Major facilitator superfamily domain-containing 4

Overview
NameMajor facilitator superfamily domain-containing 4
Smed IDSMED30017286
Length (bp)2023
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Major facilitator superfamily domain-containing 4 (SMED30017286) t-SNE clustered cells

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing 4 (SMED30017286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Major facilitator superfamily domain-containing 4 (SMED30017286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing 4 (SMED30017286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017286h1SMcG0000536 SmedASXL_011601SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30017286h1SMcG0000536 Contig50422newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017286h1SMcG0000536 Contig50422uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30017286h1SMcG0000536 dd_Smed_v4_10372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017286h1SMcG0000536 dd_Smed_v4_10372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017286h1SMcG0000536 dd_Smed_v4_10372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30017286h1SMcG0000536 dd_Smed_v4_10372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017286h1SMcG0000536 dd_Smed_v4_10372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017286h1SMcG0000536 dd_Smed_v6_10372_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017286h1SMcG0000536 OX_Smed_1.0.08062ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Human
Match: MFSD4A (major facilitator superfamily domain containing 4A [Source:HGNC Symbol;Acc:HGNC:25433])

HSP 1 Score: 143.28 bits (360), Expect = 7.904e-36
Identity = 126/483 (26.09%), Postives = 225/483 (46.58%), Query Frame = 2
Query:  227 IFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS-------------------EMNIEASDRYYNNQI-----------KILSYPFWIIGSIEL---LLFVLLFHIYRLM----QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNL-------TCGIVCLVGC-------------LCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKL 1501
            + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L + +   ++   R   VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     NC  A+                   + +++A  + ++NQ              +SY FWI+  I L   +  ++L    RL+    Q++ +           Q  +  D+ +  PK +++L        C    L G              + F+ DG+   Y+++VY+YAV+     +    A +L   FWG ++LGR  +I IS   + + ++ I+ VG+    ++L+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A VGE    ++ G++        F V  VI   L     FT Y L
Sbjct:   10 LLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLS--EANCLPANSTANTTSRGHLFHVSRVLGQHHVDA--KPWSNQTFPGLTPKDGAGTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEK-PLSVGHKVAGYLPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPSMLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLA----FTFYIL 483          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Human
Match: MFSD4A (major facilitator superfamily domain containing 4A [Source:HGNC Symbol;Acc:HGNC:25433])

HSP 1 Score: 131.724 bits (330), Expect = 2.798e-32
Identity = 110/423 (26.00%), Postives = 202/423 (47.75%), Query Frame = 2
Query:  227 IFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS-------------------EMNIEASDRYYNNQI-----------KILSYPFWIIGSIEL---LLFVLLFHIYRLM----QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNL-------TCGIVCLVGC-------------LCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEE 1321
            + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L + +   ++   R   VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     NC  A+                   + +++A  + ++NQ              +SY FWI+  I L   +  ++L    RL+    Q++ +           Q  +  D+ +  PK +++L        C    L G              + F+ DG+   Y+++VY+YAV+     +    A +L   FWG ++LGR  +I IS   + + ++ I+ VG+    ++L+    +   L+  T  +GL LS+T P +++  E+
Sbjct:   10 LLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLS--EANCLPANSTANTTSRGHLFHVSRVLGQHHVDA--KPWSNQTFPGLTPKDGAGTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEK-PLSVGHKVAGYLPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPSMLAYTED 427          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Human
Match: MFSD4A (major facilitator superfamily domain containing 4A [Source:HGNC Symbol;Acc:HGNC:25433])

HSP 1 Score: 110.538 bits (275), Expect = 4.128e-25
Identity = 103/390 (26.41%), Postives = 176/390 (45.13%), Query Frame = 2
Query:  503 RSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS-------------------EMNIEASDRYYNNQI-----------KILSYPFWIIGSIEL---LLFVLLFHIYRLM----QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNL-------TCGIVCLVGC-------------LCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKL 1501
            R   VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     NC  A+                   + +++A  + ++NQ              +SY FWI+  I L   +  ++L    RL+    Q++ +           Q  +  D+ +  PK +++L        C    L G              + F+ DG+   Y+++VY+YAV+     +    A +L   FWG ++LGR  +I IS   + + ++ I+ VG+    ++L+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A VGE    ++ G++        F V  VI   L     FT Y L
Sbjct:   48 RDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLS--EANCLPANSTANTTSRGHLFHVSRVLGQHHVDA--KPWSNQTFPGLTPKDGAGTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEK-PLSVGHKVAGYLPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPSMLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLA----FTFYIL 428          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Human
Match: MFSD4A (major facilitator superfamily domain containing 4A [Source:HGNC Symbol;Acc:HGNC:25433])

HSP 1 Score: 102.064 bits (253), Expect = 8.077e-23
Identity = 64/225 (28.44%), Postives = 113/225 (50.22%), Query Frame = 2
Query:  227 IFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEI-NKTTP 895
            + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L + +   ++   R   VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     NC  A+      S  +                         LFH+ R++ + +++ K   N+T P
Sbjct:   10 LLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLS--EANCLPANSTANTTSRGH-------------------------LFHVSRVLGQHHVDAKPWSNQTFP 207          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Human
Match: MFSD4B (major facilitator superfamily domain containing 4B [Source:HGNC Symbol;Acc:HGNC:21053])

HSP 1 Score: 96.2857 bits (238), Expect = 3.110e-20
Identity = 103/450 (22.89%), Postives = 195/450 (43.33%), Query Frame = 2
Query:  269 SFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQ--------------IKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGN------FFTLYKLGSTTTKFSEKYFKTVIDVQ 1558
            SF   G+ + I+GP+   L   +N + SS++ ++  +    L  ++  G LV ++    LL I+     +  YLV   ++  +L +++   G ++G +D+  NVL++ ++     P +Q +HF +  GA +  L     L  L+   T ++E + E+      NQ               K L + + +IG+   L+ V+ F ++              K + KQ   A  S  T  ++K +     +  +    +V  G +  Y SYV+++A    H  ++ S A+ L   FWGT +  R  AI  +   +   ++++  +G     + LV    +   L+ AT + G +++ T P  +S  E++  +      F +  AS+GE   P + G L     Q  +P   V+L   +  +      F  LYKL ++      K  +   D +
Sbjct:    5 SFLGLGLSVAIVGPTFQDLATNVNRNISSLSFIFVGRALGYLSGSVIGGFLVDVMNYFLLLGISMSATTVGLYLVPFCKTAILLTVMMSIFGVSIGILDTGGNVLILAIWGDKGAPHMQALHFSFALGAFLAPL-----LAKLALGPTASAENHTESDFHPALNQSSDADSEALFGVPNDKNLLWAYAVIGTYMFLVSVIFFCLFL-------------KNSSKQ-EKARASAETFRRAKYHNALLCLLFLFFFFYV--GAEVTYGSYVFSFATT--HAGMKESEAAGLNSIFWGTFAACRGLAIFFATCLQPGTMIVLSNIGSLTSSLFLVLFDKNPICLWIATSVYGASMATTFPSGVSWIEQYTTIHGKSAAFFVIGASLGEMAIPAVIGIL-----QGKYPDLPVVLYTSLGASIATGILFPVLYKLATSPLDRQRKEDRKSEDQK 426          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Zebrafish
Match: mfsd4aa (major facilitator superfamily domain containing 4Aa [Source:NCBI gene;Acc:393503])

HSP 1 Score: 144.821 bits (364), Expect = 1.938e-36
Identity = 121/482 (25.10%), Postives = 227/482 (47.10%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVM-IARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------EMNIEASDRYYNNQIKI-----------LSYPFWIIGSIEL----LLFVLLFHIYRLMQKQNINFK----EINKTTPKQMSDAVDSVATKPKSKTN---LTC--------------GIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEK 1531
            ++F+ N   +L Y+  F  FG+C+  +GP++  L+CQ  ++   +T+V+F Q   + + +   G   K +      +    +++   + ++ + R   +LA  +   G  MG ID+++N+ LV +Y+++   F+Q +HF  G GAL++ L  DPFL    T+C I +         ++  + + R+ +N   +           +SY FWI+  I L     +FVL++     M   + + +    ++    P+  S   +    K  S ++    +C              GI  L G + F  DG+   Y  +VYTYAV +   +L   +A +L   FW  ++ GR +AI +S   +   LLI+  VG+   V++L+     S  L+  TC +GL +S+  P +++L E+ +      TT ++ SA +GE    ++ G++M +     F +  +I   L    F  LY +  +   ++E 
Sbjct:   11 ALFRSNWQHTLTYWSVFFSFGLCVAFLGPTILDLRCQTQSTLQEITLVFFSQQFFLFLGSTIGGFFSKTLVSSLSSLAVSTLIISVVFAIIPLCRELLMLAFAMAVSGLAMGIIDTISNLQLVKIYQKDSTVFLQALHFFVGLGALVSPLIADPFLS--DTSCVIGNSSVNTTSLEDLRNKLAGRHVHNVSNVHLHTDGEVVTNVSYAFWIMAIINLPVPIAIFVLIYRERLFMCGSDPSRRLLDGDVLAIKPRGTSILAEDTGQKETSNSHADLFSCCLLGKAHSFPLSFFGIHVLGGLVLFFSDGIVGSYTGFVYTYAV-APPMNLPHKTAGYLTCIFWAAITTGRLSAIPLSYRFKPVRLLIVSQVGVIVTVLLLLIFSNSSVFLFIGTCCLGLFISSIFPCMLALTEDILEYKGCATTVLVTSAGMGEMVLQVLVGSVMHSRGSFSFLLCGMIFGCLGFTFFTFLYFVQQSHKSYTEA 489          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Zebrafish
Match: mfsd4ab (major facilitator superfamily domain containing 4Ab [Source:NCBI gene;Acc:558146])

HSP 1 Score: 122.865 bits (307), Expect = 4.861e-29
Identity = 119/477 (24.95%), Postives = 216/477 (45.28%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTY-LVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFL--QFLSTNCT-------------IASEMNI-EASDRYYNNQIKILSYPFWIIGSIEL----LLFVLLFHIY----------RLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCL-----------------CFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPV--------GNVILVILIMGNFF 1486
            ++FK N   +L Y+  F  FG+ I  +GP++  L+C+  ++   +T V+F Q   +LI + + G   K +    L +    +++   + ++ +  +  +LAI +   G  MG ID++ N+ LV++YK++   F+Q +HF  G GAL++ L  +PF+    L +N T               S +N+ E+S      + + +SY FWI+  I L     +FVL++             RL+ K  +   E       +M++  D V          +C   C  G L                  F+ +G+   Y  +VYTYAV S    L+   A  L   FW  ++ GR  +I +S   +T  LL+ +  G+   +++L+    +   L+  T  +GL +S+  P +++  E+ +      TT ++  + +GE    ++ GTL+       F V        G + L+ +I+ N F
Sbjct:    9 TLFKRNCQHTLTYWSVFFSFGLSIAFLGPTILDLKCRTGSTLQEITWVFFAQQLCLLIGSSSGGAFTKTLFSALLALFLSSLIISVVFSIIPLCYNVLLLAIAMAVSGLAMGIIDTIANIQLVSIYKKDSPIFLQALHFFIGLGALLSPLIAEPFISGHCLRSNSTENATEIIHHFRSSFRSPVNLPESSPLSGPVEERNVSYAFWIMALINLPVPIAVFVLMYQEKLLPFCPNSSPRLLDKDELAM-ETKAPDNTEMAELDDEVFLHSGHGNIFSC---CTDGALRGLPVTFFLIHIFGGMVLFMTEGIMGVYAGFVYTYAV-SPPMSLQSKMAGNLNCIFWAAITAGRLVSIPLSYRFKTVHLLLTNLAGVIVTLLLLMILYTNRVFLFVGTTFLGLFISSVFPCLVAYTEDILEYRGCATTVLVTLSGMGEMTLQVLAGTLIQKKGSYSFLVCGLVIGCLGFIFLLSVILSNHF 480          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Zebrafish
Match: mfsd4b (major facilitator superfamily domain containing 4B [Source:NCBI gene;Acc:100037368])

HSP 1 Score: 102.834 bits (255), Expect = 2.459e-22
Identity = 96/396 (24.24%), Postives = 174/396 (43.94%), Query Frame = 2
Query:  269 SFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDR-------YYNNQIKILSYPF-W---IIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNV 1423
            SF   GM I ++GP+   L   +N + S+++ ++  +    +  +L  G L   + PH LL    L            +   VL +++ ++G +MG +D+  NVL++N +    GP +Q +HF +  GA  + + I   L     + T  S M+  AS          +      +  P+ W   +IG+  LL+ +L F +Y  +   + N       + KQ             SK + T  ++ L+    F   G +  Y S+++TY     H  +E + A+ L   FWG  + GR  AI  +       L+++  VG     ++L     +  +L+  T + G+++S T P  IS  E++  +T       +  A++GE   P + G L+ +V
Sbjct:   86 SFLGLGMAISVLGPTFEDLAINVNKNISNLSYIFVGRASGYIGGSLLGGILFDFVNPHLLLGFALLTTAFGMSGTPFCKKAWVLTVLMSSVGVSMGVLDTGGNVLILNTWGEQAGPHMQALHFSFAAGAFASPI-IAKLLFGHHNSSTNTSLMSGHASKTIDAVLPFSHAKGTSTIDLPWMWAYIVIGAFVLLVSLLFFSLYFCI---STNSNRTKTASGKQQF-----------SKHHNT--LIILLSMFFFFYVGSEVAYGSFIFTYGKDYVH--MEETEAAGLNSLFWGAFAAGRGLAIFFAACLHPGTLILLSLVGTTVSSLLLCLFSQNYPMLWACTALYGISMSTTFPSGISWVEQYTTVTGRSAAIFVVGAALGEMVLPALLGFLLGHV 462          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Xenopus
Match: mfsd4a (major facilitator superfamily domain containing 4A [Source:NCBI gene;Acc:595041])

HSP 1 Score: 156.762 bits (395), Expect = 1.730e-40
Identity = 128/473 (27.06%), Postives = 226/473 (47.78%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIA--RSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFL---QFLSTNCTIASEMNIEA--------SDRYYNNQIKIL--------SYPFWIIGSIELLLFVLLFH-IYRL----------------------MQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLC---FVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKL 1501
            ++F+ N   +L Y+  F  FG+CI  +GP++  L+CQ ++S   +T V+F Q   +L+ +   G   + ++   L ++    L I+   V+I       VLA+++   G  MGCID+++N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     + +N T     N+E           R  ++ +  L        SY FWI+ +I L + V +F+ IY+                       M K+N + K       ++   AV  +  + K   N       +  C     F+ DG+  EY+ +VY+YAV+    +L   +A +L   FW  ++LGR  +I +S      ++L I+ +G+    + L+  Q  +  ++  T ++GL LS+  P +++  E+ +N     TT ++  A +GE    ++ G++M       F V  + L  L     FTLY +
Sbjct:    9 ALFRRNFQSTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLQDITWVFFAQQFCLLVGSTLGGVFKRTVK-QSLFLLFLSSLTISVVFVIIPFCDHVGVLALVMAIAGLAMGCIDTISNMQLVKIYQQDSAIFLQVLHFFVGFGALLSPLIADPFLSDTNCIQSNATQNGSRNLEHIRNSLVPHHPRNVSHYVLPLQGALVTQVSYAFWIMAAINLPVPVAVFYLIYKKGMVPGCHIQNGGLLSADELAMEMHKENDSQK---IEAHEEHGHAVSLLCCQNKKIWNAPFTFFAIHMCAAVTLFMTDGIVGEYSGFVYSYAVEQP-LNLAHKTAGYLPSLFWAFITLGRLISIPVSYKMAPRSMLFINLIGVTATFLFLLLSQNSTTGMFVGTALLGLWLSSVFPSMLAYTEDILNYKGCATTVLVTGAGMGEMVLQILVGSVMQTQGSYSFLVCGICLSSLA----FTLYAV 472          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Xenopus
Match: pax8 (paired box 8 [Source:Xenbase;Acc:XB-GENE-483693])

HSP 1 Score: 116.701 bits (291), Expect = 9.490e-27
Identity = 103/448 (22.99%), Postives = 200/448 (44.64%), Query Frame = 2
Query:  269 SFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFL---------STNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMS-DAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGN------FFTLYKLGSTTTKFSEKYFKTVIDVQNS 1564
            +F   GM I ++GP+ P L   + +S ++++ ++  +    L  ++  G L + +  H LL ++ L      Y+V   +    L  ++  +G +MG +D+  NV+++N ++   GP +Q +HF +  GA +  +     L+F+         S +   AS+ + E S   +  +  +LSY   +IG+  LL+ + LF +Y             +K+ P Q +  A D      K    L   +     C      G +  Y SY++TYA+    T+++ + A+ L   FWG  +  R  AI  +       +L++  +G     ++LV    +  +L+  T + G +++ T P   S A+++  +     +  +  AS+GE   P   G L     Q +FP   V++   +  +      F  +YKL +T  +   +Y +   D + +
Sbjct:   80 AFLGLGMAIAVLGPTFPDLAANVESSIANISFIFVGRSMGYLGGSILGGVLFEQMNQHLLLGLSMLATAAGLYVVPWCKRAVFLTAVMSVVGMSMGFLDTGGNVIILNTWEDQAGPHVQALHFSFALGAFVAPILAKLALEFIPFDKIPLMDSADRFNASQPSFEQSALPFGIKKSMLSY--IVIGTYILLVSLFLFILY-------------SKSRPSQSAGKASDEKFRTAKYHNALIFLLFLFFFCYV----GAEVAYGSYIFTYAIT---TNIDHNKAAGLNSLFWGVFAAVRGLAICFATCLYPGTMLLVSVIGCTLSSLILVLFNSNHLLLWAGTAVYGASMATTFPSGFSWAQQYTTIGGKAASLFVVGASLGEMAIPASVGYL-----QGMFPTFPVLMYTALASSTMTAVLFPVMYKL-ATAQQDQARYNRVESDDRRA 499          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Mouse
Match: Mfsd4a (major facilitator superfamily domain containing 4A [Source:MGI Symbol;Acc:MGI:2442786])

HSP 1 Score: 149.058 bits (375), Expect = 6.304e-38
Identity = 122/463 (26.35%), Postives = 215/463 (46.44%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------------EMNIEASDRYYNNQIKIL----------SYPFWIIGSIEL---LLFVLLFHIYRLM---QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC-------GIVC-------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVI 1456
             + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L++ +   ++       VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  G GAL++ L  DPFL     NC  A+                 +  A+  + N  I  L          SY FWI+  I L   L  + L    RL+   Q++ +           + ++  D+ +  PK + +       +C       G  C           + F+ DGM   Y+++VY+YAV+     +   SA +L   FWG ++LGRF +I +S   R + ++ I+ VG+    +ML+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A +GE    ++ G +        F V  VI
Sbjct:    9 ELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMGCIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLS--EANCFPANNTANATSRSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSKERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAPCSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKP-LSIGHKSAGYLPSLFWGFITLGRFISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAYTEDILQYKGCATTVLVTGAGIGEMVLQMLVGLIFQAQGSYSFLVCGVI 468          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Mouse
Match: Mfsd4a (major facilitator superfamily domain containing 4A [Source:MGI Symbol;Acc:MGI:2442786])

HSP 1 Score: 148.673 bits (374), Expect = 7.410e-38
Identity = 122/463 (26.35%), Postives = 215/463 (46.44%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------------EMNIEASDRYYNNQIKIL----------SYPFWIIGSIEL---LLFVLLFHIYRLM---QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC-------GIVC-------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVI 1456
             + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L++ +   ++       VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  G GAL++ L  DPFL     NC  A+                 +  A+  + N  I  L          SY FWI+  I L   L  + L    RL+   Q++ +           + ++  D+ +  PK + +       +C       G  C           + F+ DGM   Y+++VY+YAV+     +   SA +L   FWG ++LGRF +I +S   R + ++ I+ VG+    +ML+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A +GE    ++ G +        F V  VI
Sbjct:    9 ELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMGCIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLS--EANCFPANNTANATSRSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSKERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAPCSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKP-LSIGHKSAGYLPSLFWGFITLGRFISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAYTEDILQYKGCATTVLVTGAGIGEMVLQMLVGLIFQAQGSYSFLVCGVI 468          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Mouse
Match: Mfsd4a (major facilitator superfamily domain containing 4A [Source:MGI Symbol;Acc:MGI:2442786])

HSP 1 Score: 148.673 bits (374), Expect = 7.410e-38
Identity = 122/463 (26.35%), Postives = 215/463 (46.44%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------------EMNIEASDRYYNNQIKIL----------SYPFWIIGSIEL---LLFVLLFHIYRLM---QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC-------GIVC-------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVI 1456
             + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L++ +   ++       VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  G GAL++ L  DPFL     NC  A+                 +  A+  + N  I  L          SY FWI+  I L   L  + L    RL+   Q++ +           + ++  D+ +  PK + +       +C       G  C           + F+ DGM   Y+++VY+YAV+     +   SA +L   FWG ++LGRF +I +S   R + ++ I+ VG+    +ML+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A +GE    ++ G +        F V  VI
Sbjct:    9 ELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMGCIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLS--EANCFPANNTANATSRSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSKERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAPCSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKP-LSIGHKSAGYLPSLFWGFITLGRFISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAYTEDILQYKGCATTVLVTGAGIGEMVLQMLVGLIFQAQGSYSFLVCGVI 468          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Mouse
Match: Mfsd4a (major facilitator superfamily domain containing 4A [Source:MGI Symbol;Acc:MGI:2442786])

HSP 1 Score: 148.673 bits (374), Expect = 7.410e-38
Identity = 122/463 (26.35%), Postives = 215/463 (46.44%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------------EMNIEASDRYYNNQIKIL----------SYPFWIIGSIEL---LLFVLLFHIYRLM---QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC-------GIVC-------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVI 1456
             + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L++ +   ++       VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  G GAL++ L  DPFL     NC  A+                 +  A+  + N  I  L          SY FWI+  I L   L  + L    RL+   Q++ +           + ++  D+ +  PK + +       +C       G  C           + F+ DGM   Y+++VY+YAV+     +   SA +L   FWG ++LGRF +I +S   R + ++ I+ VG+    +ML+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A +GE    ++ G +        F V  VI
Sbjct:    9 ELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMGCIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLS--EANCFPANNTANATSRSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSKERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAPCSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKP-LSIGHKSAGYLPSLFWGFITLGRFISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAYTEDILQYKGCATTVLVTGAGIGEMVLQMLVGLIFQAQGSYSFLVCGVI 468          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Mouse
Match: Mfsd4a (major facilitator superfamily domain containing 4A [Source:MGI Symbol;Acc:MGI:2442786])

HSP 1 Score: 139.813 bits (351), Expect = 5.370e-35
Identity = 112/421 (26.60%), Postives = 199/421 (47.27%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------------EMNIEASDRYYNNQIKIL----------SYPFWIIGSIEL---LLFVLLFHIYRLM---QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC-------GIVC-------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFIN 1330
             + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L++ +   ++       VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  G GAL++ L  DPFL     NC  A+                 +  A+  + N  I  L          SY FWI+  I L   L  + L    RL+   Q++ +           + ++  D+ +  PK + +       +C       G  C           + F+ DGM   Y+++VY+YAV+     +   SA +L   FWG ++LGRF +I +S   R + ++ I+ VG+    +ML+    +   L+  T  +GL LS+T P +++  E+ + 
Sbjct:    9 ELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMGCIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLS--EANCFPANNTANATSRSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSKERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAPCSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKP-LSIGHKSAGYLPSLFWGFITLGRFISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAYTEDILQ 426          
BLAST of Major facilitator superfamily domain-containing 4 vs. UniProt/SwissProt
Match: sp|Q5BIZ0|MFD4A_XENTR (Major facilitator superfamily domain-containing protein 4A OS=Xenopus tropicalis OX=8364 GN=mfsd4a PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 9.168e-40
Identity = 128/473 (27.06%), Postives = 226/473 (47.78%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIA--RSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFL---QFLSTNCTIASEMNIEA--------SDRYYNNQIKIL--------SYPFWIIGSIELLLFVLLFH-IYRL----------------------MQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLC---FVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKL 1501
            ++F+ N   +L Y+  F  FG+CI  +GP++  L+CQ ++S   +T V+F Q   +L+ +   G   + ++   L ++    L I+   V+I       VLA+++   G  MGCID+++N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     + +N T     N+E           R  ++ +  L        SY FWI+ +I L + V +F+ IY+                       M K+N + K       ++   AV  +  + K   N       +  C     F+ DG+  EY+ +VY+YAV+    +L   +A +L   FW  ++LGR  +I +S      ++L I+ +G+    + L+  Q  +  ++  T ++GL LS+  P +++  E+ +N     TT ++  A +GE    ++ G++M       F V  + L  L     FTLY +
Sbjct:    9 ALFRRNFQSTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLQDITWVFFAQQFCLLVGSTLGGVFKRTVK-QSLFLLFLSSLTISVVFVIIPFCDHVGVLALVMAIAGLAMGCIDTISNMQLVKIYQQDSAIFLQVLHFFVGFGALLSPLIADPFLSDTNCIQSNATQNGSRNLEHIRNSLVPHHPRNVSHYVLPLQGALVTQVSYAFWIMAAINLPVPVAVFYLIYKKGMVPGCHIQNGGLLSADELAMEMHKENDSQK---IEAHEEHGHAVSLLCCQNKKIWNAPFTFFAIHMCAAVTLFMTDGIVGEYSGFVYSYAVEQP-LNLAHKTAGYLPSLFWAFITLGRLISIPVSYKMAPRSMLFINLIGVTATFLFLLLSQNSTTGMFVGTALLGLWLSSVFPSMLAYTEDILNYKGCATTVLVTGAGMGEMVLQILVGSVMQTQGSYSFLVCGICLSSLA----FTLYAV 472          
BLAST of Major facilitator superfamily domain-containing 4 vs. UniProt/SwissProt
Match: sp|Q6PDC8|MFD4A_MOUSE (Major facilitator superfamily domain-containing protein 4A OS=Mus musculus OX=10090 GN=Mfsd4a PE=2 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 4.410e-37
Identity = 122/463 (26.35%), Postives = 215/463 (46.44%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------------EMNIEASDRYYNNQIKIL----------SYPFWIIGSIEL---LLFVLLFHIYRLM---QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC-------GIVC-------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVI 1456
             + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L++ +   ++       VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  G GAL++ L  DPFL     NC  A+                 +  A+  + N  I  L          SY FWI+  I L   L  + L    RL+   Q++ +           + ++  D+ +  PK + +       +C       G  C           + F+ DGM   Y+++VY+YAV+     +   SA +L   FWG ++LGRF +I +S   R + ++ I+ VG+    +ML+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A +GE    ++ G +        F V  VI
Sbjct:    9 ELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMGCIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLS--EANCFPANNTANATSRSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSKERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAPCSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKP-LSIGHKSAGYLPSLFWGFITLGRFISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAYTEDILQYKGCATTVLVTGAGIGEMVLQMLVGLIFQAQGSYSFLVCGVI 468          
BLAST of Major facilitator superfamily domain-containing 4 vs. UniProt/SwissProt
Match: sp|Q7SXB7|MFD4A_DANRE (Major facilitator superfamily domain-containing protein 4A OS=Danio rerio OX=7955 GN=mfsd4a PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.654e-35
Identity = 121/482 (25.10%), Postives = 227/482 (47.10%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVM-IARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS---------EMNIEASDRYYNNQIKI-----------LSYPFWIIGSIEL----LLFVLLFHIYRLMQKQNINFK----EINKTTPKQMSDAVDSVATKPKSKTN---LTC--------------GIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEK 1531
            ++F+ N   +L Y+  F  FG+C+  +GP++  L+CQ  ++   +T+V+F Q   + + +   G   K +      +    +++   + ++ + R   +LA  +   G  MG ID+++N+ LV +Y+++   F+Q +HF  G GAL++ L  DPFL    T+C I +         ++  + + R+ +N   +           +SY FWI+  I L     +FVL++     M   + + +    ++    P+  S   +    K  S ++    +C              GI  L G + F  DG+   Y  +VYTYAV +   +L   +A +L   FW  ++ GR +AI +S   +   LLI+  VG+   V++L+     S  L+  TC +GL +S+  P +++L E+ +      TT ++ SA +GE    ++ G++M +     F +  +I   L    F  LY +  +   ++E 
Sbjct:   11 ALFRSNWQHTLTYWSVFFSFGLCVAFLGPTILDLRCQTQSTLQEITLVFFSQQFFLFLGSTIGGFFSKTLVSSLSSLAVSTLIISVVFAIIPLCRELLMLAFAMAVSGLAMGTIDTISNLQLVKIYQKDSTVFLQALHFFVGLGALVSPLIADPFLS--DTSCVIGNSSVNTTSLEDLRNKLAGRHVHNVSNVHLHTDGEVVTNVSYAFWIMAIINLPVPIAIFVLVYRERLFMCGSDPSRRLLDGDVLAIKPRGTSILAEDTGQKETSNSHADLFSCCLLGKAHSFPLSFFGIHVLGGLVLFFSDGIVGSYTGFVYTYAV-APPMNLPHKTAGYLTCIFWAAITTGRLSAIPLSYRFKPVRLLIVSQVGVIVTVLLLLIFSNSSVFLFIGTCCLGLFISSIFPCMLALTEDILEYKGCATTVLVTSAGMGEMVLQVLVGSVMHSRGSFSFLLCGMIFGCLGFTFFTFLYFVQQSHKSYTEA 489          
BLAST of Major facilitator superfamily domain-containing 4 vs. UniProt/SwissProt
Match: sp|Q8N468|MFD4A_HUMAN (Major facilitator superfamily domain-containing protein 4A OS=Homo sapiens OX=9606 GN=MFSD4A PE=2 SV=3)

HSP 1 Score: 143.28 bits (360), Expect = 3.796e-35
Identity = 126/483 (26.09%), Postives = 225/483 (46.58%), Query Frame = 2
Query:  227 IFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS-------------------EMNIEASDRYYNNQI-----------KILSYPFWIIGSIEL---LLFVLLFHIYRLM----QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNL-------TCGIVCLVGC-------------LCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKL 1501
            + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+F Q   +L+ +   G   + + +  + L  + L + +   ++   R   VLA ++   G  MGCID++ N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     NC  A+                   + +++A  + ++NQ              +SY FWI+  I L   +  ++L    RL+    Q++ +           Q  +  D+ +  PK +++L        C    L G              + F+ DG+   Y+++VY+YAV+     +    A +L   FWG ++LGR  +I IS   + + ++ I+ VG+    ++L+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A VGE    ++ G++        F V  VI   L     FT Y L
Sbjct:   10 LLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLS--EANCLPANSTANTTSRGHLFHVSRVLGQHHVDA--KPWSNQTFPGLTPKDGAGTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEK-PLSVGHKVAGYLPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPSMLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLA----FTFYIL 483          
BLAST of Major facilitator superfamily domain-containing 4 vs. UniProt/SwissProt
Match: sp|Q5RCN7|MFD4A_PONAB (Major facilitator superfamily domain-containing protein 4A OS=Pongo abelii OX=9601 GN=MFSD4A PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 8.700e-34
Identity = 123/483 (25.47%), Postives = 223/483 (46.17%), Query Frame = 2
Query:  227 IFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKII-EPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS-------------------EMNIEASDRYYNNQI-----------KILSYPFWIIGSIEL---LLFVLLFHIYRL----MQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN------LTC--------------GIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKL 1501
            + + NL P+L Y+  F  FG+CI  +GP++  L+CQ ++S   ++ V+  Q   +L+ +   G   + + +  + L  + L + +   ++   R   VLA+++   G  MGCID++ N+ LV +Y+++   F+QV+HF  GFGAL++ L  DPFL     NC  A+                   + +++A  + ++NQ              +SY FWI+  I L   +  ++L    RL     Q++ +           Q  +  D+ +  PK +++       +C               I      + F+ DG+   Y+++VY+YAV+     +    A +L   FWG ++LGR  +I IS   + + ++ I+ VG+    ++L+    +   L+  T  +GL LS+T P +++  E+ +      TT ++  A VGE    ++ G++        F V  VI   L     FT Y L
Sbjct:   10 LLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFLSQQLCLLLGSALGGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLALVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLS--EANCLPANSTANTTSRGHLFHVSRVLGQHHVDA--KPWSNQTLPGLTPKDGSGTRVSYAFWIMALINLPVPMAVLMLLSKERLPTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHPGHEDLFSCCQRKNLRGAPYSFFAIHITAALVLFMTDGLTGAYSAFVYSYAVEK-PLSVGHKVAGYLPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPSMLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLA----FTFYIL 483          
BLAST of Major facilitator superfamily domain-containing 4 vs. TrEMBL
Match: A0A1S3I9E4 (major facilitator superfamily domain-containing protein 4A isoform X2 OS=Lingula unguis OX=7574 GN=LOC106162177 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.802e-51
Identity = 142/518 (27.41%), Postives = 254/518 (49.03%), Query Frame = 2
Query:  218 YYSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCT----------------IASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLL----------------FHIYRLMQKQ-----------NINFKEINKTTPKQMSDAVDSVATKPKSKTNLT----CGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEK------YFKTVIDVQNSGE----TIHVKHYSRM 1600
            + S+F++N  P++ Y   F  FGMC+  +GP++  L CQ +   + M+ V+F QL   LI ++A+G LV+ I    +++++ +++  + ++V      S L ++L  MG NMG ID L N+ +++LY   + PF+Q MHF YGFGA ++ +  +PFL  L+ +CT                  ++ ++ A       ++  + Y FW++  ++L + +L+                F   +L   +           N + +   K   K  S         PK++  ++     GI  L   + F+ DG+QS Y  YVY+YA++S    L ++  ++L   FWGT +LGR  +I ++    ++ +LI +  G    +I+++  + +   LY  T   G  LS+  P  ISLAE+FI++    TT II SA++GE  FP+I G +  ++  + F +    + I  +  +  ++  GS T+K+         +    I+   + E       VK+YSRM
Sbjct:   84 FKSLFRQNWHPTIVYCSVFWSFGMCVAFLGPTLLDLGCQTSTDLNHMSWVFFAQLLCTLIGSIAAGYLVRRISTDVIILVSTILIPFSMFVVPFCGVLSTLGVVLALMGLNMGVIDCLANLQMISLYGELVAPFLQAMHFCYGFGAFVSPMIAEPFL--LNEDCTPFIIGVENMTDADGLIPLNDSSLPAHSVSEAQRMTHVKYAFWLMSLVQLPIPLLVCSLVFKDQLCRALRNTFGDSKLFSAESTLSVNHSAAINGDMELEGKGETKFFSQFHHIAGIDPKTEFKISKKEIIGISALTALILFMYDGLQSVYGGYVYSYALKS-IVGLNKTEGAYLNALFWGTFALGRLVSIPLATKFSSAFMLICNISGCVISMILILSLRHNHIALYFGTAFFGAFLSSVAPTTISLAEQFIDINSTITTVIIVSAAMGEMIFPVIVGQMFVDLGPVSFLIFECSICIFSLLVYVAIWMAGSGTSKYKATSGGSFVWCSAHINKHKTHEKGTVKTTVKYYSRM 598          
BLAST of Major facilitator superfamily domain-containing 4 vs. TrEMBL
Match: A0A0B6YKB1 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF28167 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 6.756e-51
Identity = 129/463 (27.86%), Postives = 236/463 (50.97%), Query Frame = 2
Query:  170 TIQFKQHFLSLESRPGYYSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCT-IASEMNIEASDRYYNN----------------------------QIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQM-SDAVDSVATKPKSK-------------TNLTCG-----IVCLVGCLC-FVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTL 1411
            T+  K   +S      ++ +F +N I  + Y   F  FG+C+G +GP++  L CQ ++    M  V+F+QL M L+ ++++G +   +  H L++   + + ++ + + +  + S L  +LI MG+ MGC+D L N+ ++ ++ +N+GPF+Q +H  YG GA ++ +    FL  L+ +CT       IEA   +YN+                             +  L   F+I+G ++L +  L+   Y + Q++      + K  P+ + +D  D+  + P +K             T   CG     +V L+ C   FV DG+QS + +Y+YTYA +SG   LE+   + L   FWG  + GR  A+ ++     S +L+I+ +G   G+++ +  +    ++Y  TC +GL +S+ +P V+S+AE+FI++    TT ++  A++GEA  P+I G L
Sbjct:   59 TVHMKDETIS------FWKLFLDNWIYVVTYCSVFGSFGVCVGFLGPTVFDLGCQTHSDLKKMNWVFFVQLIMTLVGSISAGCMADRVPVHSLMLCGAVGVSLSMFFIPVCDNLSSLIFVLIVMGWCMGCLDCLANLQIIQMFGKNVGPFLQAIHCSYGIGAFVSPMIASAFL--LNKDCTPYIDGFTIEAPTYHYNHDSHNGSTDHTDTMTVHVPPQPQRVFRYRHMSKLPNAFYILGGLQLSIAALV--AYVIFQEK------LGKLKPRNVPTDHHDNSHSFPGAKGFKVNKLGGWLRDTCCACGPREVIVVTLLTCFSLFVFDGLQSSFANYIYTYAHESGVKGLEKYEGAILDACFWGLFAAGRLIAVPVASRFTASFMLVINIIGCSVGLLITIIFRWSHIVIYIGTCSVGLFVSSMSPTVMSMAEQFIDINPSITTCLVVVAALGEALCPVIVGNL 505          
BLAST of Major facilitator superfamily domain-containing 4 vs. TrEMBL
Match: A0A1S3I983 (major facilitator superfamily domain-containing protein 4A isoform X1 OS=Lingula unguis OX=7574 GN=LOC106162177 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.235e-49
Identity = 143/523 (27.34%), Postives = 256/523 (48.95%), Query Frame = 2
Query:  218 YYSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKI--IEP---HFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCT----------------IASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLL----------------FHIYRLMQKQ-----------NINFKEINKTTPKQMSDAVDSVATKPKSKTNLT----CGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEK------YFKTVIDVQNSGE----TIHVKHYSRM 1600
            + S+F++N  P++ Y   F  FGMC+  +GP++  L CQ +   + M+ V+F QL   LI ++A+G LV+   I+P     +++++ +++  + ++V      S L ++L  MG NMG ID L N+ +++LY   + PF+Q MHF YGFGA ++ +  +PFL  L+ +CT                  ++ ++ A       ++  + Y FW++  ++L + +L+                F   +L   +           N + +   K   K  S         PK++  ++     GI  L   + F+ DG+QS Y  YVY+YA++S    L ++  ++L   FWGT +LGR  +I ++    ++ +LI +  G    +I+++  + +   LY  T   G  LS+  P  ISLAE+FI++    TT II SA++GE  FP+I G +  ++  + F +    + I  +  +  ++  GS T+K+         +    I+   + E       VK+YSRM
Sbjct:   84 FKSLFRQNWHPTIVYCSVFWSFGMCVAFLGPTLLDLGCQTSTDLNHMSWVFFAQLLCTLIGSIAAGYLVRSCEIDPISTDVIILVSTILIPFSMFVVPFCGVLSTLGVVLALMGLNMGVIDCLANLQMISLYGELVAPFLQAMHFCYGFGAFVSPMIAEPFL--LNEDCTPFIIGVENMTDADGLIPLNDSSLPAHSVSEAQRMTHVKYAFWLMSLVQLPIPLLVCSLVFKDQLCRALRNTFGDSKLFSAESTLSVNHSAAINGDMELEGKGETKFFSQFHHIAGIDPKTEFKISKKEIIGISALTALILFMYDGLQSVYGGYVYSYALKS-IVGLNKTEGAYLNALFWGTFALGRLVSIPLATKFSSAFMLICNISGCVISMILILSLRHNHIALYFGTAFFGAFLSSVAPTTISLAEQFIDINSTITTVIIVSAAMGEMIFPVIVGQMFVDLGPVSFLIFECSICIFSLLVYVAIWMAGSGTSKYKATSGGSFVWCSAHINKHKTHEKGTVKTTVKYYSRM 603          
BLAST of Major facilitator superfamily domain-containing 4 vs. TrEMBL
Match: A0A4Y2F1A7 (Major facilitator superfamily domain-containing protein 4A OS=Araneus ventricosus OX=182803 GN=Mfsd4a_1 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 6.275e-46
Identity = 123/463 (26.57%), Postives = 230/463 (49.68%), Query Frame = 2
Query:  218 YYSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFL------QFLSTNCTIASEMN--IEASDRYYNNQIKILSYPFWIIG----SIELLLFVLLFHIY--RLM--------QKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFK 1540
            Y  +F E+   +L     F  FG C+  +GP++  L C+      +M+ V+F Q   +L+ +  +G ++K      +L++   M+ +    + +  +   LA++L  MGF MG ID++ NV ++ +Y + + PF+Q +HF YG GA ++ +   PFL       F+S       + N  + A+      ++  + Y F+I+      + LL F LL   Y  RL+        +KQ+ +++ +     +  SD V      PKS   +   +  L   L F+ DG+Q+ Y  Y+Y+YAV+ G     +S A++L   FWG  + GR  +I ++     S +L  + +G   G+++++  + +  +L   TC++G+ +S+  P  +SL E++I++T   T+ ++F A++GE   P+I G          F V  ++L  + +  + TL+ +G T  K    +F 
Sbjct:   43 YRDLFWEHKHTTLTMCFVFWSFGTCVAFLGPTLLDLGCKTGTVFPTMSWVFFSQSLFILLGSACAGFMLKKFSRESMLIVGTSMMTLTMASIPMCNALWALAVVLAVMGFFMGTIDTVANVSMICIYGKYVSPFLQAIHFFYGVGAFLSPMIAQPFLLNEDCSPFISNETFFVEDTNETLPAASLEEAREMTHIDYAFFIMALTMVPVVLLTFTLLSRKYCLRLLGGAPPDTEEKQSKDYETMEDGDSRSDSDRV------PKSIAQIVL-VTALSAILMFLYDGLQAAYGGYIYSYAVK-GPVKFHKSDAAYLNALFWGMFAAGRLLSIALATRLSPSFMLFCNIIGCTAGLLLMLALRYNHIMLIIGTCLLGIFMSSVFPTTLSLTEQYIHVTPSTTSVLVFGAALGEMSMPVIVGHEFGRAGPTSFLVIGMVLCFISIIAYMTLWLVGLTLLKPDSNWFS 497          
BLAST of Major facilitator superfamily domain-containing 4 vs. TrEMBL
Match: A0A087TAT6 (Major facilitator superfamily domain-containing protein 4 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_23128 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.482e-45
Identity = 127/498 (25.50%), Postives = 245/498 (49.20%), Query Frame = 2
Query:  209 RPGYYSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCT----------IASEMN--IEASDRYYNNQIKILSYPFWIIGSIELLLFVLLF------HIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLC-FVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTK---------FSEKYFK-TVIDVQNSGETI---HVKHYSRMDS 1606
            R  Y+ +F E+   ++     F  FG C+  +GP++  L C+     S+M+ V+F Q   +L+ +  +G ++K      +L++   M+ ++   + +  +   LAI+L  MGF MG ID++ NV ++ +Y +++ PF+Q +HF YG GA ++ +   PFL  L+ +C+             E N    A+       +  + Y F I+    + +  L F      H  RL+     + +       + M ++     +    ++     IV ++  L  F+ DG+Q+ Y  ++Y+YAV+ G T   +S A++L   FWG  + GR  +I ++     S +L  + +G   G+++++  +    +L   TC++G+ +S+  P  +SL E++I++T   T+F++F A++GE   P+I G   D      F V  ++L  + +  + +L+ +G T  K         F  KY   TV  ++    ++   +V++YSRM +
Sbjct:   41 REHYWELFWEHKHTTVTLCFVFWSFGTCVAFLGPTLLDLGCKTGTVFSTMSWVFFSQSLFILLGSACAGFMLKRFSADMMLLVGTTMMTVSMASIPLCDALWALAIVLAVMGFFMGTIDTVANVSMICIYGKDVSPFLQAIHFFYGVGAFLSPMIAQPFL--LNEDCSPFIFNNTEPLFPEEQNETQPAATLEEARSMTHIDYAFLIMALTMVPVVALAFSLVGKKHCLRLLGGDTHDLEGKLSKEYQNMGESEAHCGSDRVIRSQFQVTIVTVLSALLMFLYDGLQAAYGGFIYSYAVK-GPTKFRKSDAAYLNALFWGMFATGRLLSIALATKLSPSFMLFCNIIGCSAGLLLMLALRYSHVMLIVGTCMLGIFMSSVFPTALSLTEQYIHVTPATTSFLVFGAALGEMSMPVIVGHAFDMSGPASFLVTGMVLCFISIIVYMSLWLVGLTLLKPDSTPGIMVFFAKYMPGTVQKMEGENTSLVNQNVQYYSRMHT 535          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Cavefish
Match: mfsd4aa (major facilitator superfamily domain-containing protein 4A-like [Source:NCBI gene;Acc:103042703])

HSP 1 Score: 150.599 bits (379), Expect = 1.681e-38
Identity = 123/501 (24.55%), Postives = 227/501 (45.31%), Query Frame = 2
Query:  221 YSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTY-LVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIA-SEMNIEASDRYYNNQ--------------------IKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPK-----------------QMSDAVDSVATKPKSKTN-LTC--------------GIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQN 1561
            +++F+ +   +L Y+  F  FG+C+ ++GP++  L+CQ  AS   + +V+F Q   + + +   G   K +      + +C  ++   +  + I R+  +LA+ +   G  MG ID+++N+ LV LY+++   F+Q +HF  G GAL++ L  DPFL    T+C +  + +N   + R+  N+                    +  +SY FWI+  I L + +    +  LM ++ I     ++ +P+                 + +D        P   TN + C              GI    G + F  DG+   Y  +VYTYAV S  + L    A +L   FW ++++GR A+I +S   +   LLI + VG+   + +L+     S  L+  TC +GL +S+  P +++  E+ ++     TT ++  A +GE    L+ GT++++     F V       +    F  L  +  T  K++     T    +N
Sbjct:   22 WALFRSHWQHTLTYWSGFFSFGLCLALLGPTVLDLRCQTQASLQGIIVVFFAQQFCLFVGSSVGGFFSKSLTCSLSSLASCTFIISVVFAFIPICRNLPMLAVAMAITGLAMGVIDTISNLQLVKLYQKDSTVFLQALHFFVGLGALLSPLIADPFLS--ETDCVLGNTTINSSTTMRHLRNKLAGRHVYNVSHIQLHTEGEVVTNVSYAFWIMALINLPVPIA---VMVLMYRERI-LTCCSERSPRLLDGDTQMCTVKTQHGLEQTDVSSQGYPDPTDNTNMMNCCHLSKLKELPLSFFGIHIFGGLVLFFSDGIVGSYTGFVYTYAVASPMS-LPHKMAGYLTSVFWASITVGRLASIPLSYRIKPVRLLIFNQVGVIVTLFLLLIFFQSSVFLFIGTCFLGLFISSIYPCMLAFTEDMLDYRGCATTVLVTFAGMGEMLLQLLAGTVINSYGSYSFLVCGSTFGCIGFTIFLVLLLVNHTHKKYTTAVTNTAAVAEN 515          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Cavefish
Match: mfsd4ab (major facilitator superfamily domain-containing protein 4B [Source:NCBI gene;Acc:103022668])

HSP 1 Score: 131.339 bits (329), Expect = 2.423e-31
Identity = 118/451 (26.16%), Postives = 210/451 (46.56%), Query Frame = 2
Query:  227 IFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTY-LVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFL--QFLSTNCTIASEMNIEASDRY-----YNNQIKI--------------LSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTN-----------LTC--------------GIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVF 1438
            +FK+N   +L Y+  F  FG+CI  +GP++  L+CQ N++   +T V+F Q   +LI +   G   K +      ++   +++   + ++ +  +  +LA+ +   G  MG ID++ N+ LV+LY+++   F+Q +HF  GFGAL++ L  DPFL      TN T   E  I    R+     + + I +              +S+ FWI+  I L + + +F    LM K+ +     N ++     D +      P++               +C              G+  L G + F+ DG+   Y  + YTYAV S    L   +A +L   FW  ++ GR  +I ++   R   LLII   G+   V++L+     S  L+  TC++GL LS+  P +++  E+ ++     TT ++ SA +GE    ++ G+++       F
Sbjct:   10 LFKQNCQHTLTYWSVFFSFGLCIAFLGPTVLDLKCQTNSTLQEITWVFFSQQFCLLIGSSIGGVFKKTLFSALAALLLSSLVISLVFAIIPLCYNVLLLAVAMAVSGLAMGIIDTIANIQLVSLYQKDSAIFLQALHFFIGFGALVSPLIADPFLAEHCPGTNST-EDEAVIMHHVRHSMAAAFRSSIPLNYSQHLGPITGQSSVSFAFWIMALINLPVPIAVF---VLMYKEKLIPFCYNGSSHLLEKDELAMETRTPETAEASEHDAGGHGDLFSCCMNSNFRELPASFFGVHILGGIVLFMTDGIVGAYAGFAYTYAV-SPPMLLHHKTAGYLPCVFWAAITGGRLLSIPLAYRLRPVYLLIISLAGVIVTVLLLLIFYTSSLFLFIGTCLLGLFLSSIFPCMLAYTEDILDYQGCATTVLVTSAGMGEMVLQVLVGSIIQTTGSYSF 455          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Cavefish
Match: mfsd4b (major facilitator superfamily domain containing 4B [Source:NCBI gene;Acc:100037368])

HSP 1 Score: 110.923 bits (276), Expect = 3.864e-25
Identity = 99/451 (21.95%), Postives = 200/451 (44.35%), Query Frame = 2
Query:  269 SFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILS----------------YPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNV-SQIVFPVGNVILVILIMGNFFTLYKLGST-TTKFSEKYFKTVIDVQNSG 1567
            SF   GMCI ++GP++  L   +N + S+++ ++  +    +  +L  G L   + PH LL  + L+     + +   +   +L +++ ++G  MG +D+  NVL++N +    GP +Q +HF +  GA ++     P +  +       S+ N   +     N  K ++                + + +IG+  ++L  +LF I  L  +   + ++ + T+ KQ+            +K ++   ++ L+    F   G +  Y S+++ YA    +  + ++ A+ +   FWG+ +  R  AII +       ++++  VG     ++LV    H   L+  T + G +++ T P  IS  E++  +T       +  A++GE   P   G L+D V  Q V     ++   +    F  +YKL S       E   + ++D + SG
Sbjct:   59 SFLGLGMCISVLGPTLEDLAKNVNKNISNISYIFAGRATGYIGGSLLGGILFDFVNPHLLLGFSMLVTSFGMFAIPFCKKALILTVLVSSVGVTMGILDTGGNVLILNTWGDQSGPHMQALHFTFAAGAFVS-----PIVAKMLFGHEPVSDQNASVTVEAATNNSKAVTSVLHFFHSKGFVQMSMWAYIVIGAF-VMLASMLFFI--LCSRSPSSAEKTSSTSGKQL-----------IAKHHMV--LIVLLSLFFFWYVGAEVAYGSFIFNYA--KNYVGMSQTQAAGMNSLFWGSFAAFRGLAIIFAACVYPGTMILLSLVGCTISALLLVLFSRHEVALWCCTALYGASMATTFPSGISWVEQYTVVTGRSAAAFVVGAALGEMVLPASVGFLLDRVKDQPVLMYLALMTATVTSILFPVMYKLASPGRGDADESDRQALLDSEESG 486          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Nematostella
Match: EDO45309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ5])

HSP 1 Score: 111.309 bits (277), Expect = 4.902e-26
Identity = 111/468 (23.72%), Postives = 202/468 (43.16%), Query Frame = 2
Query:  251 SLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLML--VINTYLVMIARSTSVLAIILIA---MGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQ--------------FLSTNCTIASEM------------NIEASDRYYNNQIK-----ILSYPFWIIGSIEL----LLFVLLFHIYRLMQKQNINF--KEIN-KTTPKQMSDAVDSVA-----------TKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTL 1492
            +L Y  +F  FGM   ++GP++  L C  +   +SM  ++F Q    L  +  SG    I+    +  I CL     +  Y + +    S   ++L     +G NMG ID++ N +L+ ++ R      + +HF YG GAL++ +  +PFL+              +   N T+  ++             +  + + +   IK      + Y FW + S+++     LF L+F   ++ +   + F  + +N   T +Q +D    V              P S+         L   L F L G    Y  Y+YTYAV+S       S  ++L   FW   ++GRF +I +S++ +   +L+ +  G F  + ++     +   L+  +   GL +S+  P  ++LAE  I++T   T+ +I S++ GE   PL+ G        + F V   I+ +  + N+  L
Sbjct:   15 TLCYCGAFLTFGMAAAVIGPTLLELGCVTSRPVNSMGWIFFSQALSALFGSSISG----IMADSCVRDILCLFTETTVTQYCLTVIPLCSQFQLMLSVFAFLGVNMGIIDTVANSVLIKIHGR------KALHFFYGLGALMSPVISEPFLRDSCKGVHFKKNIFGWTLENSTLVEDLLEELIVHGGNFSQLNITGQQFTTSIKAHAPSFVQYAFWSVASLQIPVQAALFYLIFKQRQVRRNSPVMFIGRVVNIALTGRQTADTEGKVTKLLNSVYRGRINTPPSQPLYVFACAALRWLLDFCLQG---AYGGYLYTYAVKS-EVHFTPSHGAYLTSLFWCLFAVGRFISIFVSMFVKPDKMLLANLTGCFVSMSIMFYCHPYPMSLWIGSSAFGLFMSSVFPSTLTLAEHCIDVTGSITSILIVSSASGEMLIPLLVGKEFTREGPLSFLVIGFIVCVFALINYLVL 468          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Nematostella
Match: EDO45308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ4])

HSP 1 Score: 105.145 bits (261), Expect = 1.478e-23
Identity = 111/473 (23.47%), Postives = 198/473 (41.86%), Query Frame = 2
Query:  107 LVVFIHQ---IFLSIFGHLFQMGNTIQFKQHFLSLESRPGYYSIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAM--------------GFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQ----FLSTNCTIASEMNIEASDRYYNNQIKI------------LSYPFWIIGSIEL-LLFVLLFHIY-RLMQK-------QNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCG---------IVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSAS 1372
            L+ FIH    +F S  G LF     +  K   ++L        ++   L+P  F   +  L   C   + PSMPH         + +       L  M       G    ++   F  V++  M   N  L+ IA   S + II I +              G   G  D+     L+ ++ + + P++Q +HF YG G  IT L   PFL+    ++    TI  E     S    +N   +            + + +WI+    L ++F LL+ ++ R ++K       Q+++       +    +  + ++    +S      G         +  L   +  + DG+ + + +YVY+YAV+ G   +    A++L   FWG LS+GRF AI I+L+ +   +++ID +G       ++  +     L+  T  +GL +S+  P  I+LAE +I++T   T+ +I SA+
Sbjct:   87 LLFFIHDLCNVFGSTTGGLFADRRFVAMKTGVMNL--------VWDRGLLPRPFAIHATPLCHPCHTPL-PSMPH---PFAIHATPLCHPCHTPLPSMPHPFAIPGTFSFVLRAEFSTVLSSHMFNAN-LLLSIALGVSAVCIIAIPLCRVFVLMLILAGIYGACFGATDTFTTFQLIRMFGKQVSPYLQALHFTYGLGGFITPLVARPFLRDECVYIVNYTTIVDEWPYANSTSGIDNTSTVFFSQESVYRDSHVRWAYWIVALCHLPVIFGLLWLLFTRKLEKLKSTGATQDLSVYGSQTMSNPGYNHHIVALYLNGRSPWLRVFGEDQKPRVIVVTVLTSLILLLYDGLMATFGAYVYSYAVR-GAVHMRTDHAAYLNSLFWGALSVGRFLAIGIALYLKPPTMMMIDLIGCLCCAFYMLVMEHSETALWLGTAGVGLFMSSVFPTCIALAEYYIDMTAPVTSVMIMSAA 545          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Nematostella
Match: EDO40861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S621])

HSP 1 Score: 90.5077 bits (223), Expect = 1.573e-19
Identity = 89/390 (22.82%), Postives = 179/390 (45.90%), Query Frame = 2
Query:  284 GMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIA--MGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLS-TNCTIASEMN-IEASDRYYNNQI---KILSYPF---WIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLV------CGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFG 1405
            G+   + GPS+  L  +  +    M+ V+  +    LI ++A G L   ++ +  LVI  + L+   + +++    ++  +I +A       G +D+  N L++ L+  + GP++Q++HF +  G+  + L + PFL   S TN  I S  N    S     N +    I + P    +IIGS   L   ++F  +   +     + +  K            VA+  +S       I+ +   L  +  GM++ Y  +++T+AV++    + +SSA+ L   +WG+ +  R  ++ ++ + +   ++I D +G      +LV      C       L+  T I+G++ ++  P  +S AE F++++    +  +  A VG+   PL+ G
Sbjct:    1 GITSALFGPSLFDLAYKTRSQIHDMSFVFTARSVGYLIGSVAGGWLYDKLDGY--LVIGLVSLLGALFSIVMPLVGNIYGLIFVACLASIGNGALDTDGNALMLLLWPGH-GPYMQLLHFTFAVGSFFSPLLVKPFLLPDSITNPDIYSPTNNTSGSLNVTGNSVTEHSIGAIPLTWAYIIGSFPQLAAGVVFLCFAFFKSCKEEYVKKEKRI----------VASSGQSGAVYKAVILTMFFFLFLLYVGMETGYGGFIFTFAVKA-KPSMTKSSAANLNSGYWGSFAFARLLSVPLAKYVKPGHMIIGDFIGTTIAAGILVSMSSQGCDAASIPRLWAGTIILGMSAASVFPAALSWAELFLDVSGKTASVFLVGACVGDMAVPLLVG 376          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Medaka
Match: mfsd4ab (major facilitator superfamily domain-containing protein 4B [Source:NCBI gene;Acc:101167709])

HSP 1 Score: 154.451 bits (389), Expect = 6.633e-40
Identity = 123/452 (27.21%), Postives = 210/452 (46.46%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVK-IIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNC--------------------TIASEMNIEASD-RYYNNQIKILSYPFWIIGSIEL-LLFVLLFHIY-------------RLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVC-----------------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDN 1420
            ++FK N   +L Y+  F  FG+CI  +GP++  LQCQ N++ S +T V+F Q   +LI +   G   K +      L ++ LM+ +   ++ +  +  VLAI +   G  MG ID++ N+ LV +Y+++   F+Q +HF  GFGAL++ L  DPFL    T C                    +  +E NI  +D  +  N+   + Y FWI+  I L +   +LF IY             RL+ K  +  +       +Q ++  DS  T+     +      C                 L G + F+ DG+   Y  +VYTYAV +    L   +A +L   FW  ++ GR  +I +S   +   LL+ +  G    V+ML+     S  L+  TC+ GL LS+  P +++  E+ ++     T+ ++  A +GE    ++ G+++ +
Sbjct:    9 TLFKRNAHHTLTYWSLFFSFGLCIAFLGPTILDLQCQTNSTLSQITWVFFAQQFCLLIGSSIGGVFRKTLFSALAALCVSALMISVIFAIIPLCNNVLVLAIAMAVSGLAMGIIDTIANIQLVTIYQKDSAVFLQALHFFIGFGALVSPLIADPFLS--ETGCGNLTENGTEIMHHFRNMLRNSPIAEHNINQTDLPHEANEGSTVHYAFWIMAIINLPVPIAVLFLIYREQLIPCCPGGTPRLLDKDELAMEN------QQQAEGPDSEQTEHDVGGHGNIFSCCQNDNMRGLPVSFFMIHILGGMVLFMTDGIVGAYAGFVYTYAV-APPMSLPNKTAGYLASIFWAAITAGRLLSIPLSYRFQPGRLLMFNLAGAIVTVLMLLIFYTSSVFLFVGTCLCGLFLSSIFPCMLAYTEDILDYQGCATSVLVTCAGMGEMVMQVLVGSIIQS 451          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Medaka
Match: mfsd4ab (major facilitator superfamily domain-containing protein 4B [Source:NCBI gene;Acc:101167709])

HSP 1 Score: 154.451 bits (389), Expect = 1.265e-39
Identity = 123/452 (27.21%), Postives = 210/452 (46.46%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVK-IIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNC--------------------TIASEMNIEASD-RYYNNQIKILSYPFWIIGSIEL-LLFVLLFHIY-------------RLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVC-----------------LVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDN 1420
            ++FK N   +L Y+  F  FG+CI  +GP++  LQCQ N++ S +T V+F Q   +LI +   G   K +      L ++ LM+ +   ++ +  +  VLAI +   G  MG ID++ N+ LV +Y+++   F+Q +HF  GFGAL++ L  DPFL    T C                    +  +E NI  +D  +  N+   + Y FWI+  I L +   +LF IY             RL+ K  +  +       +Q ++  DS  T+     +      C                 L G + F+ DG+   Y  +VYTYAV +    L   +A +L   FW  ++ GR  +I +S   +   LL+ +  G    V+ML+     S  L+  TC+ GL LS+  P +++  E+ ++     T+ ++  A +GE    ++ G+++ +
Sbjct:    9 TLFKRNAHHTLTYWSLFFSFGLCIAFLGPTILDLQCQTNSTLSQITWVFFAQQFCLLIGSSIGGVFRKTLFSALAALCVSALMISVIFAIIPLCNNVLVLAIAMAVSGLAMGIIDTIANIQLVTIYQKDSAVFLQALHFFIGFGALVSPLIADPFLS--ETGCGNLTENGTEIMHHFRNMLRNSPIAEHNINQTDLPHEANEGSTVHYAFWIMAIINLPVPIAVLFLIYREQLIPCCPGGTPRLLDKDELAMEN------QQQAEGPDSEQTEHDVGGHGNIFSCCQNDNMRGLPVSFFMIHILGGMVLFMTDGIVGAYAGFVYTYAV-APPMSLPNKTAGYLASIFWAAITAGRLLSIPLSYRFQPGRLLMFNLAGAIVTVLMLLIFYTSSVFLFVGTCLCGLFLSSIFPCMLAYTEDILDYQGCATSVLVTCAGMGEMVMQVLVGSIIQS 451          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Medaka
Match: mfsd4aa (major facilitator superfamily domain-containing protein 4A-like [Source:NCBI gene;Acc:101174826])

HSP 1 Score: 148.288 bits (373), Expect = 7.634e-38
Identity = 124/450 (27.56%), Postives = 213/450 (47.33%), Query Frame = 2
Query:  224 SIFKENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFN---MGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQ----FLSTNCTIASEMNIEA--------------SDRYY----NNQIKILSYPFWIIGSIEL----LLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSV----------ATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVI 1456
            S+FK +L  +L Y+  F  FG+CI  +GP++  L+CQ  ++   +T V+F Q   +L+ +  +G   K +    L +  C  LVI+     I     ++ ++ IAMG     MG ID++ N+ LV LY+++   F+Q +HF  G GAL++ L  DPFL      L  N T  S  ++E               + +Y+       +  +SY FWI+  I L     + +L+FH  RL+   + + + + K  PK      D            + + + +   T  I  L   + F+ DG+   Y  ++YTYAV S    + R +A  L   FW +++ GR A I +S       LL I  VG+     +++        L+  TC++GL +S+  P +++  E+ ++     TT ++ SAS GE    L+ G+++ +     F + + I
Sbjct:   10 SLFKHHLQQTLTYWSVFFSFGLCIAFLGPTILDLRCQTQSTLQEITWVFFSQQFFLLVGSCVAGLFKKTLLSSLLALFFC-TLVISLVFAFIPFCHHIM-LLSIAMGLAGTAMGIIDTIANLQLVKLYQKDSAVFLQALHFFIGLGALVSPLVADPFLADDSCVLGLNGTSNSSWDLEHLRNTLAGKGVSIHNTSQYHLFTEGIVVTKVSYAFWIMAVINLPVPAAVLMLMFH-ERLLLCSSSSPRLLEKDGPKSRPAEDDGQGHGSVFSCCNSARLEGQPTTTFFIYALGSAIVFITDGIIGCYAGFIYTYAV-SPPLLMGRKAAGCLDSVFWASITAGRLAFIYLSYRYSAPVLLTISLVGVILVQFLMLFFYSSCVFLFICTCVLGLCISSVFPSMLAFTEDTLDYKGCATTVLVTSASAGEMLLQLLVGSVIHSQGSYSFLLSSTI 455          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Medaka
Match: MFSD4B (sodium-dependent glucose transporter 1 [Source:NCBI gene;Acc:101167758])

HSP 1 Score: 100.138 bits (248), Expect = 1.422e-21
Identity = 96/435 (22.07%), Postives = 192/435 (44.14%), Query Frame = 2
Query:  269 SFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQL-------SIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILS-YPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFT------LYKLGSTTTKFSEK 1531
            SF   GM I ++GP+   L   +  + S+++ ++  + G  +  +L  G L   + PH LL  + ++  +  Y +   +  ++L   + ++G +MG +D+  NVL++N +    GP +Q +HF +  GA ++ +       S D   Q L+    +       A +  +N +  + S + + +IGS   L+ VL F +Y    +      + +  + KQ+            +K +L    +  +    +V  G +  Y S+++T+A    H  +  + A+ L   FWGT +  R  AI  +       ++++  +G     ++L     H   L+  T + G +++ T P  IS  E++  +T       +  A++GE   P + G L+       FP   +++ + ++ + FT      +YKL S       K
Sbjct:   84 SFLGLGMSISVLGPTFEDLALNVKKNISNISYIFIGRSGGYIGGSLIGGVLFDCMNPHLLLGFSMILTALGMYAIPFCKQAALLTAFMSSIGVSMGVLDTGGNVLILNTWGDQAGPHMQALHFSFAAGAFVSPIIAKLLFGSDDKGTQLLNATLPVT---KAPAPETAFNLKSSLKSMWAYIVIGSFLFLVSVLFFLLY---SRCGTVKDQSHSGSGKQLV-----------AKHHLALVFLLFLFFFAYV--GAEVAYGSFIFTFAKDFSH--MPEAQAAGLNSLFWGTFAAIRGFAIFFATCMYPGTMILLCLLGSTLSSLLLCLFCNHKVALWVCTGVYGASMATTFPSGISWLEQYTTITGHTAAVFVVGAALGEMVLPALVGFLLGR-----FPNQPLLMYLSLLTSTFTAIIFPVMYKLASAPGSPRRK 492          
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Medaka
Match: mfsd4b (sodium-dependent glucose transporter 1-like [Source:NCBI gene;Acc:101170320])

HSP 1 Score: 96.6709 bits (239), Expect = 1.430e-20
Identity = 94/430 (21.86%), Postives = 188/430 (43.72%), Query Frame = 2
Query:  284 GMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQL-------SIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILS-YPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFT------LYKLGSTTTKFSEK 1531
            GM I ++GP+   L   +    S+++ ++  + G  +  +L  G L   + PH LL  + ++     Y +   +  ++L   + ++G +MG +D+  NVL++N +    GP +Q +HF +  GA ++ +       S +   Q L+    +       A +  +N +  + S + + +IGS   L+ VL F +Y    +      + +  + KQ+            +K +L    +  +    +V  G +  Y S+++T+A    H  +  + A+ L   FWGT +  R  AI  +       ++++  +G     ++L     H   L+  T + G +++ T P  IS  E++  +T       +  A++GE   P + G L     Q  FP   +++ + ++ + FT      +YKL S       K
Sbjct:   99 GMSISVLGPTFEDLALNVKKDISNISYIFIGRSGGYIGGSLIGGVLFDCMNPHLLLGFSTILTAFGMYAIPFCQQAALLTAFMSSIGVSMGVLDTGGNVLILNTWGDQAGPHMQALHFSFAAGAFVSPVIAKLLFGSDEKGTQLLNATLPVT---KAPAPETAFNLKSSLKSMWAYIVIGSFLFLVSVLFFLLY---SRCGTVKDQSHSGSGKQLV-----------AKHHLALVFLLFLFFFAYV--GAEVAYGSFIFTFAKDFSH--MPEAQAAGLNSLFWGTFAATRGFAIFFATCMYPGTMILLCLLGSTLSSLLLCLFCNHKVALWVCTGVYGASMATTFPSGISWLEQYTTITGHTAAVFVVGAALGEMVLPALVGFL-----QGRFPNQPLLMYLSLLTSTFTAIIFPVMYKLASAPGSPRRK 502          
BLAST of Major facilitator superfamily domain-containing 4 vs. Planmine SMEST
Match: SMESG000038006.1 (SMESG000038006.1)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 442/444 (99.55%), Postives = 443/444 (99.77%), Query Frame = 2
Query:  287 MCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 1618
            MCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS+MNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKE NKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML
Sbjct:    1 MCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASKMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKETNKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 444          
BLAST of Major facilitator superfamily domain-containing 4 vs. Planmine SMEST
Match: SMESG000038006.1 (SMESG000038006.1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 437/439 (99.54%), Postives = 438/439 (99.77%), Query Frame = 2
Query:  302 MGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 1618
            MGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS+MNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKE NKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML
Sbjct:    1 MGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASKMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKETNKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 439          
BLAST of Major facilitator superfamily domain-containing 4 vs. Planmine SMEST
Match: SMESG000038006.1 (SMESG000038006.1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 409/411 (99.51%), Postives = 410/411 (99.76%), Query Frame = 2
Query:  386 MMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 1618
            MMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS+MNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKE NKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML
Sbjct:    1 MMLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASKMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKETNKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 411          
BLAST of Major facilitator superfamily domain-containing 4 vs. Planmine SMEST
Match: SMESG000038006.1 (SMESG000038006.1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 408/410 (99.51%), Postives = 409/410 (99.76%), Query Frame = 2
Query:  389 MLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 1618
            MLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIAS+MNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKE NKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML
Sbjct:    1 MLIATLASGKLVKIIEPHFLLVINCLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASKMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKETNKTTPKQMSDAVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGSTTTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML 410          
BLAST of Major facilitator superfamily domain-containing 4 vs. Planmine SMEST
Match: SMESG000015183.1 (SMESG000015183.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.248e-11
Identity = 98/430 (22.79%), Postives = 177/430 (41.16%), Query Frame = 2
Query:  233 KENLIPSLFYFLSFTLFGMCIGIMGPSMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLV-KIIEPHFLLVINCLMLV-INTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYK-RNIGPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNNQIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPK-QMSDAVDSVATKP------------KSKTNLTCG---------IVCLVGCLCF-VLDGMQSEYNSYVYTYAVQSGHTDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGVIMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFIIFSASVGEAFFPLIFGTLMDNVSQIVFPV 1444
            K  LI +   FLS+   G+   I+GP++P L+     +   ++     +   +LI +L  G L  + I+   LL+   L L  I    + + +S  +LA  L   GF+ G   +  N  L  L+K ++ GPF   MH  YG GA +  L I  F +   T+ +  + +   A      N IK+   PF I+G +      L+F +Y  +Q        I  + P  ++S AVD+  T+             + + NL  G         IV  +  + F  L G +  +  + ++YA++ G   + +  A  +   +W +  L R    +++L      LLI +  G     I+         + +  +   G   S   P ++ +   ++ ++      + F ++ G A    + G L+ N     FP+
Sbjct:   40 KYRLIKTFVLFLSWISLGLFSEIIGPALPALRIISGTNHEEISRALSSRAAGLLIGSLIGGVLADQFIKFRNLLIFIFLSLAGITVATIPLCQSLLILAFNLFISGFSHGAFTTSGNPSLGALWKEKSTGPF-NFMHSGYGLGAAVAPLLIKAFDKSNETSFSNVTFLKDSA------NSIKV---PFLIVG-MYCFSIALIFFVYCFLQN------PIGDSAPLCRLSHAVDTKPTETNVIIKNKCFLFVQFRQNLVNGLKNLNRKTIIVMFLSFISFFALVGNERVFGKFQFSYAIE-GLLKMSKDRAYLINCLYWVSFCLARIFIAVLALKIPAKILLISEIFGALISSIIFTIWNQSELVFFIFSTSFGFFKSPLFPTMLGVLSLYVTVSGILVVVVNFGSAAGAACCQYLAGYLIHNYGHYTFPL 451          
The following BLAST results are available for this feature:
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD4A7.904e-3626.09major facilitator superfamily domain containing 4A... [more]
MFSD4A2.798e-3226.00major facilitator superfamily domain containing 4A... [more]
MFSD4A4.128e-2526.41major facilitator superfamily domain containing 4A... [more]
MFSD4A8.077e-2328.44major facilitator superfamily domain containing 4A... [more]
MFSD4B3.110e-2022.89major facilitator superfamily domain containing 4B... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mfsd4aa1.938e-3625.10major facilitator superfamily domain containing 4A... [more]
mfsd4ab4.861e-2924.95major facilitator superfamily domain containing 4A... [more]
mfsd4b2.459e-2224.24major facilitator superfamily domain containing 4B... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mfsd4a1.730e-4027.06major facilitator superfamily domain containing 4A... [more]
pax89.490e-2722.99paired box 8 [Source:Xenbase;Acc:XB-GENE-483693][more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfsd4a6.304e-3826.35major facilitator superfamily domain containing 4A... [more]
Mfsd4a7.410e-3826.35major facilitator superfamily domain containing 4A... [more]
Mfsd4a7.410e-3826.35major facilitator superfamily domain containing 4A... [more]
Mfsd4a7.410e-3826.35major facilitator superfamily domain containing 4A... [more]
Mfsd4a5.370e-3526.60major facilitator superfamily domain containing 4A... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BIZ0|MFD4A_XENTR9.168e-4027.06Major facilitator superfamily domain-containing pr... [more]
sp|Q6PDC8|MFD4A_MOUSE4.410e-3726.35Major facilitator superfamily domain-containing pr... [more]
sp|Q7SXB7|MFD4A_DANRE1.654e-3525.10Major facilitator superfamily domain-containing pr... [more]
sp|Q8N468|MFD4A_HUMAN3.796e-3526.09Major facilitator superfamily domain-containing pr... [more]
sp|Q5RCN7|MFD4A_PONAB8.700e-3425.47Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I9E41.802e-5127.41major facilitator superfamily domain-containing pr... [more]
A0A0B6YKB16.756e-5127.86Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A1S3I9831.235e-4927.34major facilitator superfamily domain-containing pr... [more]
A0A4Y2F1A76.275e-4626.57Major facilitator superfamily domain-containing pr... [more]
A0A087TAT63.482e-4525.50Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mfsd4aa1.681e-3824.55major facilitator superfamily domain-containing pr... [more]
mfsd4ab2.423e-3126.16major facilitator superfamily domain-containing pr... [more]
mfsd4b3.864e-2521.95major facilitator superfamily domain containing 4B... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO453094.902e-2623.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453081.478e-2323.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408611.573e-1922.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd4ab6.633e-4027.21major facilitator superfamily domain-containing pr... [more]
mfsd4ab1.265e-3927.21major facilitator superfamily domain-containing pr... [more]
mfsd4aa7.634e-3827.56major facilitator superfamily domain-containing pr... [more]
MFSD4B1.422e-2122.07sodium-dependent glucose transporter 1 [Source:NCB... [more]
mfsd4b1.430e-2021.86sodium-dependent glucose transporter 1-like [Sourc... [more]
back to top
BLAST of Major facilitator superfamily domain-containing 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038006.10.000e+099.55SMESG000038006.1[more]
SMESG000038006.10.000e+099.54SMESG000038006.1[more]
SMESG000038006.10.000e+099.51SMESG000038006.1[more]
SMESG000038006.10.000e+099.51SMESG000038006.1[more]
SMESG000015183.12.248e-1122.79SMESG000015183.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017286 ID=SMED30017286|Name=Major facilitator superfamily domain-containing 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2023bp
CTAATATTAATTCTGAGATTCCTGTTTGTGTGTTTCTCCCTCAGTTATAG
AGTTCAGTGAAAATTAAAGGTATATTTATGGGTAATGCAGCTCCTTTTGA
TGATTCTTAGTTGTTTTTATCCATCAAATTTTTCTCTCTATTTTTGGACA
TCTTTTTCAAATGGGTAACACAATACAATTTAAACAACATTTTTTATCCT
TGGAAAGTCGACCTGGCTATTATTCAATTTTTAAAGAAAATTTAATTCCA
TCACTTTTTTATTTTCTTTCATTTACGTTATTTGGAATGTGCATCGGGAT
TATGGGGCCATCAATGCCCCATTTACAGTGCCAAATAAATGCTTCCCAAT
CTTCGATGACCATAGTTTATTTTCTGCAGCTAGGAATGATGTTAATTGCT
ACATTAGCATCTGGAAAATTAGTTAAAATAATCGAACCTCATTTTCTATT
GGTCATTAATTGTTTGATGCTTGTCATAAATACTTATCTAGTCATGATCG
CCCGCTCAACATCAGTATTGGCTATCATCCTAATCGCTATGGGATTTAAT
ATGGGATGTATAGATTCATTGAATAATGTTTTGCTGGTTAATCTTTATAA
AAGAAATATTGGTCCATTTATACAGGTAATGCACTTTCTTTATGGATTTG
GAGCTTTGATTACCCAACTGAGCATTGACCCGTTTTTACAATTTTTGTCA
ACTAATTGCACTATTGCATCTGAGATGAATATTGAAGCGAGTGACAGATA
TTATAATAATCAAATTAAAATACTTTCATATCCATTTTGGATAATTGGGT
CCATAGAATTGCTGTTATTTGTGCTTCTTTTCCATATTTATCGGCTGATG
CAGAAACAAAATATCAACTTTAAAGAAATAAATAAAACAACTCCTAAACA
GATGAGCGATGCAGTCGATTCAGTCGCTACTAAACCAAAGTCAAAAACTA
ATTTAACATGTGGAATTGTTTGTCTAGTTGGATGTTTATGTTTCGTTCTA
GATGGAATGCAGTCGGAATATAATAGTTATGTTTATACGTATGCCGTTCA
ATCTGGCCACACGGATTTAGAAAGAAGTTCTGCAAGTTTTCTAGGATTCA
CATTCTGGGGTACTCTGTCTTTGGGTAGGTTTGCTGCAATTATTATTTCT
TTATGGTGCCGAACATCAGCTCTGCTGATTATAGACACAGTGGGCTTGTT
CTTTGGAGTTATTATGCTGGTGTGTGGCCAAGGGCATAGCAACATTTTAT
ATACAGCAACATGTATAATAGGACTGACGTTAAGCAATACGACGCCGGGA
GTAATATCACTAGCCGAGGAGTTCATTAACTTAACTAAGTGGAGGACAAC
ATTTATTATTTTCAGTGCTTCTGTTGGAGAAGCCTTTTTCCCATTGATAT
TTGGCACACTCATGGATAACGTCAGTCAAATTGTATTTCCAGTAGGAAAT
GTCATTTTAGTTATTTTGATTATGGGGAACTTTTTCACATTATACAAATT
AGGATCAACTACGACTAAATTCTCAGAAAAATATTTCAAAACTGTGATTG
ATGTACAAAATTCTGGAGAAACAATTCATGTGAAACACTACTCCCGAATG
GACAGTGTAGAAATGCTATAGTTTCTAGTTATTCTTTCAGCTGCGGATAA
TGAATTATGTAAATTTTATGAATCGCCATCGAATGTCTCAAAGGAAATTT
GAAAATAAAATTAGAAACTAATTAATTAAAACAAAATTCGAACAATATCC
TATGCGAATTTGTTGAATTGTGATTTGATTTTTTCCTAAGATTAGTTTGT
ACTCTTTATAGGTTTCAGTTGAATTGTGCATAATATGTGTTGATATTATT
ATTTATCATATTTTATGTCTTCTTTTTTTCCTTTTCTCTAATAGATGCAA
AAAGTCTTTTAATTGTCGATGGTGAGAATTCAATCTGGGTTTGTTGATTT
TTAATATATTGTTATTAGGATTCTTAAATTTAAATTTAAATTATTTGTAT
GAATGAAATTAGTTTAGTAAAAC
back to top

protein sequence of SMED30017286-orf-1

>SMED30017286-orf-1 ID=SMED30017286-orf-1|Name=SMED30017286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MGNTIQFKQHFLSLESRPGYYSIFKENLIPSLFYFLSFTLFGMCIGIMGP
SMPHLQCQINASQSSMTIVYFLQLGMMLIATLASGKLVKIIEPHFLLVIN
CLMLVINTYLVMIARSTSVLAIILIAMGFNMGCIDSLNNVLLVNLYKRNI
GPFIQVMHFLYGFGALITQLSIDPFLQFLSTNCTIASEMNIEASDRYYNN
QIKILSYPFWIIGSIELLLFVLLFHIYRLMQKQNINFKEINKTTPKQMSD
AVDSVATKPKSKTNLTCGIVCLVGCLCFVLDGMQSEYNSYVYTYAVQSGH
TDLERSSASFLGFTFWGTLSLGRFAAIIISLWCRTSALLIIDTVGLFFGV
IMLVCGQGHSNILYTATCIIGLTLSNTTPGVISLAEEFINLTKWRTTFII
FSASVGEAFFPLIFGTLMDNVSQIVFPVGNVILVILIMGNFFTLYKLGST
TTKFSEKYFKTVIDVQNSGETIHVKHYSRMDSVEML*
back to top

protein sequence of SMED30017286-orf-2

>SMED30017286-orf-2 ID=SMED30017286-orf-2|Name=SMED30017286-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MSVPNINGKKASPTEALKIINVVLHLVKLMNSSASDITPGVVLLNVSPII
HVAVYKMLLCPWPHTSIITPKNKPTVSIISRADVRHHKEIIIAANLPKDR
VPQNVNPRKLAELLSKSVWPD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 26..236
e-value: 2.4E-15
score: 58.3
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 260..447
e-value: 9.3E-18
score: 66.1
NoneNo IPR availablePANTHERPTHR23121FAMILY NOT NAMEDcoord: 24..466
NoneNo IPR availableCDDcd17395MFS_MFSD4coord: 34..447
e-value: 5.59697E-47
score: 165.005
NoneNo IPR availableTMHMMTMhelixcoord: 423..445
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 150..172
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 396..418
NoneNo IPR availableTMHMMTMhelixcoord: 336..358
NoneNo IPR availableTMHMMTMhelixcoord: 121..143
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 32..444