Cyclic nucleotide gated channel alpha 3

Overview
NameCyclic nucleotide gated channel alpha 3
Smed IDSMED30017295
Length (bp)2183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic nucleotide gated channel alpha 3 (SMED30017295) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel alpha 3 (SMED30017295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic nucleotide gated channel alpha 3 (SMED30017295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel alpha 3 (SMED30017295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017295SMESG000013398.1 Contig6889newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017295SMESG000013398.1 Contig6889uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30017295SMESG000013398.1 SmedASXL_015385SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30017295SMESG000013398.1 SmedASXL_001922SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017295SMESG000013398.1 dd_Smed_v4_18944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017295SMESG000013398.1 dd_Smed_v6_23493_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30017295SMESG000013398.1 dd_Smed_v6_18944_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 270/529 (51.04%), Postives = 377/529 (71.27%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            +VVD SSNLYY W+  + + + +N  LL  RA F   Q +Y  +W + DY  D++ ++D+ + +RTGFLE GLMV+D  ++ ++Y +   FKLD   ++P +L  L       +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          ++S+ +   + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIGKEMYI+  GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E PEAK  L E+G++ILMKDNL+D E  +    +P  ++  ++++  ++   + +++ L+ ++   Q  MK +L  L++ + G 
Sbjct:  141 IVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYL---KVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP----------NISIPE-HGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELARAGA-DPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGG 654          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 270/529 (51.04%), Postives = 377/529 (71.27%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            +VVD SSNLYY W+  + + + +N  LL  RA F   Q +Y  +W + DY  D++ ++D+ + +RTGFLE GLMV+D  ++ ++Y +   FKLD   ++P +L  L       +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          ++S+ +   + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIGKEMYI+  GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E PEAK  L E+G++ILMKDNL+D E  +    +P  ++  ++++  ++   + +++ L+ ++   Q  MK +L  L++ + G 
Sbjct:  159 IVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYL---KVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP----------NISIPE-HGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELARAGA-DPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGG 672          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 265/527 (50.28%), Postives = 379/527 (71.92%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W I DY+ DIV +ID+F+ +RTG+LE GL+V +  K++  Y S L FKLD   ++P +L          +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C F+ +S +IG G+D +VYP             ++ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+GK+ILMKD LLDL    N+ ++P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  225 VVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYF---KLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYP------------DINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNI-ANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFL 735          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 265/527 (50.28%), Postives = 379/527 (71.92%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W I DY+ DIV +ID+F+ +RTG+LE GL+V +  K++  Y S L FKLD   ++P +L          +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C F+ +S +IG G+D +VYP             ++ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+GK+ILMKD LLDL    N+ ++P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  225 VVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYF---KLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYP------------DINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNI-ANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFL 735          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 265/527 (50.28%), Postives = 379/527 (71.92%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W I DY+ DIV +ID+F+ +RTG+LE GL+V +  K++  Y S L FKLD   ++P +L          +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C F+ +S +IG G+D +VYP             ++ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+GK+ILMKD LLDL    N+ ++P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  156 VVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYF---KLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYP------------DINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNI-ANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFL 666          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-4 (Cyclic nucleotide-gated cation channel [Source:UniProtKB/Swiss-Prot;Acc:Q03611])

HSP 1 Score: 490.73 bits (1262), Expect = 4.972e-164
Identity = 246/480 (51.25%), Postives = 347/480 (72.29%), Query Frame = 2
Query:  548 YRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWY---RFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSEL-VQDFEVEQEIMK 1975
            +R +W  FD L+D V +ID F+  R G+++ GL+V + EK+ K Y     +++D   ++PL+ + L  P   I++      R NRL +  ++   ++RT+TR++ PN FR+  ++ +++I+IHWN C +F++S  IGLG+D +VY    +  + +L   ++   D     Y+YSF+WSTL LTT+ EVP PV N E+  +TL+L+ GVLIFATI+GNVGSMISNM+AA+T+FQ K+DG+K+YME R V K+LE R+I WFDYLW NKQSL +  +L  LPDKL+AEIA+QVH+ETL+ V+IFQDCE  LL +L+LKL++QVFSPGD+IC+KGDIG+EMYIVKRG+L VV DDG KVFVTL+EGSVFGELSILNI GSK+GNRRTANV+SVGY+DLF L+K DLW+ L E P+A+  L+ +G+EIL KDNLLD    +N+     T++ I + +N  + + + + + L V+    E ++MK
Sbjct:  200 FRMLWVFFDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKVTKAYWQSKQYRIDGISLIPLD-YILGWPIPYINWRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIIIHWNACLYFWISEWIGLGTDAWVY---GHLNKQSLPDDIT---DTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGVLIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIAMQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGSVFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLD----ENAPEEQKTVEEIAEHLNNAVKVLQTRMARLIVEHSSTEGKLMK 668          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-1 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:A8WI01])

HSP 1 Score: 347.436 bits (890), Expect = 1.267e-109
Identity = 197/527 (37.38%), Postives = 298/527 (56.55%), Query Frame = 2
Query:  434 VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFI--FDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVS-----NSIGLGSDGFVYPPRSNNTEATLSVSVSQPWD-----------------QFST---------------------MYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQS-LDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLD---LEANKNSVNNP 1867
            VD  SN +Y W G +++  L  ++      A  + Q  + ++      + L+D+VNI+DL   +R  ++E G+ V +  K++ + +    F LD   ++P E   +   S    + W R NRLTK Y+LF+F  +TDTRT  P+ F +  LI   +++ HWNGC +F++S      +  L    F Y    N   AT    +    D                 QF+                       Y  SF+WS LTL T+ E P P    +      + L G++IFA I+G+VG+M+  +N  K++F+  +DG KR+M +R V   L ++ + +F Y+W +  + +DE+ I   LP +L  EIAV++H +TLK VK+F+ C+  LL +LILKL+++V+SP DYIC+KGD+G EMYIVK G + VV++DG  +FVTL  G VFGELSILNIPG+K+ N RTA+V+S GYSDL+ L+K+DLW+ L E P+AK  LI++G +IL KD ++D   ++    S N P
Sbjct:   73 VDEHSNTFYLWTGLVSLVALHPLVF----TALSVFQDVHPFLRNTGPLNLLLDLVNILDLIAHTRIEYVENGVAVKNLSKLMHHRLKSTFFILDVIAVVPAESLHIFGDS----FFWSRINRLTKCYRLFDFSTQTDTRTTSPHAFGLFKLIFICVVIFHWNGCLYFYISKVYNYTTARLEHWIFSYDKIINPILATCVTDIPNHRDFCDTDDLLITHLPENEVQFTVTDYMTTWENKTTTIKFANFFRQYALSFYWSALTLVTLGEQPSPCTTFQNAFEIGDTLLGLVIFAVIVGDVGNMVVAINLRKSEFENVLDGCKRFMVYRKVPNLLRKKAVEYFAYVWAHGGAQVDEEEIAEFLPPRLFGEIAVEIHMDTLKKVKLFESCDPRLLYELILKLQLRVYSPMDYICKKGDVGTEMYIVKEGFVEVVSEDGQTIFVTLPAGFVFGELSILNIPGNKNKNLRTASVRSKGYSDLYVLDKEDLWEALHEYPQAKDSLIQKGIQILEKDKMIDPNMVDDEDESFNGP 591          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-2 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:Q9N4C1])

HSP 1 Score: 304.294 bits (778), Expect = 1.007e-91
Identity = 191/606 (31.52%), Postives = 311/606 (51.32%), Query Frame = 2
Query:  383 QNKTFFTKIN---------LWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRY--MWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSD-----GF----VYPPRSNNTEA-------------TLSVSVSQP---------WDQ---------FSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLL------DLEANKNSVNNPH-----TIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            Q +T FT+I          L+Y +V    +S  +Y W   +++ IL+N+  + +   F      + Y   W   +   D   ++D  +GSR  F+  G  V+  +KM KNY      KLD   + P + +  I    ++     R  RL K Y+L+EFI  T  RT+FP+  +I  L     I+ HWN C +F  S   GL  D     GF    V+ PR +  +A              L +   +P         WD+         FS  Y  + +WS+LT+T   + P P  +S+  +   + L GVL+FATIIG VGS+++ M+    DF+  +DG+K YM++RGV   ++ R++N F YL  + Q  DE+ ILS LP   +A IA  +H +TL  V +F  C++ LL ++++ ++ QV+SP DY+CRK +  KEM+IVK+G L V+ DD      +LKEG  FGELSI+ + G+  G+RR+ +++SVGYSD++ L++DD+  +L E PE + RL+E  + +L    LL      ++    + +++       ++D  L R+   +   +   + ++  F       K ++  L+N+ N +
Sbjct:  200 QRQTGFTQIKDILTDKCRKLYYFYVT--ENSTFFYYWTAIISIGILYNMFAMVI---FIFDDVHFGYFNQWLYVNLFFDFCFLLDCLVGSRMTFVSEGNEVSQTDKMFKNYRQSRRCKLDLLCLAPADFYLFIDTKASL----VRAIRLVKAYRLYEFIMLTQRRTDFPHFMKILFLTSSCAILFHWNACVYFLFSLYQGLTEDDPNAFGFSYYKVFDPRFSICDALYDQDCYYPEDTEVLDIRDERPHYMEDMYKFWDKKFNILQIGNFSREYSMTIYWSSLTITKCGQQPWPSKSSQNSLEIFDTLIGVLVFATIIGGVGSVVTQMSQNVNDFREMMDGIKFYMKYRGVQSAIQDRVLNCFLYLNSHNQLYDEEEILSLLPPFFQARIAANLHQDTLSKVSLFYKCDQRLLQEVVMLVKQQVYSPNDYLCRKNEKAKEMFIVKKGLLAVIDDDTGVELDSLKEGHTFGELSIVQVKGNILGDRRSVSLRSVGYSDVYVLHQDDVTRLLQEYPEERVRLMENARRMLHSRGLLETNELGEMCETDDGLDDEAMLEFLSVDEQLNRLENIIDSIDTDLANMITSFSYNSVAYKKRVTALENIFNSN 796          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-2 (TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2])

HSP 1 Score: 280.411 bits (716), Expect = 6.181e-83
Identity = 171/520 (32.88%), Postives = 270/520 (51.92%), Query Frame = 2
Query:  455 YYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIID-LFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVV-ADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVN---------NPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSK 1981
            Y  W+  +T+  LFN   +P+R+++     D    WFI DY  D+V +ID L I  R  F   G+ V   +   ++Y+   +FKLD   ILP +L         I    +R NR+ KI   +   D  D     P   RI+  + +++ +IH N C ++ +S     G   ++      N +  L+  V   ++     YI  F+++    T+    P P    E+I MT   + GV +FA ++G +  ++SN N  + +FQ K+D      +  G+  E   R+ +WF Y W  +++LDE  ++  LP KL+ ++A+ VHY TL  V++FQDC+  LL  L+LKLR  +F PGD IC KGD+GKEMYI+ +G L VV  D   K+F  L +G+VFGE+S+L I G+   NRRTA++++ GY  LF L K+DL DV+   P+A++ L  +   +L  D   D +  K             NP  +  ++  I     + ENK  + ++   +E+E  KS+
Sbjct:  221 YMTWLSLVTLCFLFNAFCIPLRSSYPYQTADNWMYWFIVDYSCDLVYVIDMLLIKPRLRFTRGGIQVKIYKDTQRHYLMTRTFKLDILSILPTDLMYFFFGKMPI----WRINRVLKINSFWLLFDMLDNSFANPYAIRIARTLSYMIYIIHCNSCVYYKLSALQAFGQIAYL-----ENGKWYLNKWV---YNNQGNAYIRCFYFTAAVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLALGECKKLGLKMETTNRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKVQLFQDCDRALLRDLVLKLRPVIFLPGDMICLKGDVGKEMYIINQGILQVVGGDHNEKIFAELAQGAVFGEISLLAIGGN---NRRTASIRAKGYCTLFVLAKEDLNDVIRYYPQAQTILRRKAAAMLKNDKKSDEKTEKIKAQAELEDRCKINPRQVPKLITLIANMTEMNENKGVQELKKV-IEEETEKSR 724          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: che-6 (pep chromosome:WBcel235:IV:2104056:2111408:-1 gene:WBGene00000487.1 transcript:C23H5.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:che-6)

HSP 1 Score: 271.937 bits (694), Expect = 3.949e-81
Identity = 166/506 (32.81%), Postives = 273/506 (53.95%), Query Frame = 2
Query:  443 SSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYI-SKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSD-----GF----VYPPRSNNTEA--------------TLSV---------SVSQPWD---------QFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLD 1834
            +S  YY W   ++  +++N+  + +   F   +  Y + W   + + D+V I+D+F+ SR  +L  G  V + +K+ KNY   KL    D   +LPL+       S ++     R  R+ K+ +L +F+ RT  +T FP  F+I  L V  +++ HWN C +F  S   G+  +     GF    V+ P     +A              TL +          +++ W           FS  Y  S +WS LT+TT  + P P  +S+  +   + L GVL+FATIIG+VGS+++ M+    +F+  +DG+K YM++R V   ++ R ++ F YL  + Q  DE+ ILS LP +L+A IA  +H ETL+ ++IF  CE   + +++L ++ QVFSP DY+CRK +  KE++IVK+GKL V+ DD  +    L EG+ FGELSI+ + G+  G RR  +++SVG+SD++ L +DD+  +L E P+    ++   + +L    LL+
Sbjct:   64 NSKYYYIWSFFVSFGVMYNMFAMVI-FIFADIKTQYFWNWIFLNVMFDMVFIVDIFVQSRLTYLHEGEEVKNTKKLRKNYFFQKLKVANDIFCLLPLDFLLFFDDSMSL----VRTIRIVKVIRLMDFVQRTQQQTTFPRAFKIILLAVSCIVLFHWNACLYFLFSLYEGITEESQTEFGFSYYKVFEPVFPTCQAYYDENCWFGEDIDHTLDLDDVRDSYKKEMAEYWKDKHYRWTTGNFSREYSMSIYWSALTITTCGQQPWPSTSSQNSLEVFDTLIGVLVFATIIGSVGSVVTQMSQTVNEFRQMMDGIKFYMKYREVNSAIQERALSCFMYLMAHNQLDDEEGILSLLPPRLQANIAANLHMETLQNIQIFALCESRFMHEVVLLVKQQVFSPNDYLCRKNEKAKELFIVKKGKLRVIDDDTGEEMGELTEGATFGELSIVYVKGNLLGTRRCCSLQSVGFSDIYVLYRDDVSRLLQEFPQEYKTIVMNARNLLHSRGLLE 564          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302924)

HSP 1 Score: 495.738 bits (1275), Expect = 9.936e-167
Identity = 242/533 (45.40%), Postives = 349/533 (65.48%), Query Frame = 2
Query:  434 VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWY------RFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            VD +   +Y W+  +++ +L+N+I +  RA F+   K     W+  DYL D + ++D  +    GFL+ GL+V D  ++ ++Y     + LD   +LP +L  +  P +    ++       R NRL +I +L+E+ DRT+T T +PN FRI  +++ +L++IHWN C +F +S  IG  SD +VY     N   T + ++ +        YIYSF+WSTLTLTT+ E P P  + E++ +  + L GVLIFATI+GN+GSMISNMN A+ +FQ ++DGVK+YM FR VG ELE R+I WF Y W    +LDE+ +L+ LPDKLKAEIA+QVH +TLK V+IF D E  LL  L+LKL++QVFSPGDYICRKGD+GKEMYIVKRGKL+VV DDGI V  TL  GSVFGE+S+L I G+++GNRRTANV+S+GYSDLFCL K DLW+ L + PEA+S L +RG ++L KD LLD +   +S     +I+  ++++  ++     + + L+ ++   Q  +K +L  L+  +NG 
Sbjct:  100 VDPTLQSHYRWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVY-----NLNGTRNNTLQR-------QYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE--MNGG 618          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302925)

HSP 1 Score: 496.123 bits (1276), Expect = 1.503e-164
Identity = 242/533 (45.40%), Postives = 349/533 (65.48%), Query Frame = 2
Query:  434 VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWY------RFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            VD +   +Y W+  +++ +L+N+I +  RA F+   K     W+  DYL D + ++D  +    GFL+ GL+V D  ++ ++Y     + LD   +LP +L  +  P +    ++       R NRL +I +L+E+ DRT+T T +PN FRI  +++ +L++IHWN C +F +S  IG  SD +VY     N   T + ++ +        YIYSF+WSTLTLTT+ E P P  + E++ +  + L GVLIFATI+GN+GSMISNMN A+ +FQ ++DGVK+YM FR VG ELE R+I WF Y W    +LDE+ +L+ LPDKLKAEIA+QVH +TLK V+IF D E  LL  L+LKL++QVFSPGDYICRKGD+GKEMYIVKRGKL+VV DDGI V  TL  GSVFGE+S+L I G+++GNRRTANV+S+GYSDLFCL K DLW+ L + PEA+S L +RG ++L KD LLD +   +S     +I+  ++++  ++     + + L+ ++   Q  +K +L  L+  +NG 
Sbjct:  275 VDPTLQSHYRWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVY-----NLNGTRNNTLQR-------QYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE--MNGG 793          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299573)

HSP 1 Score: 407.912 bits (1047), Expect = 3.199e-129
Identity = 202/455 (44.40%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  425 HVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRL 1789
            H V D +  L Y W   +++  L+N  ++  R AF    +    +WF  DYL D + +ID+    RTG+LE G++ TD  K+  +Y++   F +D   +LPL+   L   S   + +   F RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL++ HWNGC +  +  + G GS  +VY    +++E+   V            Y+ S++W TL LTT+ ++P P    E++ + L+LL G+++FAT++G+V +++++++AA+ +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DE+  +S LPDKLKAEIA+ VH +TLK V+IFQ+ E   L +L+L+LR  +FSPGDYICRKG++GKEMYIV RG+L VVAD+G  V  +LK GS FGE+SILN+    +GNRRTA+V+SVGYSDLF L+K D+WDVL E P A+ RL
Sbjct:  295 HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL---SIGFNSILRSF-RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY----HDSESADVVK----------QYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 729          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0330241)

HSP 1 Score: 408.297 bits (1048), Expect = 5.993e-127
Identity = 203/457 (44.42%), Postives = 301/457 (65.86%), Query Frame = 2
Query:  425 HVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNI--PGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRL 1789
            H V D +  L Y W   +++  L+N  ++  R AF    +    +WF  DYL D + +ID+    RTG+LE G++ TD  K+  +Y++   F +D   +LPL+   L   S   + +   F RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL++ HWNGC +  +  + G GS  +VY    +++E+   V            Y+ S++W TL LTT+ ++P P    E++ + L+LL G+++FAT++G+V +++++++AA+ +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DE+  +S LPDKLKAEIA+ VH +TLK V+IFQ+ E   L +L+L+LR  +FSPGDYICRKG++GKEMYIV RG+L VVAD+G  V  +LK GS FGE+SILN+   G + GNRRTA+V+SVGYSDLF L+K D+WDVL E P A+ RL
Sbjct:  570 HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL---SIGFNSILRSF-RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY----HDSESADVVK----------QYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGKELGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1008          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0474145)

HSP 1 Score: 408.297 bits (1048), Expect = 8.462e-127
Identity = 202/455 (44.40%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  425 HVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRL 1789
            H V D +  L Y W   +++  L+N  ++  R AF    +    +WF  DYL D + +ID+    RTG+LE G++ TD  K+  +Y++   F +D   +LPL+   L   S   + +   F RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL++ HWNGC +  +  + G GS  +VY    +++E+   V            Y+ S++W TL LTT+ ++P P    E++ + L+LL G+++FAT++G+V +++++++AA+ +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DE+  +S LPDKLKAEIA+ VH +TLK V+IFQ+ E   L +L+L+LR  +FSPGDYICRKG++GKEMYIV RG+L VVAD+G  V  +LK GS FGE+SILN+    +GNRRTA+V+SVGYSDLF L+K D+WDVL E P A+ RL
Sbjct:  570 HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL---SIGFNSILRSF-RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY----HDSESADVVK----------QYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1004          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 266/523 (50.86%), Postives = 369/523 (70.55%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            VVD + N+YYNW+  +T  +++N I +  RA F   Q DY  +WF  DYL D V ++D+   +RTG+LE GL+V D++K+   Y   L F+LD   ++P ++F L      ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++I+IHWN C ++  S +IG GSD FVYP  S+             + +    Y YS +WSTLTLTT+ E P PV NSE+  +  + L GVLIFATI+GNVGSMI+N NAA+ DFQ +ID +K+YM FR V K+LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GS++GNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKDNLLDLE  K    +P  ++  +++I   +   + +++ L+ + E  Q  +K ++  L+ 
Sbjct:  113 VVDPAGNMYYNWLFVITCPVMYNWIFIIARACFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYLYF---GMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPE-----------FGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEK 620          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 265/522 (50.77%), Postives = 369/522 (70.69%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            VVD + N+YYNW+  +T  +++N I +  R+ F   Q DY  +WF  DYL D V ++D+   +RTG+LE GL+V D++K+   Y   L F+LD   ++P ++F L      ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++I+IHWN C ++  S +IG GSD FVYP  S+             + +    Y YS +WSTLTLTT+ E P PV NSE+  +  + L GVLIFATI+GNVGSMI+N NAA+ DFQ +ID +K+YM FR V K+LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GS++GNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKDNLLDLE  K    +P  ++  +++I   +   + +++ L+ + E  Q  +K ++  L+
Sbjct:  119 VVDPAGNMYYNWLFVITCPVMYNWIFIIARSCFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYLYF---GMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPE-----------FGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLE 625          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 264/524 (50.38%), Postives = 371/524 (70.80%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            ++D +S+ YY W+  +   + +N+++L  RA F   Q  Y  +W + DY  D++  +D F+ SRTGFLE GL+V D +K++ NY +   FK D   ++P +LF L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L++IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L E+GK IL KDNLLD EA   +  +P  ++  + R+  N+ +   K+++L+ ++   Q  +K ++ +++N
Sbjct:  173 IMDPASDKYYRWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMEN 680          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 264/524 (50.38%), Postives = 371/524 (70.80%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            ++D +S+ YY W+  +   + +N+++L  RA F   Q  Y  +W + DY  D++  +D F+ SRTGFLE GL+V D +K++ NY +   FK D   ++P +LF L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L++IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L E+GK IL KDNLLD EA   +  +P  ++  + R+  N+ +   K+++L+ ++   Q  +K ++ +++N
Sbjct:  179 IMDPASDKYYRWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMEN 686          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 264/524 (50.38%), Postives = 371/524 (70.80%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            ++D +S+ YY W+  +   + +N+++L  RA F   Q  Y  +W + DY  D++  +D F+ SRTGFLE GL+V D +K++ NY +   FK D   ++P +LF L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L++IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L E+GK IL KDNLLD EA   +  +P  ++  + R+  N+ +   K+++L+ ++   Q  +K ++ +++N
Sbjct:  174 IMDPASDKYYRWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMEN 681          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 274/524 (52.29%), Postives = 374/524 (71.37%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD L+D EA K    +P  ++  ++++   M   + +++ L+ D+   Q  +K ++  L++
Sbjct:  200 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAKAGA-DPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLES 707          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 274/524 (52.29%), Postives = 374/524 (71.37%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD L+D EA K    +P  ++  ++++   M   + +++ L+ D+   Q  +K ++  L++
Sbjct:  133 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAKAGA-DPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLES 640          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 274/524 (52.29%), Postives = 374/524 (71.37%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD L+D EA K    +P  ++  ++++   M   + +++ L+ D+   Q  +K ++  L++
Sbjct:   50 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAKAGA-DPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLES 557          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 274/524 (52.29%), Postives = 374/524 (71.37%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD L+D EA K    +P  ++  ++++   M   + +++ L+ D+   Q  +K ++  L++
Sbjct:   80 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAKAGA-DPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLES 587          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: amacr (alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:XB-GENE-1009589])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 265/527 (50.28%), Postives = 376/527 (71.35%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLN 2008
            V+D S NLYYNW+  +T+ +++N  ++  RA F   Q+DY  +WF  DY+ D + I D+F+ +RTG+LE GL+V D  K+   Y   + FKLD   I+P ++  L      ++Y   R N+L ++ ++FEF  RT+TRTN+PNIFRIS+LI++++I+IHWN C ++ +S +IG G D +VYP            + S P + + +  Y+YS +WSTLTLTT+ E P PV +SEF  +  + L GVLIFATI+GNVGSMISNMNAA+ +FQ +ID +K+YM FR V K+LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LL++L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD LLDL+   NS  +P  I+  + ++   +   + K++ L+ +++  Q+ +K ++  ++ ++ 
Sbjct:   11 VIDPSGNLYYNWLFCITMPVMYNWTMIIARACFDELQQDYLELWFFLDYMSDAIYIADMFVRTRTGYLEQGLLVRDEVKLRDKYKMTMQFKLDVLSIIPTDILYL---QFGLNYPELRLNKLLRVARMFEFFQRTETRTNYPNIFRISNLIMYIVIIIHWNACVYYSISKAIGFGEDTWVYP------------NTSHPEYGRLARKYVYSLYWSTLTLTTIGETPPPVQDSEFWFVVADFLVGVLIFATIVGNVGSMISNMNAARAEFQGRIDAIKQYMHFRKVSKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLIELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDGLLDLDI-ANSGADPKDIEEKVIQMEGLVENLQTKFARLLAEYDSAQQKLKQRVTKIEKIIK 521          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 267/530 (50.38%), Postives = 376/530 (70.94%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLN 2008
            + +VVD SSN+YY W+  + + + +N  LL  RA F   Q ++  +W + DY  D++ ++D+ + +RTGFLE GLMV D +++ K+Y   L FKLD   ++P +L  L      ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LI+IHWN C +F +S  IG G+D +VYP            + S+P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L G+LIFATI+GNVGSMISNMNA + +FQ KID VK+YM+FR V K+LE R+I WFDYLW N++++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E P+AK  L E+G++ILMKDNL+D +     V+    ++  ++ +  ++ + + +++ L+ ++   Q  +K +L  L++ +N
Sbjct:  136 EPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYL---KLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYP------------NTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLIDEDLVAARVDT-RDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQMN 649          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 267/528 (50.57%), Postives = 383/528 (72.54%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLE-ANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W IFDY+ D+V + D+F+ +RTG+LE GL+V DR K+++ Y + L FKLD   ++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP             V+ P + + +  Y+YS +WSTLTLTT+ E P PV +SE+I + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ ++D +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD LLD+  AN  S  +P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  148 VVIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYI---KFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYP------------DVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIANMGS--DPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFL 658          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 267/528 (50.57%), Postives = 383/528 (72.54%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLE-ANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W IFDY+ D+V + D+F+ +RTG+LE GL+V DR K+++ Y + L FKLD   ++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP             V+ P + + +  Y+YS +WSTLTLTT+ E P PV +SE+I + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ ++D +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD LLD+  AN  S  +P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  148 VVIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYI---KFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYP------------DVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIANMGS--DPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFL 658          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 267/528 (50.57%), Postives = 383/528 (72.54%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLE-ANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W IFDY+ D+V + D+F+ +RTG+LE GL+V DR K+++ Y + L FKLD   ++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP             V+ P + + +  Y+YS +WSTLTLTT+ E P PV +SE+I + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ ++D +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+G++ILMKD LLD+  AN  S  +P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  148 VVIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYI---KFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYP------------DVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIANMGS--DPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFL 658          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 267/530 (50.38%), Postives = 376/530 (70.94%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLN 2008
            + +VVD SSN+YY W+  + + + +N  LL  RA F   Q ++  +W + DY  D++ ++D+ + +RTGFLE GLMV D +++ K+Y   L FKLD   ++P +L  L      ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LI+IHWN C +F +S  IG G+D +VYP            + S+P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L G+LIFATI+GNVGSMISNMNA + +FQ KID VK+YM+FR V K+LE R+I WFDYLW N++++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E P+AK  L E+G++ILMKDNL+D +     V+    ++  ++ +  ++ + + +++ L+ ++   Q  +K +L  L++ +N
Sbjct:   98 EPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYL---KLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYP------------NTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLIDEDLVAARVDT-RDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQMN 611          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90980|CNG3_CHICK (Cyclic nucleotide-gated channel rod photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 267/525 (50.86%), Postives = 381/525 (72.57%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            ++D + N+YYNW+  +T+ +++N  ++  RA F   Q DY  +WFI DY+ D++ I D+F+ +RTG+LE GL+V + +K+ + Y S L FKLDF  I+P +L         ++Y   R NRL ++ ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP  S+   A L+             Y+YS +WSTLTLTT+ E P PV +SE+  + ++ L GVLIFATI+GNVGSMISNMNAA+ +FQ KID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH ETLK V+IF DCE  LLV+L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L E P+AK+ L E+GK+ILMKD LLD+E   N  ++P  ++  +  +  +M   + K++ L+ +++  Q+ +K +L  ++ +L
Sbjct:  109 IIDPAGNMYYNWLFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGLLVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYF---KLGLNYPELRINRLLRVARMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPEFARLT-----------RKYVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARAEFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGKQILMKDGLLDIEV-ANLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEYDAAQQKLKKRLTQIEKIL 618          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q16281|CNGA3_HUMAN (Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens OX=9606 GN=CNGA3 PE=1 SV=2)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 270/529 (51.04%), Postives = 377/529 (71.27%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            +VVD SSNLYY W+  + + + +N  LL  RA F   Q +Y  +W + DY  D++ ++D+ + +RTGFLE GLMV+D  ++ ++Y +   FKLD   ++P +L  L       +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          ++S+ +   + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIGKEMYI+  GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E PEAK  L E+G++ILMKDNL+D E  +    +P  ++  ++++  ++   + +++ L+ ++   Q  MK +L  L++ + G 
Sbjct:  159 IVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYL---KVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP----------NISIPE-HGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELARAGA-DPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGG 672          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q29441|CNGA3_BOVIN (Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus OX=9913 GN=CNGA3 PE=2 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 274/527 (51.99%), Postives = 377/527 (71.54%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLEL--FSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            VV+D SSN+YY+W+  + V + +N  LL  RA F   Q ++  +W + DY  DI+  +D+ + +RTGFLE GLMV D  ++ K+Y   L FKLD   ++P +L  F L      ++Y   RFNRL K+ +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP            +VS P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TL+ V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E PEAK  L E+G++ILMKDNL+D E  K    +P  I+  ++ +  ++   + +++ L+ ++   Q  +K +L  L++
Sbjct:  178 VVMDPSSNMYYHWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVRARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKL-----GMNYPELRFNRLLKLARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP------------NVSNPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYIIKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAKAGA-DPKDIEEKVEHLETSLDSLQTRFARLLAEYNATQMKVKQRLSQLES 686          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q28279|CNGA1_CANLF (cGMP-gated cation channel alpha-1 OS=Canis lupus familiaris OX=9615 GN=CNGA1 PE=2 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 267/527 (50.66%), Postives = 384/527 (72.87%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            +V+D + N+YYNW+  +T+ +++N  ++  RA F   Q DY   W IFDYL DIV ++D+F+ +RTG+LE GL+V +  K+++ Y S L FKLDF  ++P +L          +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C +F +S +IG G+D +VYP             V+ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L E P+AK+ L E+GK+ILMKD LLD+    N+ ++P  ++  + R+  ++ L + +++ ++ ++E  Q+ +K +L  ++  L
Sbjct:  155 MVIDPAGNMYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWIIFDYLSDIVYLLDMFVRTRTGYLEQGLLVREEAKLIEKYKSNLQFKLDFLSVIPTDLLYF---KLGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYFSISKAIGFGNDTWVYP------------DVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDINI-ANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVERFL 665          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90805|CNG1_CHICK (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 270/518 (52.12%), Postives = 370/518 (71.43%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKL 1984
            V+D SSN+YYNW+  +   + +N  +L  RA F   Q D+  +W   DY  DI+ + D+F+  RTGFLE GL+V D +K+  +Y   + FKLD   +LP +L  L      ++Y   RFNRL +I +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          +VS+ + + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ K+D +K+YM FR V K+LE R+I WFDYLW NK+++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L E PEAK  L E+G++ILMKDNL+D EA K    +P  ++  + R+   +   + +++ L+ ++   Q+ +K +L
Sbjct:  202 VIDPSSNMYYNWLTIIAAPVFYNWCMLICRACFDELQIDHIKLWLFLDYCSDIIYVFDMFVRFRTGFLEQGLLVKDEKKLRDHYTQTVQFKLDVLSLLPTDLAYL---KLGLNYPELRFNRLLRIARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKVIGFGTDSWVYP----------NVSIPE-YGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKVDSIKQYMHFRKVTKDLEARVIKWFDYLWTNKKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLKPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEEAAKAGA-DPKDLEEKIDRLETALDTLQTRFARLLAEYSSSQQKVKQRL 704          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A3P7XJ78 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS4000 PE=4 SV=1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 296/526 (56.27%), Postives = 398/526 (75.67%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            + +V+DSS + YY WIG +T+T+L+N I+LP+R+AF    +    +W + DY ID V  +D+F+G RTG+LE GL+V D+EK+ + YI +  F +D   ILP +LF  I P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS++  +    + ++ WD+  + Y+YSF+WSTL LTT+ E P PV N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ K+DGVKRYMEFR V KELE R+I WFDYLW NKQSL+ED+ L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L E PE K+ L++RG++IL KDNLLD +  + +     +I+  ++RI+  ++    + + L+ +F   Q  +K +L  L+ 
Sbjct:   98 KDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDS-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQ 621          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A183LJM5 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 296/526 (56.27%), Postives = 398/526 (75.67%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            + +V+DSS + YY WIG +T+T+L+N I+LP+R+AF    +    +W + DY ID V  +D+F+G RTG+LE GL+V D+EK+ + YI +  F +D   ILP +LF  I P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS++  +    + ++ WD+  + Y+YSF+WSTL LTT+ E P PV N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ K+DGVKRYMEFR V KELE R+I WFDYLW NKQSL+ED+ L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L E PE K+ L++RG++IL KDNLLD +  + +     +I+  ++RI+  ++    + + L+ +F   Q  +K +L  L+ 
Sbjct:   98 KDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDS-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQ 621          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A504Z0W2 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_00261 PE=4 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 296/527 (56.17%), Postives = 392/527 (74.38%), Query Frame = 2
Query:  416 WYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            W   +VVDSS + YY WIG ++ T+L+N I+LP+R+AF    +    MW  FDYLID +  ID+F+G RTGFLE GL+V D  ++ K Y+ +     D   + P +L  LI PS      W RFNRL K+Y+LFEFIDRT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRSN+  + +  + S  W+   + Y+YSF+WSTL LTT+ E P PV+N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ ++DGVKRYMEFR V KELE R+I WFDYLW NKQSL+EDT L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L E PEAK  L++RG+EIL KDNL+D E  + +     TI+  + R++  ++    + + L+ +F   Q  +K +L  L+
Sbjct:   85 WITTLVVDSSQSAYYYWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSNDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDT-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLE 609          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: G4VGD7 (Putative cyclic-nucleotide-gated cation channel OS=Schistosoma mansoni OX=6183 GN=Smp_194700 PE=4 SV=1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 295/525 (56.19%), Postives = 397/525 (75.62%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            + +V+DSS + YY WIG +T+T+L+N I+LP+R+AF    +     W + DY ID V  +D+F+G RTG+LE GL+V D+EK+ + Y+ +  F +D   ILP +L  LI P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS++  +    + ++ WD+  + Y+YSF+WSTL LTT+ E P PV N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ K+DGVKRYMEFR V KELE R+I WFDYLW NKQSL+ED+ L+ LPDKLKAEIA+ VH++TL+ V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L E PE K+ L++RG++IL KDNLLD +  + +     +I+  ++RI+  M+    + + L+ +F   Q  +K +L  L+
Sbjct:   90 KDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPITWMVLDYCIDCVYFMDIFVGFRTGYLEEGLLVRDKEKLKQAYLKRRQFIIDIITILPTDLLYLI-PIFNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRASGLSSDSFVYPPRSSDDTSDEYKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDS-LNALPDKLKAEIAIHVHFDTLQRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDILRKAQEQQESIEQCVQRIDNTMNQLTTRLARLIGEFGASQAKLKRRLTRLE 612          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A4E0RSW7 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola hepatica OX=6192 GN=D915_005543 PE=4 SV=1)

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 295/527 (55.98%), Postives = 391/527 (74.19%), Query Frame = 2
Query:  416 WYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            W   +VVDSS + YY WIG ++ T+L+N I+LP+R+AF    +    MW  FDYLID +  ID+F+G RTGFLE GL+V D  ++ K Y+ +     D   + P +L  LI PS      W RFNRL K+Y+LFEFIDRT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRS +  + +  + S  W+   + Y+YSF+WSTL LTT+ E P PV+N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ ++DGVKRYMEFR V KELE R+I WFDYLW NKQSL+EDT L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L E PEAK  L++RG+EIL KDNL+D E  + +     TI+  + R++  ++    + + L+ +F   Q  +K +L  L+
Sbjct:   85 WITTLVVDSSQSAYYYWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSTDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDT-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIVGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLE 609          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 267/528 (50.57%), Postives = 370/528 (70.08%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGS 2014
            V+D + N YYNW+  +T  +++N +L+  RA F   Q DY   WFI D++ D+V + D+   +RTG+LE GL+V D +K+ + Y+  L FKLD   ++P +L  ++     ++Y   R N+L ++ +LFEF  RT+TRTNFPN+FRIS+L+++++I+IHWN C ++ VS ++G GSD FVYP  SN             + +    Y YS +WSTLTLTT+ E P P  ++EF  +  + L GVLIFATI+GNVGSMI+NMNAA+ DFQ +ID +K+YM FR V  +LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L E PEAKS L E+G++ILMKDNLLDLE  K    +P  ++  + RI   +   + +++ L+   E  Q  +K ++  L+  +  S
Sbjct:   86 VIDPAGNTYYNWLFVITCPVMYNWVLIIARACFEELQHDYLIYWFILDFVSDLVYVADMVFRTRTGYLEQGLLVKDEKKLRERYMVSLQFKLDLISMIPTDLLYVLV---GLNYPEIRMNKLFRVNRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACLYYSVSKAMGFGSDRFVYPDPSNPE-----------FGRLIRKYAYSMYWSTLTLTTIGETPPPEKDAEFFFVVTDFLVGVLIFATIVGNVGSMITNMNAARADFQARIDAIKQYMSFRKVTTDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKSMLEEKGRQILMKDNLLDLEVAKQG-PDPKDMEEKVVRIGSVLEDLQTRFARLLAQHEAVQSRLKRRVTKLETKITVS 598          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 271/581 (46.64%), Postives = 386/581 (66.44%), Query Frame = 2
Query:  287 WICNRFRKKSNRKDE--------KLPVVDSQPDDAEL-IHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            W  +R +++  R D         +L  + S+   A   I   ++    K  +W    ++D +++ YY+W+  +   + +N++++  RA F   Q  Y  +W I DY  D++   D F+ SRTGFLE GL+V D  K++ +Y     FK D   ++P +   L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++LI+IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E PEAK  L E+GK ILMKDNL+D EA  N+  +P  ++  + ++  N+ +   K+  L+ ++   Q  +K +L ++++
Sbjct:   85 WATHRLQREVERPDSFLERFRGPELKDISSRGSYARSSIGHPDRPHKRKKEVW----IMDPATDKYYHWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMES 645          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 261/524 (49.81%), Postives = 366/524 (69.85%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            ++D +++ YY+W+  +   + +N++++  RA F   Q  Y  +W I DY  D++   D F+ SRTGFLE GL+V D  K++ +Y     FK D   ++P +   L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++LI+IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E PEAK  L E+GK ILMKDNL+D EA  N+  +P  ++  + ++  N+ +   K+  L+ ++   Q  +K +L ++++
Sbjct:   64 IMDPATDKYYHWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMES 571          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 259/522 (49.62%), Postives = 363/522 (69.54%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            ++D +S+LYY+W+  ++V   +N+++L  RA F   Q  Y  +W   DY  D++  ID F+ SRTGFLE GL+V DR+K+ +NY     F+ D   ++P ++  L     N +    RFNRL K+ +LFEF DRT+TRTNFPNIFRI +L++++LI+IHWN C FF +S ++G GSD +VYP  S+     L+             YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R++ WFDYLW  +++ DE  +L  LPDKLKAEIA+ VH ETL+ V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E PEAK  L E+G+ ILMKD L+D  A K +  +   ++  +  +  N+ + + K + +  D+   Q  +K ++++++
Sbjct:  128 IMDPASDLYYHWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLA-----------RKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTA--DAKDLEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNME 633          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 259/522 (49.62%), Postives = 363/522 (69.54%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            ++D +S+LYY+W+  ++V   +N+++L  RA F   Q  Y  +W   DY  D++  ID F+ SRTGFLE GL+V DR+K+ +NY     F+ D   ++P ++  L     N +    RFNRL K+ +LFEF DRT+TRTNFPNIFRI +L++++LI+IHWN C FF +S ++G GSD +VYP  S+     L+             YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R++ WFDYLW  +++ DE  +L  LPDKLKAEIA+ VH ETL+ V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E PEAK  L E+G+ ILMKD L+D  A K +  +   ++  +  +  N+ + + K + +  D+   Q  +K ++++++
Sbjct:  179 IMDPASDLYYHWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLA-----------RKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTA--DAKDLEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNME 684          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 252.677 bits (644), Expect = 2.979e-76
Identity = 155/504 (30.75%), Postives = 266/504 (52.78%), Query Frame = 2
Query:  323 KDEKLP--VVDSQPDDAEL----IHFQNKTFFTKINLWYQHVVVDSSSN-LYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFI-GSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSL-ISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAD-DGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGK 1804
            K+E  P   V++  +  E       F+ + +  KI        +D  ++ +Y  W+  + +   ++   LP+R +F +   +    W+I DY  D + ++D+ +   R  F+  G ++TD+++  K Y     FK D   +LPL++  L   PS       +R  RL K Y  FEF DR +   +   I+R+     +LL  +H N CF++FVS+  GLGS  +VY  +                      YI  ++W+  TL T+  +P P    E +        GV + + +IG +G +I    A +  ++  +D    YM    + + ++ R+  W++Y W ++  LDE  +L  LP K++ EIA+ V+Y  +  V +F+ C+  ++  ++L+L+  V+ PGD++C+KG++G+EMYI+K G++ VV   D   VFVTL+ GSVFGE+S+L + G   GNRRTANV + G+++LF L+K DL ++L   PE++  L ++ K
Sbjct:    3 KEETAPQAAVEAATEQHECQMLCCRFKRRPWMDKIKKMKLPETIDPCADRIYLIWLTLVMLAFQWSCWFLPLRLSFPVHTPNTMSFWYIGDYTCDAIYLLDILVMQCRLQFVHRGDIITDQKETSKFYYHSEKFKSDLLSLLPLDILYLKFGPS-----AMFRLPRLIKYYAFFEFNDRLEAIMSKAYIYRVIRTTGYLLFSLHLNACFYYFVSDMEGLGSTRWVYNGKGYR-------------------YIRCYYWAVKTLITIGGLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYTIVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGG---GNRRTANVMAHGFANLFILDKRDLNEILRIYPESEKLLRKKAK 479          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.716 bits (317), Expect = 1.203e-30
Identity = 107/461 (23.21%), Postives = 205/461 (44.47%), Query Frame = 2
Query:  464 WIGTLTVTILFNVILLPVRAAFYIP----QKDYRYMWF------IFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYV-WYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSN-----------SIG-LGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGE-LSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPE 1774
            W   + + +++  I  P  AAF +     + + +   +      I D ++DI+ ++D+FI  RT ++     V      +  +  K  F +D    +P +L    S S + +        +  ++ +L     + D  + +     +  +  F LI  HW  C ++ + N            IG L   G       N+T+ +   S+    D++ T   ++F  S+LT      V  P  N E I     +L G L++A+I GNV ++I  + +    +  ++  VK ++ F  +   L +R+  +F + W     +D + +L   P+ L+A+I + ++   L+  K F    +  L  L +K +     PGD +   GD+   MY + RG + ++ +D   V   L +  +FGE ++  + PG  S     A+V+++ Y DL  + ++D+ +VLD  PE
Sbjct:  101 WDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKNEEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSGSGETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLVLLMCTFALIA-HWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIK---DKYVTALYFTF--SSLTSVGFGNV-SPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILRED--IVVAILGKNDIFGEPVNQYSRPGKSS-----ADVRALTYCDLHKIVREDMLEVLDMYPE 547          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 4.562e-27
Identity = 106/437 (24.26%), Postives = 197/437 (45.08%), Query Frame = 2
Query:  566 IFDYLIDIVNIIDLFIGSRTGFL-EMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFN----RLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLL-----IMIHWNGCFFFFVSNS-----------IG----LGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVA--EVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIE 1795
            + D  ++I+ IID+ +  RT ++ + G +V D   +  +Y++   F +D    LP +L              Y FN     L  + K    +       N     + S++++ LL     ++ HW  C ++ +  +           IG    LG      P  +NNT    S           + YI S +++  +LT+V    V     ++E I     +L G L+ A + GNV ++I  M + ++ +  +   +K ++    + K+L++R++ +F   W     +D   +L   PD+L+A+IA+ ++ E L+ + IF+      L  L L ++    +PG+++ R+GD  +  Y V  G + V+ DD   V   L +G + G     ++       +  A+VK++ Y DL C++   L+DVLD  PE   +  E
Sbjct:   97 VVDISVEILFIIDILLNFRTTYVSKSGQVVYDGRSICVHYVTTWFF-IDLIAALPFDLL-------------YAFNVSVTTLVHLLKTVRLLRLLRLLQNLDRYSQYSTVVLTLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKK-LETPFHTNNTGGGPSTR---------SAYIASLYFALSSLTSVGFGNVSANT-DAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKEILQ-LAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVLKDD--MVLAILGKGDLIGS----DLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYPEYSHQFHE 501          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 109.768 bits (273), Expect = 6.417e-25
Identity = 103/477 (21.59%), Postives = 206/477 (43.19%), Query Frame = 2
Query:  458 YNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFL-EMGLMVTDREKMLKNYISKLSFKLDFTGILPLEL-------------------FSLISPSKNIDYVWYRFN-----------RLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFST----------MYIYSFFWSTLTLTTVA-EVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLD 1762
            ++WI  + +   +  I++P   +F   Q +    W + D ++D++ ++D+ +   T F+   G +++D + +  NY+ K  F +D    LP ++                   F   SPS+ +D  W R             ++ ++ +L     + D    +     +  + VF L   HW  C ++ + +   +  D      R ++    L  ++  P+    T          +YI S +++  +LT++      P  + E I     ++ G L++ATI GNV ++   M A    +   ++ V+ +++   V K L  R++++    W   + +D + +L   P  ++A+I V ++ +       F+   +  L  L ++ +    +PGD I   G+    +  V  G L V+ DD  +V   L +G VFG++       + S     ANV+++ Y DL  + +D L  VLD
Sbjct:  200 WDWI--ILILTFYTAIMVPYNVSFKTKQNNV--AWLVVDSVVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYL-KTWFVIDLLSCLPYDIINAFENVDEVVRAAQIRGPFGSRSPSRLLD-AWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAA-HWLACIWYSIGDYEVI--DEATNLIRKHSWLYQLGETIGTPYHFNGTQWEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVIQDD--EVVAILGKGDVFGDVFWKERVIAPS----CANVRALTYCDLHVIRRDALVKVLD 661          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001558.1 (pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 gene:ENSPMAG00000001411.1 transcript:ENSPMAT00000001558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.888e-19
Identity = 56/256 (21.88%), Postives = 121/256 (47.27%), Query Frame = 2
Query:  869 ISSLIVFLLIMIHWNGCFFFFVSNS---IGLGSDGFVYPP-------RSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVA--EVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGI 1600
            ++ L+    ++ HW  C +F +      + + SD  + P        +      + + SVS       + YI S +++  ++T+V    V     +SE I     +L G L+ A + GNV ++I  M + ++ +  +   +K ++    + + L++R++ +F   W     +D + +L   PD+L+A++ + ++ E L+ + +F+      L  L L ++    +PG+Y+ R+GD  +    V  G + V+ D  +
Sbjct:   32 LTMLMSMFALLAHWMACIWFVIGCQEIVVRVSSDTHISPHCWLHQLRKRLEASGSANSSVSHCGPPLRSAYITSLYFTLSSITSVGFGNVSANT-DSEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTKDLKEFIRIHRLPQPLKQRMLEYFQTTWSVNNGIDTNELLKDFPDELRADVTMHLNKEMLQ-LPLFEAASRGCLRSLSLNVKTTFCAPGEYLIRQGDALQAFCFVLSGSMEVLKDGTV 285          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 454.907 bits (1169), Expect = 2.054e-154
Identity = 219/461 (47.51%), Postives = 317/461 (68.76%), Query Frame = 2
Query:  443 SSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRS----NNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEIL 1813
            S +  Y W+  +++ +L+N   + +R AF        Y+W I DY  D++ I D+ +  RTGFLE G++ T   KM ++Y+    F LD   ++PL++  +    +      +R NR+ K ++ + F+DRT++RT FPN+ R++SL+ F+L++IHWN C +F VS  IG GSD +VYP       N++E T+S            MYIYSF+WSTLTLTT+ EVP P    E+II+TL+ L GVL+FATI+GNVG++I+N+NA + DFQ K+DG+K YM F  + + L+RR+I WFDYLW  K+  DE+ IL +LPDKL+AEIA+ VH ++L+ V IFQDCE   L +L+L+LR Q+FSPGDY+CRKG++G+EMYIV RGKL VV++ G K++  L+ GS FGE+S+L++  S +GNRRTA+V+SVGY++LFCL K+DL +VLDE P  K ++ +  KE L
Sbjct:    1 SGDRLYFWLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILVSMRTGFLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPA----FRINRILKFHRFWHFLDRTESRTTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTIS-----------RMYIYSFYWSTLTLTTIGEVPPPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSM--SSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO34633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW2])

HSP 1 Score: 375.555 bits (963), Expect = 1.515e-123
Identity = 184/454 (40.53%), Postives = 287/454 (63.22%), Query Frame = 2
Query:  464 WIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDN 1825
            W+  ++V +++N + +  R  F   Q  +  +WF+ DY+ DI+  +D+ +  RT +L+ GL+V D +K+ +NY++ + FKLD   ILP +       ++       R  R+ ++ KLF+   R +T++++PN+ +  ++++ +L++ HWN CF+F +S SIG GSD +VYP  S+N            +D+ S  Y+YSF+WST  + T      P  + E + +  +L  G L FA ++G  G+++ ++  A+ +F    + +K+YM    V  +L+ R+I+W DY+W  K+SLD + IL  LP+KL+ +IAV V+   L+ V +F DCE  LL ++++KLR QVFSPGDYICRKGD+G+EMYIV  G L VV DDG  V   L EGS FGE+SILN+ G   GNRRTA V+SVG+SDL CL+KDDL + + + PEA+ RL ERG+E+L + +
Sbjct:    4 WLYIVSVAVVYNWVFIIARQCFSQLQVRFMTLWFVMDYICDIIYGMDIMVEFRTAYLDQGLLVRDLKKLRQNYLATVKFKLDMISILPFDFLYFGLGTRFTLCRLLRLLRIHRVVKLFQ---RGETKSSYPNLLQTFAVVLVILLVFHWNACFYFAISESIGFGSDKWVYPNLSSNN-----------YDKLSRQYLYSFYWSTRMMITGESENPPETDMELLFVVADLTVGYLTFAALVGQFGAILGHIMRARVEFITHSNSIKQYMNNHKVNNDLQERVISWIDYMWHKKRSLDHERILKKLPEKLRGQIAVHVYLAVLRHVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVVGDDGTTVLAILSEGSYFGEISILNLSG--IGNRRTAAVRSVGFSDLLCLSKDDLLEAMSDYPEARMRLEERGRELLNRTH 441          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO49540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK0])

HSP 1 Score: 328.561 bits (841), Expect = 1.719e-105
Identity = 183/449 (40.76%), Postives = 266/449 (59.24%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKD--YRYMWFIFDYLIDIVNIIDLFIGSRTGFLE-MGLMVTDREKMLKNYISKLSFKLDFTGILPLEL---FSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADD---GIKVFV-TLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDL 1747
            V+D    L Y W   +T  + +N  ++ +R AF   + +  YR +++  D + DI+ ++D+ +  RT + +  G+M+   + +  NY SK+ F LD   + PLE    F+L+ PS     VW+R  RL K + +  F   +D RTN PN  R+  L ++L + +HW  C ++ +S   GLGS+ +VYP  S                     YI S +WS LTLTT+ E P P  N E +  +   L G+ +FA ++GNVG +ISNMNAA+TDFQ K+D +K YME   V ++L+ R   W  Y W    S   D  L  LP +L+AE+A+ VH  TLK VKIF+DC+E LL +L+LKLR Q+FSPGDYICR G+IG+EMYI+  GK+ VV  D   G K+ V +L EG+ FGE+S+L +   +  NRR+A+V+SVGYS+L  L++ DL
Sbjct:    3 VIDPEGGLCYTWAALVTFAVFYNFCIVLLRIAFKEVRNELFYRMIYWPLDVISDIIYLVDILVQFRTAYRDDHGIMINTPKLLALNYCSKIPFFLDALSVFPLETTLPFTLVQPS-----VWFRCLRLLKWHCVLRFFVISDLRTNKPNRLRVVKLALYLGLALHWVACGYYMISEYEGLGSNSWVYPEASGED---------------GKKYIKSLYWSILTLTTIGETPEPSTNLEHVFTSAMFLFGIFVFAAVVGNVGDVISNMNAARTDFQTKMDYIKSYMEHHKVPEDLQNRAKRWAYYAW----SRHSDA-LGMLPLRLRAELAIHVHLATLKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLLRLDEGR--NRRSADVRSVGYSELLWLSQKDL 424          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 304.679 bits (779), Expect = 2.908e-96
Identity = 177/461 (38.39%), Postives = 268/461 (58.13%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTV-AEVPGPVFNSE------FIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRL 1789
            +V+D S   Y+ W+ T+++ +++N   L V  AF    +         DY  D +  +D  +  R GFLE G+MV    K+ K Y     F LD   ILP ++  L      I     RFNRL K ++   F DR +  +  P +F ++ LI +L ++IHW  C +F +S   G G+D +++P      +  LS        + S  Y+YS + S++++TTV A V G +          F+I+T   L GVLIFATI+GN G MI  M  ++  +  K++G+K Y+E   +   L++R+I+WFDYLW +K+ ++E  +   L D  KAEIA+ V+ +TL  V++F DC+   L +L+LKLR  + SPGD+ICR+G+ G+EMYIV +G L V+ D+   V  TL  GS FGE+S+LN+ G   GN RTA+V+SVG+SDLF L+K DL +VL+  P+AK ++
Sbjct:    1 LVLDPSGTFYFLWLLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDTLVQFRVGFLEHGVMVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPI----LRFNRLFKAHRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHP----RLDGQLS--------KLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFVIVTY--LTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIRVEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVL-DEKETVLATLSAGSHFGEISLLNMKG--IGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQM 440          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO39918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S2])

HSP 1 Score: 299.671 bits (766), Expect = 1.639e-94
Identity = 155/450 (34.44%), Postives = 257/450 (57.11%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAK 1780
            V+       Y W   +   I +N+ ++ +R AF   Q ++   W +FDY  D + ++D+ I  RTGFLE G++V D +++ ++Y    +F  D   + P ++  ++ P +       R NRL K YK F      ++ T +P   R+  L+  + ++I+WN  F+  +S + G G++ +VYP   +                    Y+ S +WSTLTLT + ++P P  N E++      L GV +FATI+GN GS+I N NA + DF+ + +G   YM    V K+L+RR++ W+DY W +    D ++ L+ LPDKLK EIA+ V+ ETL+ V   Q C+   L  L+L +++++F+PGD+ICRKG++ +EMY++  GK+ VV + G +V   L  G  FGE+ IL++  S+  NRRTA+++++GY + F L+K+D+     + PEA+
Sbjct:    1 VIAPDGRFMYIWFYFVVFAIRYNLWVVILRIAFPAAQDEFTVAWLVFDYFCDFLYVLDIIINFRTGFLEEGILVVDAKRVARHYAVSKNFIADLLSVFPTDILCVLYPER---LPMLRINRLIKAYKSFRIKSLMESHTTYPTFLRVFFLLHLMFLLINWNAGFYIMISRTEGFGTNAWVYPGNGS----------------LYQQYLKSLYWSTLTLTAIGDLPSPATNFEYLYTIACYLCGVFMFATIVGNAGSIIVNRNANRLDFERQREGTNNYMRKNRVPKDLQRRVLMWYDYSWASGGG-DLNS-LTLLPDKLKTEIALHVNLETLRKVTFLQKCQPEFLHDLVLMMKLRIFTPGDFICRKGEVAREMYVIIDGKIEVVGEVG-QVLKVLSGGDFFGEIGILSL--SEGQNRRTADIRTIGYVECFVLSKEDVLKATRDYPEAQ 426          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 260/523 (49.71%), Postives = 370/523 (70.75%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            ++D S++ YY W+  +   + +N++++  RA+F   QK Y  +W + DY  DI+ + D F+ SRTG+LE GL+V D +K+   Y +   FK D   ++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L++IHWN C FF +S +IG GSD +VYP            ++S P   + +  YIYS +WSTLTLTT+ E P PV + E++ +  + L GVLIFA+I+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L TLPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L E+GK ILMKDNL+D EA  N+  +P  ++  + ++  N+ + +  +++L+ ++   Q  +K ++  ++
Sbjct:  177 IMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYP------------NISHPEHGRLARKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKME 683          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga2b (cyclic nucleotide gated channel subunit alpha 2 [Source:NCBI gene;Acc:101171687])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 262/526 (49.81%), Postives = 362/526 (68.82%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLN 2008
            VV  S ++YY W+  +++T+L+N  ++  RA F   Q  +   W + DY+ D V I+D  +  RTGFLE GL+V D  K+  +Y+  L FKLD   ILP +L  +   +  I     RFNRL    ++FEF DRT+TRTN+PNIFRI +L++++L++IHWN C ++ +S S+G GSD +V+P  S     TLS S           Y+Y  +WSTLTLTT+ E+P PV + E++ +  + L GVLIFATI+GNVGSMISNMNA + +FQ +ID +K YM FR V +ELE R+I WFDYLW NK+++DE  +L  LP+KL+AEIA+ VH ETLK V+IF+DCE  LLV+L+LKLR QVFSPGDYICRKGDIGKEMYI+K GKL VVADDG+  +  L  GS FGE+SILNI GSK GNRRTAN++S+GYSDLFCL+KDDL + + E P+AK+ L ERG+EIL K+ LLD  A+   +    T + + +R+  ++   + +++ L+ D+   Q+ +K ++  L+  +N
Sbjct:  122 VVSPSDDIYYRWLLVISITVLYNWFVVVARACFDELQVTFFIWWLVLDYISDTVYILDTIVRLRTGFLEQGLLVKDHIKLRDSYVRTLQFKLDVASILPTDLGYI---ATGIHTPQLRFNRLLHFPRMFEFFDRTETRTNYPNIFRICNLVLYILVIIHWNACIYYAISKSLGFGSDTWVFPNASRTGFTTLSES-----------YVYCLYWSTLTLTTIGEMPPPVRDEEYLFVVFDFLVGVLIFATIVGNVGSMISNMNATRAEFQARIDAIKHYMHFRKVSRELETRVIKWFDYLWTNKKAVDEQEVLKNLPNKLRAEIAINVHLETLKKVRIFKDCEAGLLVELVLKLRQQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLTSGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVIEYPDAKTVLEERGREILKKEGLLDENADSGGLQKEDTEEKV-ERLEMSLDTLQTRFARLLNDYTHTQQRLKQRVTLLEQQIN 632          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: ENSORLT00000025598.2 (cyclic nucleotide-gated channel cone photoreceptor subunit alpha [Source:NCBI gene;Acc:101170498])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 258/523 (49.33%), Postives = 364/523 (69.60%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQN 1999
            ++D +++LYY+W+  L V + +N++LL  RA F   Q +Y  MW + DY  D+   ID F+ +RTGFLE GL+V D + + + Y++ L FK D   +LP ++   +    N ++   RFNRL ++ +LFEF DRT+TRTNFPNIFRI++L+++++I+IHWN C +F VS  +G GSD +VYP  +    + L++            YIY F+WSTLTLTT+ E P PV + E+  +  + L GVLIFATI+GNVG+MISNM AA+ +FQ KID +K+YM FR V K+LE R++ WFDYLW  +++ DE  +L +LPDKLKAEIA+ VH ETL  V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L ++G+ ILMKDNL+D   +  +  +   ++  + +I  ++ +  NK+ +L    +  Q  +K +L +L N
Sbjct:  109 IMDPATDLYYHWLSALAVPVFYNLMLLVARACFNELQYNYTTMWIVLDYGSDVFYYIDTFVRARTGFLEQGLLVKDPKVLKEKYMTTLQFKFDVISLLPTDIVFFVIGINNPEW---RFNRLFRLPRLFEFFDRTETRTNFPNIFRIANLVLYIIIIIHWNACLYFAVSKVLGFGSDTWVYPALTGPKFSRLAIQ-----------YIYCFYWSTLTLTTIGETPPPVRDIEYFFVVADFLTGVLIFATIVGNVGAMISNMGAARVEFQAKIDSIKQYMHFRKVTKDLEARVVKWFDYLWTEEKTCDEKQVLKSLPDKLKAEIAINVHLETLSKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKYALEDKGRAILMKDNLID--ESLVAACDAKDLENKVNQIEASVEVMTNKFKKLTAQHQSSQRKLKQRLSNLSN 615          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 270/598 (45.15%), Postives = 386/598 (64.55%), Query Frame = 2
Query:  287 WICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHV-VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTG--------------------------FLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            W   R      R+D  L      P   E  +  N++   K+    + V ++D S++ YY W+  +   + +N++++  RA+F   QK Y  +W + DY  DI+ + D F+ SRTG                          +LE GL+V D +K+   Y +   FK D   ++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L++IHWN C FF +S +IG GSD +VYP            ++S P   + +  YIYS +WSTLTLTT+ E P PV + E++ +  + L GVLIFA+I+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L TLPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L E+GK ILMKDNL+D EA  N+  +P  ++  + ++  N+ + +  +++L+ ++   Q  +K ++  ++
Sbjct:   43 WTSFRMNPPEERRDSFLERFRG-PKLKEASNAGNRSDEDKLRHRRKEVWIMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYP------------NISHPEHGRLARKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKME 623          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 260/549 (47.36%), Postives = 370/549 (67.40%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTG--------------------------FLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            ++D S++ YY W+  +   + +N++++  RA+F   QK Y  +W + DY  DI+ + D F+ SRTG                          +LE GL+V D +K+   Y +   FK D   ++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L++IHWN C FF +S +IG GSD +VYP            ++S P   + +  YIYS +WSTLTLTT+ E P PV + E++ +  + L GVLIFA+I+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L TLPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L E P+AK  L E+GK ILMKDNL+D EA  N+  +P  ++  + ++  N+ + +  +++L+ ++   Q  +K ++  ++
Sbjct:  154 IMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYP------------NISHPEHGRLARKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKME 686          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 1173.69 bits (3035), Expect = 0.000e+0
Identity = 576/578 (99.65%), Postives = 577/578 (99.83%), Query Frame = 2
Query:  284 MWICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 2017
            MWICNRFRKKSNRKDE LPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNS+NNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI
Sbjct:    1 MWICNRFRKKSNRKDENLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 578          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 568/570 (99.65%), Postives = 569/570 (99.82%), Query Frame = 2
Query:  308 KKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 2017
            KKSNRKDE LPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNS+NNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI
Sbjct:    2 KKSNRKDENLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 571          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000035733.1 (SMESG000035733.1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 401/571 (70.23%), Postives = 485/571 (84.94%), Query Frame = 2
Query:  284 MWICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 1996
            M +  R +K   R +E+ PV+     + E I       FT+I  W Q  VVDSSS  YYNWIG LT+T+LFN+++LPVRAAF IPQ+ YR +W++FDY+ID  N+ID+ I SR  FLE GL+V +  ++ KNYISK+ FK+D   ILP+ELFSLI P +NIDYVWYRFNRLTKIYKLFEFI+RTDTRTNFPNIFRISSLI+FLLI+IHWNGCFFFF+SNSIGLGSDGFVYPPRSN+T+ T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP PV N EFIIMT+ELLGGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE++LL+QLILKL++QVFSPGDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N + N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++
Sbjct:    1 MTLWKRIKKCFVRNNERFPVLG----NIENIPPLKGDLFTRIGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNIFRISSLIIFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 567          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000071536.1 (SMESG000071536.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 273/444 (61.49%), Postives = 345/444 (77.70%), Query Frame = 2
Query:  689 KLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLS-VSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 2017
            K  FKLD   I+P E+FS I       + + RFNRL K YKLF F DRT+TR NFPN+FRI  LI ++LI+IH N C +FF+S  +GLG+D +VYPPR ++++A ++ +S+   W+ F   YIYSF+WSTL LTT+AE P PV N +F+ +T++LL GVLIFATI+GNVGSMI+NMNAA+++FQMK+DGVKRYMEFR V KELE R+I WFDY+W NKQSLDE TIL+TLPDKLKAEIA+ VHY+TLK V IFQDCE  LLV+L+LKL +QVFSPGDYICRKGDIGKEMYIVK+GKL VV+DDG  VFVTL  GSVFGE+SILNI GSK+GNRRTANVKS+GYSDLFCLNK+DLWDVLDE PEA+++LIERGKE+L KDNLLDL+A      +  T++M LK+++  + +   + S L  ++    +  K +++  +  +  SI
Sbjct:    3 KWEFKLDLLSIVPFEIFSAIPQIGFRQFAFLRFNRLIKCYKLFTFADRTETRINFPNMFRILMLIFYILILIHLNACIYFFISTVVGLGADSWVYPPRGSDSKAPMAQISIQDSWNSFLVKYIYSFYWSTLILTTIAETPPPVKNYQFVFITIDLLAGVLIFATIVGNVGSMITNMNAARSEFQMKMDGVKRYMEFRKVNKELEERVIKWFDYIWSNKQSLDEKTILATLPDKLKAEIAIHVHYDTLKRVNIFQDCEPGLLVELVLKLNLQVFSPGDYICRKGDIGKEMYIVKQGKLGVVSDDGNTVFVTLNAGSVFGEISILNIAGSKTGNRRTANVKSIGYSDLFCLNKNDLWDVLDEYPEARNKLIERGKEVLQKDNLLDLDALAEVEKSQQTMEMKLKKLDATLEILLARLSRLQTEYVTNSQKFKQRINKWEMRIQFSI 446          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000071540.1 (SMESG000071540.1)

HSP 1 Score: 489.189 bits (1258), Expect = 4.747e-167
Identity = 236/459 (51.42%), Postives = 323/459 (70.37%), Query Frame = 2
Query:  632 LEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPR-SNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVL 2005
            +E GL+V+D +K+ +NY  K  FKLD   + P ELFSLI    +    + RFNRL K YK F F+D T+ + NFPN+FRI  LI ++L +IH N C FF+VS  IGLGSD +VYPPR S+++  T+ + +S   + F   Y Y F+WSTL LTT+   P P+ + EF+ +++  L G+L+FA I+GN+ SMI N+N ++  FQ   D VKRYM+ R V K L  ++  WF+Y+W+NKQ ++E   L  LPD+LK+EIA+QVH++ LK V IFQDCE  +LV L++KLR+QVFSP DYICRKGD+GKEMYIVK GKL VV+DDG+  FVTL  GSVFGE+SILNI G+K+GNRRTANVKS+GYSDLFCL+KDDLW VL+E PE K +LI++GK+ILMK+NLLD+EA   S  N   ++  +K ++E M     K++ L+ +    +  +  +++  +  L
Sbjct:    1 MEQGLIVSDSKKLRQNYFMKWDFKLDSISLAPFELFSLIPNVGDSIRSFLRFNRLLKYYKFFSFVDATERKINFPNVFRIFILIFYILTVIHLNACVFFYVSTVIGLGSDSWVYPPRVSDSSPPTVQIEISDSMNSFFFKYSYCFYWSTLVLTTIGNTPTPIRSCEFLFISINFLVGLLLFAAIVGNIRSMIININESRKQFQSMSDRVKRYMKLRKVNKNLYEKVTKWFEYMWLNKQLINEKETLCILPDQLKSEIAIQVHFDILKKVHIFQDCESGILVALVIKLRLQVFSPDDYICRKGDVGKEMYIVKHGKLGVVSDDGMTTFVTLNPGSVFGEISILNIAGNKTGNRRTANVKSIGYSDLFCLSKDDLWKVLNEYPETKRKLIDKGKDILMKENLLDIEAIIKSKENKAKLENKIKILDEEMDNLLTKFARLMAELSASRFKLNQRMEKCEKKL 459          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNGA30.000e+051.04cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA30.000e+051.04cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA10.000e+050.28cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA10.000e+050.28cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA10.000e+050.28cyclic nucleotide gated channel subunit alpha 1 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-44.972e-16451.25Cyclic nucleotide-gated cation channel [Source:Un... [more]
cng-11.267e-10937.38Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
cng-21.007e-9131.52Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
tax-26.181e-8332.88TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2][more]
che-63.949e-8132.81pep chromosome:WBcel235:IV:2104056:2111408:-1 gene... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CngA9.936e-16745.40gene:FBgn0261612 transcript:FBtr0302924[more]
CngA1.503e-16445.40gene:FBgn0261612 transcript:FBtr0302925[more]
CG422603.199e-12944.40gene:FBgn0259145 transcript:FBtr0299573[more]
CG422605.993e-12744.42gene:FBgn0259145 transcript:FBtr0330241[more]
CG422608.462e-12744.40gene:FBgn0259145 transcript:FBtr0474145[more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b0.000e+050.86cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga1b0.000e+050.77cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3a0.000e+050.38cyclic nucleotide gated channel subunit alpha 3a [... [more]
cnga3a0.000e+050.38cyclic nucleotide gated channel subunit alpha 3a [... [more]
cnga3a0.000e+050.38cyclic nucleotide gated channel subunit alpha 3a [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyb0.000e+052.29nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb0.000e+052.29nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb0.000e+052.29nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb0.000e+052.29nuclear transcription factor Y subunit beta [Sourc... [more]
amacr0.000e+050.28alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnga30.000e+050.38cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga10.000e+050.57cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
Cnga10.000e+050.57cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
Cnga10.000e+050.57cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
Cnga30.000e+050.38cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90980|CNG3_CHICK0.000e+050.86Cyclic nucleotide-gated channel rod photoreceptor ... [more]
sp|Q16281|CNGA3_HUMAN0.000e+051.04Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q29441|CNGA3_BOVIN0.000e+051.99Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q28279|CNGA1_CANLF0.000e+050.66cGMP-gated cation channel alpha-1 OS=Canis lupus f... [more]
sp|Q90805|CNG1_CHICK0.000e+052.12Cyclic nucleotide-gated channel cone photoreceptor... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7XJ780.000e+056.27Cyclic nucleotide-binding domain-containing protei... [more]
A0A183LJM50.000e+056.27Cyclic nucleotide-binding domain-containing protei... [more]
A0A504Z0W20.000e+056.17Cyclic nucleotide-gated channel cone photoreceptor... [more]
G4VGD70.000e+056.19Putative cyclic-nucleotide-gated cation channel OS... [more]
A0A4E0RSW70.000e+055.98Cyclic nucleotide-gated channel cone photoreceptor... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b0.000e+050.57cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3a0.000e+046.64cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3a0.000e+049.81cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3b0.000e+049.62cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3b0.000e+049.62cyclic nucleotide gated channel subunit alpha 3b [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1a2.979e-7630.75cyclic nucleotide gated channel subunit beta 1a [S... [more]
ENSPMAT00000005594.11.203e-3023.21pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
ENSPMAT00000005922.14.562e-2724.26pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
kcnh1b6.417e-2521.59potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000001558.11.888e-1921.88pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 ge... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353932.054e-15447.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346331.515e-12340.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495401.719e-10540.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353762.908e-9638.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399181.639e-9434.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga3a0.000e+049.71cyclic nucleotide gated channel subunit alpha 3 [S... [more]
cnga2b0.000e+049.81cyclic nucleotide gated channel subunit alpha 2 [S... [more]
ENSORLT00000025598.20.000e+049.33cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3a0.000e+045.15cyclic nucleotide gated channel subunit alpha 3 [S... [more]
cnga3a0.000e+047.36cyclic nucleotide gated channel subunit alpha 3 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013398.10.000e+099.65SMESG000013398.1[more]
SMESG000013398.10.000e+099.65SMESG000013398.1[more]
SMESG000035733.10.000e+070.23SMESG000035733.1[more]
SMESG000071536.10.000e+061.49SMESG000071536.1[more]
SMESG000071540.14.747e-16751.42SMESG000071540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017295 ID=SMED30017295|Name=Cyclic nucleotide gated channel alpha 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2183bp
GTTGGGTTCGGGGAATGGGGCGTCGACTGACAACTTTATTAATTACGGAG
AGAATAGAAAATGCAAACGCGAGCAGTTCTTGGCAGTTCTCATTTGATTG
TAGTTAAATAGATGAAATTCTCTAAAATAAGAATTACCTGTCATTATTTG
CGAATGATTCCATGGGAAAATTCCTTGTAATAGATTTTCATTTTTCATCG
ATTATATTCTTCAAATCTGATTCGTCAGGATTTTCATTGGATCAATTTCA
TACTCGATAGGAATTTTATTGATTTGGAATTTTATGTGGATTTGCAATCG
ATTCAGAAAAAAATCCAACAGAAAGGATGAAAAGCTCCCAGTCGTTGATT
CTCAGCCTGACGATGCCGAACTCATTCATTTTCAAAACAAAACTTTCTTT
ACGAAAATTAATTTATGGTACCAACATGTTGTCGTTGATTCGTCTTCAAA
TCTGTATTACAATTGGATTGGCACTTTAACTGTTACAATACTTTTTAATG
TCATCCTACTTCCTGTCAGGGCGGCCTTTTATATTCCCCAAAAAGATTAT
AGATATATGTGGTTCATCTTCGATTATCTAATAGATATAGTCAATATCAT
TGACTTGTTTATCGGATCAAGAACAGGTTTCTTAGAAATGGGTTTGATGG
TGACAGACAGAGAAAAAATGCTTAAAAATTATATTTCTAAATTGTCATTC
AAATTAGATTTCACGGGAATTTTACCTTTAGAATTATTCAGTTTAATTTC
CCCTTCCAAAAATATTGATTATGTTTGGTATCGATTTAATCGGCTCACAA
AAATCTATAAATTGTTTGAATTCATCGACCGCACGGATACTAGAACCAAC
TTCCCAAATATTTTCAGAATTTCTTCACTAATAGTTTTTCTACTGATCAT
GATTCATTGGAATGGATGCTTTTTCTTTTTTGTTAGTAACTCCATTGGAC
TGGGGTCCGATGGGTTTGTGTATCCCCCAAGGAGTAACAACACTGAGGCG
ACACTGTCGGTGTCAGTTAGTCAACCCTGGGACCAATTTTCCACAATGTA
CATCTATTCATTTTTCTGGTCAACTTTGACCCTTACAACAGTCGCAGAAG
TACCAGGTCCAGTTTTTAATTCTGAATTCATAATAATGACTCTCGAACTT
CTTGGGGGAGTTTTGATTTTTGCCACAATCATTGGAAATGTTGGCTCAAT
GATATCTAACATGAACGCGGCAAAAACGGATTTTCAAATGAAAATTGACG
GAGTAAAAAGATATATGGAATTTCGTGGTGTTGGAAAGGAGTTAGAAAGA
CGAATCATAAATTGGTTTGATTATTTGTGGATAAATAAGCAATCCTTGGA
TGAAGACACTATTCTGTCAACACTTCCTGACAAATTAAAAGCAGAAATAG
CTGTCCAGGTTCATTATGAAACTCTGAAAGGGGTAAAAATATTTCAGGAC
TGCGAAGAAACTCTTTTAGTCCAGTTAATTCTCAAATTGCGAATGCAAGT
CTTCAGTCCAGGAGATTATATTTGTAGGAAAGGGGATATTGGGAAGGAAA
TGTATATTGTCAAACGAGGAAAGCTAAATGTTGTTGCTGACGATGGAATT
AAGGTTTTTGTTACTCTAAAGGAAGGAAGCGTTTTTGGAGAGTTATCAAT
TCTGAATATTCCAGGCAGTAAAAGTGGAAATCGTAGAACTGCGAATGTAA
AATCAGTTGGATATTCAGATTTGTTTTGTTTAAATAAAGATGACCTGTGG
GATGTATTAGATGAGAACCCAGAAGCAAAATCTAGATTAATAGAGAGAGG
CAAAGAAATATTAATGAAAGATAATCTGCTAGATCTAGAGGCAAATAAAA
ATTCAGTAAACAATCCTCACACAATAGACATGATCTTGAAGAGAATTAAT
GAAAATATGAGCTTATTTGAAAATAAATATTCAGAACTCGTGCAAGATTT
TGAAGTGGAACAAGAGATAATGAAATCAAAATTGGATGATTTACAGAATG
TTTTAAACGGTTCCATTTAATATTAATTATTGTTTTAATTATATATAACA
GTTGAATTTCTCACAACATTGACGGATAATATAATGAAAATATTTTATTT
TATATTTAATTTTATGTGTTCCTCATATTCCATTCTTTCTGAAGGTCCTC
TATTCGAAATTGTCATCAGACATTTATCTTACG
back to top

protein sequence of SMED30017295-orf-1

>SMED30017295-orf-1 ID=SMED30017295-orf-1|Name=SMED30017295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MWICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVV
VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLI
DIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLE
LFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLI
VFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWD
QFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATII
GNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWI
NKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLIL
KLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSV
FGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKS
RLIERGKEILMKDNLLDLEANKNSVNNPHTIDMILKRINENMSLFENKYS
ELVQDFEVEQEIMKSKLDDLQNVLNGSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034220ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
IPR000595cNMP-bd_dom
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR032406CLZ_dom
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 535..573
NoneNo IPR availableGENE3DG3DSA:1.10.287.630coord: 313..377
e-value: 5.4E-26
score: 92.2
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 187..312
e-value: 2.1E-5
score: 26.2
NoneNo IPR availablePANTHERPTHR45638:SF17CYCLIC NUCLEOTIDE-GATED CATION CHANNEL SUBUNIT Acoord: 43..572
NoneNo IPR availablePANTHERPTHR45638FAMILY NOT NAMEDcoord: 43..572
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 54..311
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 282..304
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
IPR003938Potassium channel, voltage-dependent, EAG/ELK/ERGPRINTSPR01463EAGCHANLFMLYcoord: 97..107
score: 35.23
coord: 472..480
score: 45.14
coord: 256..273
score: 26.39
coord: 205..215
score: 29.26
coord: 299..308
score: 42.81
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 386..507
e-value: 1.4E-22
score: 91.0
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 405..495
e-value: 7.0E-19
score: 67.7
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 386..504
score: 24.9
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 386..503
e-value: 9.63939E-25
score: 97.0113
IPR032406Cyclic nucleotide-gated channel, C-terminal leucine zipper domainPFAMPF16526CLZcoord: 502..571
e-value: 6.8E-12
score: 45.6
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 379..512
e-value: 1.8E-38
score: 133.2
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 451..474
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 413..429
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 313..505