 bits (191), Expect = 5.132e-14
Identity = 55/195 (28.21%), Postives = 102/195 (52.31%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQVGYSIMPNEDA----LQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESST------GNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESEN 1373
            I ++R YYE+EI  LK++L  V  S+ P+ +     L +RC  LE  L ++      L  +   L+ QL  WP R        ++L+  +E+ +  ++++ N + +L   ++ +E  L  +            +E   LQ L+QEYD L KD++  K N +S E KL+++    ++L   ++ LE++++++E EN
Sbjct:  620 IADLRAYYESEISTLKEKLDLV--SLPPDMEKSNQILLERCEHLERALTEASVRIRELENRNRHLERQLAEWPERYNAASSTVQALQHHLEETKQSSREKDNTVTKLKSRLRQMEEVLQNACKEVDEKEARMNKEHKMLQDLLQEYDSLRKDHEGTKDNLVSTENKLFDANEQISELKRVISKLEAQVKQLEHEN 812          
BLAST of SMED30017309 vs. Ensembl Cavefish
Match: MPHOSPH9 (M-phase phosphoprotein 9 [Source:NCBI gene;Acc:103034795])

HSP 1 Score: 78.1814 bits (191), Expect = 5.132e-14
Identity = 55/195 (28.21%), Postives = 102/195 (52.31%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQVGYSIMPNEDA----LQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESST------GNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESEN 1373
            I ++R YYE+EI  LK++L  V  S+ P+ +     L +RC  LE  L ++      L  +   L+ QL  WP R        ++L+  +E+ +  ++++ N + +L   ++ +E  L  +            +E   LQ L+QEYD L KD++  K N +S E KL+++    ++L   ++ LE++++++E EN
Sbjct:  620 IADLRAYYESEISTLKEKLDLV--SLPPDMEKSNQILLERCEHLERALTEASVRIRELENRNRHLERQLAEWPERYNAASSTVQALQHHLEETKQSSREKDNTVTKLKSRLRQMEEVLQNACKEVDEKEARMNKEHKMLQDLLQEYDSLRKDHEGTKDNLVSTENKLFDANEQISELKRVISKLEAQVKQLEHEN 812          
BLAST of SMED30017309 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005691.1 (pep scaffold:Pmarinus_7.0:GL477106:6984:14698:-1 gene:ENSPMAG00000005147.1 transcript:ENSPMAT00000005691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.222e-7
Identity = 49/198 (24.75%), Postives = 93/198 (46.97%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQK-------RCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLET------KLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESEN 1373
            + ++R YYE EI  L ++L +      P  +A +        RC  LE  L+ +      L  +   L+ QL  W  R         +++ R+E+ R   +QR+    +L   ++++E       KL +      Q+E   LQ L+ EY+ L K+ + +K    + E KL+++    ++L    + LE++I+++E E+
Sbjct:   23 LADLRSYYEGEIASLTEKLSK-SSPRSPRREAQRASQRFVYYRCDELERALKVTHQRIRDLELRNRELEAQLTEWRERYETAAVAARAMQQRLEEARAHVRQREGATLKLQARLRDVEHAFETAYKLSDDKEARIQREHKMLQDLLAEYESLAKENERVKEALRNTEDKLFDANNEISELKRMKSRLEAQIKQIEHEH 219          
BLAST of SMED30017309 vs. Ensembl Medaka
Match: MPHOSPH9 (M-phase phosphoprotein 9 [Source:NCBI gene;Acc:101164909])

HSP 1 Score: 67.781 bits (164), Expect = 8.014e-11
Identity = 53/193 (27.46%), Postives = 97/193 (50.26%), Query Frame = 3
Query:  819 IEEMRRYYENEIYVLKKQLQ--QVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESST------GNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESEN 1373
            + +++ YYE+EI  L+++LQ   +   +  +  AL  RC  LE  L  +    + L E    L+ +L  W  R        +SL+ R+E+ +   +++      L   V+ LE     +          +++E   LQ L+ EYD L K+++ +K N +S ERKL +S    ++L   V+ LE++++++E EN
Sbjct:  597 VADLKAYYESEIQSLREKLQLRDLPQDLEKSNQALTDRCKHLEEALVNATRHIQDLEETNLSLEKKLADWAERYAVAAATVKSLQQRLEEGKRSGREKDALTSRLKTRVQQLEEAAQAARRDADEKQARREREYKMLQDLLSEYDCLTKEHESVKNNLVSAERKLVDSSDHISELKRVVSKLEAQVKQLEHEN 789          
BLAST of SMED30017309 vs. Planmine SMEST
Match: SMESG000037799.1 (SMESG000037799.1)

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 641/664 (96.54%), Postives = 643/664 (96.84%), Query Frame = 3
Query:  201 MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSRVRRSSDYSYNYKIDSFKRRTFSLEDKANIMTTSIYFTESEIKSPNLIFSSDKSDVIPEKETFEIGPNSSTRESTPLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSVETPVKNDXXXXXXXXXXXXXIKLNYSKAGSNSSGVLNXXXXXXXXXXXXXHDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYRGWARSTYPPTLAGFEPEVSPRNGSSQEFLSYSQVEPQPQFDMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMNSSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEVEDILVNQQMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVELERRYDQLQNEKKQLLTKLSHIPXXXXXXXXXXXXXXXXXXXAQLDQIDRQLGLMRMTLKQKNIL 2192
            MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSR+RRSSDYSYNYKIDSFKRRTFSLEDKANIMTT                  +KSDVIPEKETFEIGPNSSTRES PLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSVETPVKNDNSESSKKSESNSKIKLNYSKAGSN SGVLNKEKSEKPISEKKIHDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYRGWARSTYPPTLAGFEPEVSPRNGSSQEFLSYSQVEPQPQFDMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMNSSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEVEDILVN QMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVELERRYDQLQNEKKQLLTKLSHIPSNSSGRNRRSNREQRESLEAQLDQIDRQLGLMRMTLKQKNIL
Sbjct:    1 MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSRIRRSSDYSYNYKIDSFKRRTFSLEDKANIMTT------------------NKSDVIPEKETFEIGPNSSTRESAPLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSVETPVKNDNSESSKKSESNSKIKLNYSKAGSNLSGVLNKEKSEKPISEKKIHDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYRGWARSTYPPTLAGFEPEVSPRNGSSQEFLSYSQVEPQPQFDMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMNSSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEVEDILVNHQMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVELERRYDQLQNEKKQLLTKLSHIPSNSSGRNRRSNREQRESLEAQLDQIDRQLGLMRMTLKQKNIL 646          
BLAST of SMED30017309 vs. Planmine SMEST
Match: SMESG000037799.1 (SMESG000037799.1)

HSP 1 Score: 1110.9 bits (2872), Expect = 0.000e+0
Identity = 610/664 (91.87%), Postives = 612/664 (92.17%), Query Frame = 3
Query:  201 MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSRVRRSSDYSYNYKIDSFKRRTFSLEDKANIMTTSIYFTESEIKSPNLIFSSDKSDVIPEKETFEIGPNSSTRESTPLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSVETPVKNDXXXXXXXXXXXXXIKLNYSKAGSNSSGVLNXXXXXXXXXXXXXHDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYRGWARSTYPPTLAGFEPEVSPRNGSSQEFLSYSQVEPQPQFDMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMNSSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEVEDILVNQQMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVELERRYDQLQNEKKQLLTKLSHIPXXXXXXXXXXXXXXXXXXXAQLDQIDRQLGLMRMTLKQKNIL 2192
            MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSR+RRSSDYSYNYKIDSFKRRTFSLEDKANIMTT                  +KSDVIPEKETFEIGPNSSTRES PLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSVETPVKNDNSESSKKSESNSKIKLNYSKAGSN SGVLNKEKSEKPISEKKIHDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYR                               SQVEPQPQFDMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMNSSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEVEDILVN QMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVELERRYDQLQNEKKQLLTKLSHIPSNSSGRNRRSNREQRESLEAQLDQIDRQLGLMRMTLKQKNIL
Sbjct:    1 MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSRIRRSSDYSYNYKIDSFKRRTFSLEDKANIMTT------------------NKSDVIPEKETFEIGPNSSTRESAPLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSVETPVKNDNSESSKKSESNSKIKLNYSKAGSNLSGVLNKEKSEKPISEKKIHDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQLRKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQQRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYDLMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGNEKSFVNSNYR-------------------------------SQVEPQPQFDMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMNSSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEVEDILVNHQMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVELERRYDQLQNEKKQLLTKLSHIPSNSSGRNRRSNREQRESLEAQLDQIDRQLGLMRMTLKQKNIL 615          
The following BLAST results are available for this feature:
BLAST of SMED30017309 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
JRK5.780e-1032.33Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
JRK5.780e-1032.33Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
JRK5.971e-1032.33Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
JRK5.971e-1032.33Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
back to top
BLAST of SMED30017309 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017309 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017309 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017309 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPHOSPH91.076e-827.59M-phase phosphoprotein 9 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of SMED30017309 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Jrk5.370e-933.91jerky [Source:MGI Symbol;Acc:MGI:106214][more]
back to top
BLAST of SMED30017309 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|O75564|JERKY_HUMAN2.868e-932.33Jerky protein homolog OS=Homo sapiens OX=9606 GN=J... [more]
sp|Q60976|JERKY_MOUSE3.756e-833.91Jerky protein OS=Mus musculus OX=10090 GN=Jrk PE=2... [more]
back to top
BLAST of SMED30017309 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9KY281.670e-1429.90M-phase phosphoprotein 9 (Fragment) OS=Callorhinch... [more]
A0A4W3JRL92.176e-1429.90Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A401QAP71.593e-1231.03Uncharacterized protein (Fragment) OS=Scyliorhinus... [more]
A0A3B5ALX22.858e-1226.89M-phase phosphoprotein 9 OS=Stegastes partitus OX=... [more]
A0A4U5VAF96.084e-1228.79M-phase phosphoprotein 9 OS=Collichthys lucidus OX... [more]
back to top
BLAST of SMED30017309 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPHOSPH95.132e-1428.21M-phase phosphoprotein 9 [Source:NCBI gene;Acc:103... [more]
MPHOSPH95.132e-1428.21M-phase phosphoprotein 9 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30017309 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005691.11.222e-724.75pep scaffold:Pmarinus_7.0:GL477106:6984:14698:-1 g... [more]
back to top
BLAST of SMED30017309 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017309 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017309 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPHOSPH98.014e-1127.46M-phase phosphoprotein 9 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30017309 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037799.10.000e+096.54SMESG000037799.1[more]
SMESG000037799.10.000e+091.87SMESG000037799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017309 ID=SMED30017309|Name=SMED30017309|organism=Schmidtea mediterranea sexual|type=transcript|length=3631bp
GTCGATATTTACACACTATTTTAACTGTGCAGCAATAACTAACAAATTAA
TCATTGTTTTTAGAAAATTTTCACAATATAGTCAATTGGAAAGACAGAGA
AAATTGACTGTTTCCCAAAAGTGCCCGTGTGCTCATGTAAATATTGTTAG
CAGGTAATTCATTGAAAATAGGGAAACCGTTAAAAATCAAATCATGCTAA
ATGAACGTCTCATTGAAAAATTTTCCCAATACAATCAATAAAACAAAAAA
TTCTAAACCCATCACTGGAGTGAAACCAGTACAGTTCAAAGAATCTCATT
CAAAGTCGAGGGTCCGCAGATCGTCTGATTATTCTTATAATTACAAAATC
GACAGTTTTAAGCGAAGAACTTTTTCACTAGAAGATAAAGCCAACATTAT
GACAACAAGTATATATTTTACCGAAAGTGAAATTAAAAGTCCGAATTTGA
TATTTTCTTCAGATAAAAGTGATGTGATTCCAGAAAAAGAGACCTTTGAA
ATCGGGCCTAACTCCTCAACAAGAGAATCGACGCCCTTGCAGACAATTCC
GAGTAATGATTCCTTGGATAATTTAAAATCTTCTACTTTCTCAAGATCAA
GTGAATTAGAAAATGAATTTTCTTCCAATGATAAACTGGACGATTCGGTT
GAAACCCCTGTTAAAAATGACAATAGTGAAAGCTCAAAAAAGTCTGAAAG
TAATTCAAAAATAAAACTCAATTATAGTAAGGCCGGAAGTAATTCAAGCG
GTGTTTTAAACAAAGAAAAATCTGAGAAACCCATTTCTGAAAAGAAAATC
CATGATCCCAAAGTGGTCATTGAAGAGATGAGACGTTACTACGAAAATGA
AATATATGTACTCAAAAAGCAATTGCAACAAGTTGGATACAGCATTATGC
CAAACGAAGACGCACTACAAAAACGATGCCATTTGCTCGAATCCCAACTG
AGGAAATCGCAAAATGAAGCAGAATCCTTAGCAGAACAAGTCAGTGGTTT
GAAAACTCAATTGCAAACCTGGCCAAATCGAGTAACGGAACTCGAAGAAG
ACAATGAATCACTTCGAGGTCGGATCGAGGACGTGAGAGTAATCAATCAG
CAGAGGCAAAATGAAATTGACGAACTGCATGAAATTGTTAAAAATCTTGA
AACAAAGTTGTGGGAAAGTTCTACCGGTAATCAGCAACAAGAAAAGATTT
TTCTTCAGAGATTAATGCAAGAATATGATCATTTATTGAAAGATTATGAT
CTAATGAAGCTAAACTACATGTCAAACGAGAGGAAATTATACGAATCGCG
AGCCCTATCCAATGATTTGTCGAATAAAGTAACAGATTTAGAAAGCAAAA
TCCGTAAAGTGGAAAGTGAAAACCATTTCCTAAAAAGACGATTGGGTAAT
GAGAAATCGTTTGTCAATTCGAATTACCGGGGTTGGGCTCGAAGTACTTA
TCCGCCAACATTGGCAGGTTTTGAGCCAGAAGTGTCACCTAGAAACGGTT
CATCACAAGAGTTTCTATCTTATAGTCAAGTTGAGCCACAACCCCAATTT
GATATGGGAATGATGTCCATGAGCTGTTACGGAGCCCTGCCGTCGTATTC
TAATTCTAGCGATACTAGAGAACAAATATCAGAAAATATGAGAAGATTCG
AGCCCCTGAAAACTAAAATAGTTGATAGATACAATCAAGGGAAGATGAAT
AGTAGCATGTATGTCCAACCTACCGAGGACCTCAATGAAGTGATAACTCC
CACAAGTGAACGACGTAGAGTCGCAATAAAAGATGACTCTCAATATCCAA
AAAAGCAATTCAAAATAGAGTCGGCTTCGTTCGACATGTTGAATGAAGTA
GAGGATATCTTAGTTAATCAACAAATGACGACGTCAATCTCCGATTTCCG
TCAAGGAGAGATCAAACAATCTATTGGAAGAAGAAAAAAACCTGAGTATT
ACAATAGAGATTCTTGGGCCAGTAGTCGGGTTGATGAAGATGTAGAGCTT
GAAAGACGCTACGATCAACTACAAAATGAAAAGAAACAATTGCTGACAAA
ATTGAGTCACATTCCTTCGAATAGTTCAGGAAGAAACAGGCGTTCTAACA
GAGAACAGAGAGAAAGCTTAGAAGCTCAGCTTGACCAGATAGACCGGCAA
CTTGGCCTAATGCGAATGACATTAAAACAAAAAAACATTTTAAATATGGC
TACAACAAACGCGGTTTCATAAGCATTATAAACCTGTTCACGAGTGAGAT
GGTATTTTACGCAGTACTCACTCGTTGCGGTTTCATATGCTGATTTCTTT
TCACCTGAAATATCAAATTTTCTAATACCGTGCTTTGATTAAAAACGACC
TAACCAACAGTTCGAAAAAACCCTATTCAGTTACTTTTAGAGCGCCATAG
AAATATTTAGCTTATTCAATGACGATGGAACCAAGTTATTAGCATTACTT
AAACTCTCTTAACACTAAAACCACTCATATAAAACTGAATTGAACAGCTT
TAGTTCAGCCTTATGCATTGTTTACTTAATTTTAGTGAATTTATCCTTAT
CCATTTTAGAACCAGAAAGAGAATTAAAATTAATTTCGTTTCTTTATTTC
CCAGACTGATTTTTCAATATTCTATAAACCATTTTGAATGCTCAAAATAA
AAGGAGAAAATAAATAACGAAATAATTATAAGTAAAACAATATCAGAATT
CACATTTTATCCTTTTATAAATAGTTTTTTTATTAACGAAATAAAAATGA
TAAAATTTAAGAATAAAGTATTTTTATTTATCTGTAAATTATTCAAATAT
TAATTATTATTAAATTAATTCAAGTAATTGATGGAAACAATTGGAACGAA
TACGGATATATTGTTATTGTTCATTGGGAAAATGTGATACAGAGGAAGTT
TAAAAGTACTGGGAAAAATAAAAAAAATTCATTTAATAAAATATTTAATT
AAAATATAAAACAAAGTTAACATTTATTAATTAATGTAGATTAGTTAAAA
AGAAAGTCGAAAACAAAAACAAATTTGTTTTAGTAAAACTGACAATTGAA
AAACAACCGTTGATTAGATGATTATTTTGTCAATAAATGCCAGTCGAATT
TATTTTACAGATAAGAACTGAAAAAAATGTGATACGATCAAAGGAATCAT
AAAGAATTCCTCAGTCTGACCTTCGAATCCACATTTACACAGGTCTAGCT
CATTGAACGCTCTTTCTAATAAGAAAACAATATACTTGCAAAATGAAAAG
CGGCTAAATAACTAATATAGTATACTTTACCCATGTGTTATGCATGAAAT
AAAATGTTCACTGAAAGCAGCTTTAGAACGTTACATCAAAGAATTTCAGA
GCATTTAGATCTTGTCGGTAAATTTTCAGTCAACAAATATCCCCAACAAA
TATGCACTAATTTGAAAATCTGAAAATAAAGGATCAATATTTATCTGAAA
CAAAAATCCTGATTATGAAACAAATGAAATTCCCAATTTGAAAATGTTTC
GACATTTTATAAAACTTTAAATAATAATTTTATAAAAAATATTTTGAAAA
TATATATATTTCTAAAAAAGGCAAACATAAAAAATTAAAATTTTATTTTC
AAAATCTTTTTGAATTTATTTTGAGGGCCAC
back to top

protein sequence of SMED30017309-orf-1

>SMED30017309-orf-1 ID=SMED30017309-orf-1|Name=SMED30017309-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=674bp
MNVSLKNFPNTINKTKNSKPITGVKPVQFKESHSKSRVRRSSDYSYNYKI
DSFKRRTFSLEDKANIMTTSIYFTESEIKSPNLIFSSDKSDVIPEKETFE
IGPNSSTRESTPLQTIPSNDSLDNLKSSTFSRSSELENEFSSNDKLDDSV
ETPVKNDNSESSKKSESNSKIKLNYSKAGSNSSGVLNKEKSEKPISEKKI
HDPKVVIEEMRRYYENEIYVLKKQLQQVGYSIMPNEDALQKRCHLLESQL
RKSQNEAESLAEQVSGLKTQLQTWPNRVTELEEDNESLRGRIEDVRVINQ
QRQNEIDELHEIVKNLETKLWESSTGNQQQEKIFLQRLMQEYDHLLKDYD
LMKLNYMSNERKLYESRALSNDLSNKVTDLESKIRKVESENHFLKRRLGN
EKSFVNSNYRGWARSTYPPTLAGFEPEVSPRNGSSQEFLSYSQVEPQPQF
DMGMMSMSCYGALPSYSNSSDTREQISENMRRFEPLKTKIVDRYNQGKMN
SSMYVQPTEDLNEVITPTSERRRVAIKDDSQYPKKQFKIESASFDMLNEV
EDILVNQQMTTSISDFRQGEIKQSIGRRKKPEYYNRDSWASSRVDEDVEL
ERRYDQLQNEKKQLLTKLSHIPSNSSGRNRRSNREQRESLEAQLDQIDRQ
LGLMRMTLKQKNILNMATTNAVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR026636MPHOSPH9
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005814centriole
GO:0005856cytoskeleton
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 370..397
NoneNo IPR availableCOILSCoilCoilcoord: 335..355
NoneNo IPR availableCOILSCoilCoilcoord: 597..617
NoneNo IPR availableCOILSCoilCoilcoord: 630..650
NoneNo IPR availableCOILSCoilCoilcoord: 236..270
NoneNo IPR availableCOILSCoilCoilcoord: 278..319
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 614..629
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 98..174
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..167
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 614..639
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 100..137
IPR026636M-phase phosphoprotein 9PANTHERPTHR14926M-PHASE PHOSPHOPROTEIN 9coord: 121..407
coord: 578..659