nuclear factor Y complex B2

Overview
Namenuclear factor Y complex B2 (AKG62117.1)
Smed IDSMED30017282
Length (bp)897
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear factor Y complex B2 (SMED30017282) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear factor Y complex B2 (SMED30017282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear factor Y complex B2 (SMED30017282) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear factor Y complex B2 (SMED30017282) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017282SMESG000040141.1 KU366700smed_ncbi_20200123PMID:27304889
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
headSMED30017282SMESG000040141.1 KU366700smed_ncbi_20200123PMID:27304889
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory regionSMED30017282SMESG000040141.1 KU366700smed_ncbi_20200123PMID:27304889
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
X1 cellSMED30017282SMESG000040141.1 SmedASXL_005154SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017282SMESG000040141.1 SmedASXL_005154SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30017282SMESG000040141.1 SMESG000040140.1 dd_Smed_v4_2532_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear factor Y complex B2 vs. Ensembl Human
Match: NFYB (nuclear transcription factor Y subunit beta [Source:HGNC Symbol;Acc:HGNC:7805])

HSP 1 Score: 152.525 bits (384), Expect = 9.212e-45
Identity = 68/100 (68.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   52 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y complex B2 vs. Ensembl Human
Match: NFYB (nuclear transcription factor Y subunit beta [Source:HGNC Symbol;Acc:HGNC:7805])

HSP 1 Score: 152.525 bits (384), Expect = 9.212e-45
Identity = 68/100 (68.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   52 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y complex B2 vs. Ensembl Human
Match: NFYB (nuclear transcription factor Y subunit beta [Source:HGNC Symbol;Acc:HGNC:7805])

HSP 1 Score: 152.14 bits (383), Expect = 1.126e-44
Identity = 68/100 (68.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   53 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 152          
BLAST of nuclear factor Y complex B2 vs. Ensembl Human
Match: POLE3 (DNA polymerase epsilon 3, accessory subunit [Source:HGNC Symbol;Acc:HGNC:13546])

HSP 1 Score: 63.5438 bits (153), Expect = 8.213e-12
Identity = 35/94 (37.23%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            R +D  LP A +++I+K+A+P    ISKEA+  +    S ++ + TS A     + KRKT+N  D+L AM  + F++ V PL+  L  YR   K
Sbjct:    4 RPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Human
Match: POLE3 (DNA polymerase epsilon 3, accessory subunit [Source:HGNC Symbol;Acc:HGNC:13546])

HSP 1 Score: 63.5438 bits (153), Expect = 8.213e-12
Identity = 35/94 (37.23%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            R +D  LP A +++I+K+A+P    ISKEA+  +    S ++ + TS A     + KRKT+N  D+L AM  + F++ V PL+  L  YR   K
Sbjct:    4 RPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Celegans
Match: nfyb-1 (Nuclear transcription Factor Y, B (Beta) subunit [Source:UniProtKB/TrEMBL;Acc:A0A0M7RFF4])

HSP 1 Score: 120.553 bits (301), Expect = 3.361e-31
Identity = 57/100 (57.00%), Postives = 72/100 (72.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            L +Q+RFLPIANV +IMK  +    K++K+AKE  QECVSE+ISFI SEAAE C   KRKTI  +DLL AM   GF+   EP+R+FL KYR+A+K+   I
Sbjct:   59 LLDQERFLPIANVVRIMKTQMDPQAKLAKDAKECAQECVSEFISFIASEAAEICNITKRKTITADDLLTAMEATGFDNYAEPMRIFLQKYRQAHKITGPI 158          
BLAST of nuclear factor Y complex B2 vs. Ensembl Celegans
Match: nfyb-1 (Nuclear transcription Factor Y, B (Beta) subunit [Source:UniProtKB/TrEMBL;Acc:A0A0M7RFF4])

HSP 1 Score: 97.4413 bits (241), Expect = 4.099e-23
Identity = 46/84 (54.76%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  301 MKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            MK  +    K++K+AKE  QECVSE+ISFI SEAAE C   KRKTI  +DLL AM   GF+   EP+R+FL KYR+A+K+   I
Sbjct:    1 MKTQMDPQAKLAKDAKECAQECVSEFISFIASEAAEICNITKRKTITADDLLTAMEATGFDNYAEPMRIFLQKYRQAHKITGPI 84          
BLAST of nuclear factor Y complex B2 vs. Ensembl Celegans
Match: dro-1 (DR1 (One) transcription factor family [Source:UniProtKB/TrEMBL;Acc:O45550])

HSP 1 Score: 48.9062 bits (115), Expect = 6.762e-7
Identity = 24/69 (34.78%), Postives = 42/69 (60.87%), Query Frame = 1
Query:  274 LPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            LP   +++I+K+ VP   +I+ E+++++  C  E++  I  EA     Q++RKTI  E +  A+ NLGF
Sbjct:   22 LPQKGINQIIKEVVP-EMRIANESRDMINACCVEFVKHIAREAQRIASQDQRKTIYHEHVQKALQNLGF 89          
BLAST of nuclear factor Y complex B2 vs. Ensembl Fly
Match: Nf-YB (gene:FBgn0032816 transcript:FBtr0343854)

HSP 1 Score: 141.354 bits (355), Expect = 2.010e-41
Identity = 65/104 (62.50%), Postives = 83/104 (79.81%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDS 564
            LREQDRFLPI N+ KIMK  VP NGKI+K+A+E +QECVSE+ISFI+SEA E+   E RKT+NG+DLL A +NLGF+  VEPL ++L KYRE+NK D ++  D+
Sbjct:   36 LREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDA 139          
BLAST of nuclear factor Y complex B2 vs. Ensembl Fly
Match: Nf-YB (gene:FBgn0032816 transcript:FBtr0081289)

HSP 1 Score: 141.354 bits (355), Expect = 2.010e-41
Identity = 65/104 (62.50%), Postives = 83/104 (79.81%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDS 564
            LREQDRFLPI N+ KIMK  VP NGKI+K+A+E +QECVSE+ISFI+SEA E+   E RKT+NG+DLL A +NLGF+  VEPL ++L KYRE+NK D ++  D+
Sbjct:   36 LREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDA 139          
BLAST of nuclear factor Y complex B2 vs. Ensembl Fly
Match: NC2beta (gene:FBgn0028926 transcript:FBtr0080695)

HSP 1 Score: 68.5514 bits (166), Expect = 1.382e-13
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  238 EQLSPLREQDRF-LPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            E L P  E D   LP A+++KI+K+ VPT  +++ E++E++  C SE+I  I+SEA E C    +KTIN E +L A+  LGF
Sbjct:    7 ELLPPSAEDDELTLPRASINKIIKELVPT-VRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGF 87          
BLAST of nuclear factor Y complex B2 vs. Ensembl Fly
Match: Chrac-14 (gene:FBgn0043002 transcript:FBtr0100268)

HSP 1 Score: 50.0618 bits (118), Expect = 1.397e-7
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYR 525
            R +D  LP A + +++K+A+P +  +SKEA+  +    S +  F+TS +     ++  KTI  +D+L  +  L FE  V  L   L  YR
Sbjct:    4 RIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYR 93          
BLAST of nuclear factor Y complex B2 vs. Ensembl Zebrafish
Match: nfybb (nuclear transcription factor Y, beta b [Source:ZFIN;Acc:ZDB-GENE-050306-25])

HSP 1 Score: 152.525 bits (384), Expect = 4.507e-45
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            LREQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   51 LREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 150          
BLAST of nuclear factor Y complex B2 vs. Ensembl Zebrafish
Match: nfyba (nuclear transcription factor Y, beta a [Source:ZFIN;Acc:ZDB-GENE-050417-13])

HSP 1 Score: 152.14 bits (383), Expect = 6.307e-45
Identity = 72/113 (63.72%), Postives = 91/113 (80.53%), Query Frame = 1
Query:  214 DGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            DG  +++F      REQD +LPIANV++IMK AVP  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   42 DGNGSKDF-----FREQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 149          
BLAST of nuclear factor Y complex B2 vs. Ensembl Zebrafish
Match: nfyba (nuclear transcription factor Y, beta a [Source:ZFIN;Acc:ZDB-GENE-050417-13])

HSP 1 Score: 152.14 bits (383), Expect = 6.307e-45
Identity = 72/113 (63.72%), Postives = 91/113 (80.53%), Query Frame = 1
Query:  214 DGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            DG  +++F      REQD +LPIANV++IMK AVP  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   42 DGNGSKDF-----FREQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 149          
BLAST of nuclear factor Y complex B2 vs. Ensembl Zebrafish
Match: nfybb (nuclear transcription factor Y, beta b [Source:ZFIN;Acc:ZDB-GENE-050306-25])

HSP 1 Score: 152.91 bits (385), Expect = 7.420e-45
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            LREQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   72 LREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 171          
BLAST of nuclear factor Y complex B2 vs. Ensembl Zebrafish
Match: nfybb (nuclear transcription factor Y, beta b [Source:ZFIN;Acc:ZDB-GENE-050306-25])

HSP 1 Score: 152.14 bits (383), Expect = 1.611e-44
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            LREQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   46 LREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 145          
BLAST of nuclear factor Y complex B2 vs. Ensembl Xenopus
Match: cdk5r1 (cyclin-dependent kinase 5, regulatory subunit 1 (p35) [Source:Xenbase;Acc:XB-GENE-1032903])

HSP 1 Score: 150.214 bits (378), Expect = 6.360e-44
Identity = 68/100 (68.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   51 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 150          
BLAST of nuclear factor Y complex B2 vs. Ensembl Xenopus
Match: cdk5r1 (cyclin-dependent kinase 5, regulatory subunit 1 (p35) [Source:Xenbase;Acc:XB-GENE-1032903])

HSP 1 Score: 149.828 bits (377), Expect = 4.692e-43
Identity = 68/100 (68.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:  113 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 212          
BLAST of nuclear factor Y complex B2 vs. Ensembl Xenopus
Match: pole3 (polymerase (DNA directed), epsilon 3, accessory subunit [Source:NCBI gene;Acc:550018])

HSP 1 Score: 62.3882 bits (150), Expect = 1.615e-11
Identity = 35/94 (37.23%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            R +D  LP A V++I+K+A+P    ISKEA+  +    S ++ + TS A     + KRKT+N  D+L AM  + F++ + PL+  L  YR+  K
Sbjct:    4 RPEDLNLPNAVVTRIIKEALPEGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNATDVLAAMEEMEFQRFLTPLKESLEVYRQDQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Xenopus
Match: rad17 (RAD17 checkpoint clamp loader component [Source:Xenbase;Acc:XB-GENE-1002356])

HSP 1 Score: 59.6918 bits (143), Expect = 2.755e-10
Identity = 27/72 (37.50%), Postives = 51/72 (70.83%), Query Frame = 1
Query:  265 DRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            D  +P A ++K++K+ +P N +++ +A+E+V  C +E+I  I+SEA E C + ++KTI+ E ++ A+ +LGF
Sbjct:   10 DLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGF 80          
BLAST of nuclear factor Y complex B2 vs. Ensembl Mouse
Match: Nfyb (nuclear transcription factor-Y beta [Source:MGI Symbol;Acc:MGI:97317])

HSP 1 Score: 152.525 bits (384), Expect = 7.041e-45
Identity = 68/100 (68.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K +  I
Sbjct:   52 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y complex B2 vs. Ensembl Mouse
Match: Nfyb (nuclear transcription factor-Y beta [Source:MGI Symbol;Acc:MGI:97317])

HSP 1 Score: 90.5077 bits (223), Expect = 2.116e-22
Identity = 39/55 (70.91%), Postives = 48/55 (87.27%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQ 417
             REQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C 
Sbjct:   52 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCH 106          
BLAST of nuclear factor Y complex B2 vs. Ensembl Mouse
Match: Pole3 (polymerase (DNA directed), epsilon 3 (p17 subunit) [Source:MGI Symbol;Acc:MGI:1933378])

HSP 1 Score: 62.7734 bits (151), Expect = 9.062e-12
Identity = 34/94 (36.17%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            R +D  LP A +++I+K+A+P    ISKEA+  +    S ++ + TS A     + KRKT+N  D+L AM  + F++ + PL+  L  YR   K
Sbjct:    4 RPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFITPLKEALEAYRREQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Mouse
Match: Dr1 (down-regulator of transcription 1 [Source:MGI Symbol;Acc:MGI:1100515])

HSP 1 Score: 59.3066 bits (142), Expect = 2.900e-10
Identity = 27/72 (37.50%), Postives = 51/72 (70.83%), Query Frame = 1
Query:  265 DRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            D  +P A ++K++K+ +P N +++ +A+E+V  C +E+I  I+SEA E C + ++KTI+ E ++ A+ +LGF
Sbjct:   10 DLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGF 80          
BLAST of nuclear factor Y complex B2 vs. UniProt/SwissProt
Match: sp|P25209|NFYB_MAIZE (Nuclear transcription factor Y subunit B OS=Zea mays OX=4577 GN=NFY2 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.230e-49
Identity = 76/109 (69.72%), Postives = 94/109 (86.24%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREA---NKLDSSIMDDSIE 570
            +REQDRFLPIAN+S+IMKKA+P NGKI+K+AKE VQECVSE+ISFITSEA++KCQ+EKRKTING+DLLWAMA LGFE  +EPL+++L KYRE    +KL +   D SI+
Sbjct:   29 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREMEGDSKLTAKSSDGSIK 137          
BLAST of nuclear factor Y complex B2 vs. UniProt/SwissProt
Match: sp|Q60EQ4|NFYB3_ORYSJ (Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB3 PE=1 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 1.481e-48
Identity = 75/109 (68.81%), Postives = 94/109 (86.24%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREA---NKLDSSIMDDSIE 570
            +REQDRFLPIAN+S+IMKKA+P NGKI+K+AKE VQECVSE+ISFITSEA++KCQ+EKRKTING+DLLWAMA LGFE  +EPL+++L KYRE    +KL +   D S++
Sbjct:   36 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREMEGDSKLTAKAGDGSVK 144          
BLAST of nuclear factor Y complex B2 vs. UniProt/SwissProt
Match: sp|Q5QMG3|NFYB2_ORYSJ (Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB2 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.858e-48
Identity = 74/109 (67.89%), Postives = 94/109 (86.24%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREA---NKLDSSIMDDSIE 570
            +REQDRFLPIAN+S+IMKKAVP NGKI+K+AKE +QECVSE+ISF+TSEA++KCQ+EKRKTINGEDLL+AM  LGFE+ V+PL+++L KYRE    +KL S   D S++
Sbjct:   32 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREVIGDSKLSSKAGDGSVK 140          
BLAST of nuclear factor Y complex B2 vs. UniProt/SwissProt
Match: sp|Q8VYK4|NFYB8_ARATH (Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana OX=3702 GN=NFYB8 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.827e-47
Identity = 68/92 (73.91%), Postives = 86/92 (93.48%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYRE 528
            +REQDRFLPIAN+S+IMK+ +P NGKI+K+AKEIVQECVSE+ISF+TSEA++KCQ+EKRKTING+DLLWAMA LGFE  +EPL+++L +YRE
Sbjct:   28 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYMEPLKVYLMRYRE 119          
BLAST of nuclear factor Y complex B2 vs. UniProt/SwissProt
Match: sp|O23310|NFYB3_ARATH (Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana OX=3702 GN=NFYB3 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 4.048e-47
Identity = 71/91 (78.02%), Postives = 82/91 (90.11%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYRE 528
            REQDRFLPIANVS+IMKKA+P N KISK+AKE VQECVSE+ISFIT EA++KCQ+EKRKTING+DLLWAM  LGFE  VEPL+++L KYRE
Sbjct:   20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQKYRE 110          
BLAST of nuclear factor Y complex B2 vs. TrEMBL
Match: A0A182BAE3 (Nuclear factor-Y subunit B2 OS=Schmidtea mediterranea OX=79327 GN=NF-YB2 PE=2 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 1.245e-142
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 1
Query:  130 MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAGHDSXXXXXXXXXXXDGSSSGNIYVTYPTXXXXXXXXXXXVDNSNL 795
            MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAGHDSTTATGTITLSTDGSSSGNIYVTYPTNLNTINGCNNNVDNSNL
Sbjct:    1 MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAGHDSTTATGTITLSTDGSSSGNIYVTYPTNLNTINGCNNNVDNSNL 222          
BLAST of nuclear factor Y complex B2 vs. TrEMBL
Match: A0A0F7GWX5 (Nuclear factor Y complex B2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.682e-81
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 1
Query:  154 VSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLF 510
            VSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLF
Sbjct:    1 VSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLF 119          
BLAST of nuclear factor Y complex B2 vs. TrEMBL
Match: A0A5K3EN84 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 7.672e-59
Identity = 99/183 (54.10%), Postives = 127/183 (69.40%), Query Frame = 1
Query:  136 SNQENIVSDNNFD-------SYYENMDHQVQQGDGEYTQ-EFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAG 660
            +++ N +SDN  D        YY  +D  +   D +Y+  + EQ SPLREQDRFLPIANVSKIMK+A+P NGK++K+AKE VQECVSE+ISFITSEAAE+CQ EKRKTINGEDLLWAM  LGFE  VEPL+ FL KYR+A K+DS+I++ S E+   +     +  NT+ +      + S A 
Sbjct:   37 ADKMNSLSDNQADESAYQDAGYYGTIDSSLTDADADYSATDMEQRSPLREQDRFLPIANVSKIMKRAIPPNGKVAKDAKECVQECVSEFISFITSEAAERCQNEKRKTINGEDLLWAMNALGFENYVEPLKTFLVKYRDAIKIDSTIINSSAELAATLQQQHPHHTNTVIVAAPPNLLNSPAA 219          
BLAST of nuclear factor Y complex B2 vs. TrEMBL
Match: A0A0R3W2E2 (CBFD_NFYB_HMF domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3977 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 8.814e-59
Identity = 92/138 (66.67%), Postives = 112/138 (81.16%), Query Frame = 1
Query:  175 SYYENMDHQVQQGDGEYTQ-EFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHM 585
            SYY  +D  +   D +Y+  + EQ SPLREQDRFLPIANVSKIMK+A+P+NGK++K+AKE VQECVSE+ISFITSEAAE+CQ EKRKTINGEDLLWAM  LGFE  VEPL+ FL KYR+A K+DSSI++ S E+   +
Sbjct:   18 SYYGTIDSSLADTDADYSAADIEQRSPLREQDRFLPIANVSKIMKRAIPSNGKVAKDAKECVQECVSEFISFITSEAAERCQNEKRKTINGEDLLWAMNALGFENYVEPLKTFLVKYRDAIKIDSSIINSSAELAATL 155          
BLAST of nuclear factor Y complex B2 vs. TrEMBL
Match: A0A087W114 (Nuclear transcription factor Y subunit beta OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000204400 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.663e-58
Identity = 91/137 (66.42%), Postives = 111/137 (81.02%), Query Frame = 1
Query:  178 YYENMDHQVQQGDGEYTQ-EFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHM 585
            YY  +D  +   D +Y+  + EQ SPLREQDRFLPIANVSKIMK+A+P+NGK++K+AKE VQECVSE+ISFITSEAAE+CQ EKRKTINGEDLLWAM  LGFE  VEPL+ FL KYR+A K+DSSI++ S E+   +
Sbjct:   19 YYGTIDSSLADTDADYSAADIEQRSPLREQDRFLPIANVSKIMKRAIPSNGKVAKDAKECVQECVSEFISFITSEAAERCQNEKRKTINGEDLLWAMNALGFENYVEPLKTFLVKYRDAIKIDSSIINSSAELAATL 155          
BLAST of nuclear factor Y complex B2 vs. Ensembl Cavefish
Match: nfyba (nuclear transcription factor Y subunit beta [Source:NCBI gene;Acc:103021655])

HSP 1 Score: 152.14 bits (383), Expect = 5.762e-45
Identity = 68/95 (71.58%), Postives = 84/95 (88.42%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            LREQD +LPIANV++IMK A+P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+L+L K+REA K
Sbjct:   51 LREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMK 145          
BLAST of nuclear factor Y complex B2 vs. Ensembl Cavefish
Match: pole3 (DNA polymerase epsilon 3, accessory subunit [Source:NCBI gene;Acc:103024896])

HSP 1 Score: 63.929 bits (154), Expect = 2.982e-12
Identity = 33/94 (35.11%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            R +D  LP A +++I+K+A+P    +SKEA+  + +  S ++ + TS A     + KRKT+N  D++ AM  + FE+ + PLR  L  Y++  K
Sbjct:    4 RPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANSFAMKAKRKTLNAGDVMSAMEEMEFERFLPPLRDALEAYKKGQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Cavefish
Match: dr1 (down-regulator of transcription 1 [Source:ZFIN;Acc:ZDB-GENE-061013-797])

HSP 1 Score: 58.9214 bits (141), Expect = 2.996e-10
Identity = 27/72 (37.50%), Postives = 51/72 (70.83%), Query Frame = 1
Query:  265 DRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            D  +P A ++K++K+ +P N +++ +A+E+V  C +E+I  I+SEA E C + ++KTI+ E ++ A+ +LGF
Sbjct:   10 DLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVINALESLGF 80          
BLAST of nuclear factor Y complex B2 vs. Ensembl Sea Lamprey
Match: nfybb (Nuclear transcription factor Y subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P25210])

HSP 1 Score: 152.14 bits (383), Expect = 1.254e-45
Identity = 74/144 (51.39%), Postives = 102/144 (70.83%), Query Frame = 1
Query:  133 DSNQENIVSDNNFDSYY----ENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSI 552
            D++Q  I  D     +Y     + D +     G++ +      P REQD +LPIANV++IMK ++P++GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  VEPL+ +L KYRE+ K +  I
Sbjct:    9 DASQLGITGDYIGGGHYVLQSSDGDAEGSLASGDHDESCGSKDPYREQDIYLPIANVARIMKTSIPSSGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKQYLQKYRESMKGEKGI 152          
BLAST of nuclear factor Y complex B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005397.1 (pep scaffold:Pmarinus_7.0:GL480146:24969:27649:-1 gene:ENSPMAG00000004898.1 transcript:ENSPMAT00000005397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.322e-10
Identity = 26/72 (36.11%), Postives = 51/72 (70.83%), Query Frame = 1
Query:  265 DRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            D  +P A ++K++K+ +P N +++ +A+E+V  C +E+I  I+SEA + C + ++KTI+ E ++ A+ +LGF
Sbjct:   10 DLTIPRAAINKLIKELLP-NVRVANDARELVVSCCTEFIHLISSEANDICNKSEKKTISPEHVIKALESLGF 80          
BLAST of nuclear factor Y complex B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000236.1 (pep scaffold:Pmarinus_7.0:GL476858:192568:199959:1 gene:ENSPMAG00000000215.1 transcript:ENSPMAT00000000236.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 3.456e-7
Identity = 25/86 (29.07%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  250 PLREQDRF-LPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLR 504
            P  E D+  LP A+V +++ + VP   +++  A+++++   + ++  ++SEA   C   +RKTI+ E ++ A+  LG   S+  LR
Sbjct:   16 PAHEADQVTLPYASVQRLVGELVPCL-RLTAGARDLLRMACTRFVRHVSSEANTACAHAQRKTISPEHVIQALERLGLAGSMGELR 100          
BLAST of nuclear factor Y complex B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002618.1 (pep scaffold:Pmarinus_7.0:GL480211:72207:74463:-1 gene:ENSPMAG00000002388.1 transcript:ENSPMAT00000002618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 5.135e-7
Identity = 25/86 (29.07%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  250 PLREQDRF-LPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLR 504
            P  E D+  LP A+V +++ + VP   +++  A+++++   + ++  ++SEA   C   +RKTI+ E ++ A+  LG   S+  LR
Sbjct:   10 PAHEADQVTLPYASVQRLVGELVPCL-RLTAGARDLLRVACTRFVRHVSSEANTACAHAQRKTISPEHVIQALERLGLAGSMGELR 94          
BLAST of nuclear factor Y complex B2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010174.1 (pep scaffold:Pmarinus_7.0:GL481450:33143:34437:1 gene:ENSPMAG00000009205.1 transcript:ENSPMAT00000010174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 6.439e-7
Identity = 29/105 (27.62%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  250 PLREQDRF-LPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLR--------LFLTKYREANK 537
            P  E D+  LP A+V +++ + VP   +++  A+++++     ++  ++SEA   C   +RKTI+ E ++ A+  LG   S+  LR        L L++ R A +
Sbjct:   16 PAHEADQVTLPYASVQRLVGELVPCL-RLTAGARDLLRVACKRFVRHVSSEANTACAHVQRKTISPEHVIQALERLGLAGSMGELRACHAEFCALALSRRRRATR 119          
BLAST of nuclear factor Y complex B2 vs. Ensembl Yeast
Match: HAP3 (Subunit of the Hap2p/3p/4p/5p CCAAT-binding complex; complex is heme-activated and glucose-repressed; complex is a transcriptional activator and global regulator of respiratory gene expression; contains sequences contributing to both complex assembly and DNA binding [Source:SGD;Acc:S000000117])

HSP 1 Score: 134.42 bits (337), Expect = 1.103e-39
Identity = 61/121 (50.41%), Postives = 88/121 (72.73%), Query Frame = 1
Query:  193 DHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIM 555
            D Q   G+   +   +Q+S LREQDR+LPI NV+++MK  +P + K+SK+AKE +QECVSE ISF+TSEA+++C  +KRKTINGED+L ++  LGFE   E L+++L KYR+   L + +M
Sbjct:   15 DTQENGGNASSSGSLQQISTLREQDRWLPINNVARLMKNTLPPSAKVSKDAKECMQECVSELISFVTSEASDRCAADKRKTINGEDILISLHALGFENYAEVLKIYLAKYRQQQALKNQLM 135          
BLAST of nuclear factor Y complex B2 vs. Ensembl Nematostella
Match: EDO46868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNJ1])

HSP 1 Score: 147.517 bits (371), Expect = 8.026e-45
Identity = 66/90 (73.33%), Postives = 80/90 (88.89%), Query Frame = 1
Query:  262 QDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREA 531
            QDRFLPIANV++IMKK++P  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM  LGF+  VEPL+L+L KYRE 
Sbjct:    4 QDRFLPIANVARIMKKSIPKTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMQTLGFDNYVEPLKLYLQKYREV 93          
BLAST of nuclear factor Y complex B2 vs. Ensembl Nematostella
Match: EDO43839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXF9])

HSP 1 Score: 67.781 bits (164), Expect = 1.995e-13
Identity = 36/101 (35.64%), Postives = 65/101 (64.36%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFL--TKYREANKLDSS 549
            L + D  LP A V+K++K+ +P N ++S +A+E++  C +E+I  I+SEA + C ++ +KTI+ + +L A+  LGF+  +E ++  L   K + ANK  +S
Sbjct:    7 LADDDVTLPRAAVNKMIKEMIP-NMRVSNDARELILNCCTEFIHLISSEANDVCNRQMKKTISPDHILLALEGLGFQHYIEDVKSVLAECKTQAANKRRAS 106          
BLAST of nuclear factor Y complex B2 vs. Ensembl Nematostella
Match: EDO37307 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG28])

HSP 1 Score: 49.6766 bits (117), Expect = 1.151e-7
Identity = 29/94 (30.85%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            + +D  LP A V +++K+A+P    ISKEA+  + +  S ++ + TS A       KRKT+   D++ A+ ++ FEQ +  L+  L  +++  K
Sbjct:    4 KPEDLNLPNAVVVRLVKEALPDGVSISKEARSAIGKAASVFVLYATSCANNFALSHKRKTLQATDVISALEDMEFEQFIPQLKQDLNAFQKEQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Medaka
Match: nfyba (nuclear transcription factor Y subunit beta [Source:NCBI gene;Acc:101165365])

HSP 1 Score: 150.599 bits (379), Expect = 2.397e-44
Identity = 70/107 (65.42%), Postives = 88/107 (82.24%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMG 576
            REQD +LPIANV++IMK AVP  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  V+PL+L+L K+REA K +  I   S+  G
Sbjct:   51 REQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVDPLKLYLQKFREAMKGEKGIAGVSVGEG 157          
BLAST of nuclear factor Y complex B2 vs. Ensembl Medaka
Match: nfyba (nuclear transcription factor Y subunit beta [Source:NCBI gene;Acc:101165365])

HSP 1 Score: 149.828 bits (377), Expect = 2.777e-43
Identity = 70/107 (65.42%), Postives = 88/107 (82.24%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMG 576
            REQD +LPIANV++IMK AVP  GKI+K+AKE VQECVSE+ISFITSEA+E+C QEKRKTINGED+L+AM+ LGF+  V+PL+L+L K+REA K +  I   S+  G
Sbjct:   51 REQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVDPLKLYLQKFREAMKGEKGIAGVSVGEG 157          
BLAST of nuclear factor Y complex B2 vs. Ensembl Medaka
Match: ENSORLT00000000708.2 (DNA polymerase epsilon 3, accessory subunit [Source:NCBI gene;Acc:101172142])

HSP 1 Score: 65.0846 bits (157), Expect = 1.071e-12
Identity = 34/94 (36.17%), Postives = 57/94 (60.64%), Query Frame = 1
Query:  256 REQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANK 537
            + +D  LP A +++I+K+A+P    +SKEA+  + +  S ++ + TS A     + KRKT+N  D+L AM  + FE+ +EPLR  L  Y++  K
Sbjct:    4 KPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFALKAKRKTLNAADVLAAMEEMEFERFLEPLRAALEVYKKGQK 97          
BLAST of nuclear factor Y complex B2 vs. Ensembl Medaka
Match: dr1 (down-regulator of transcription 1 [Source:NCBI gene;Acc:101168111])

HSP 1 Score: 53.1434 bits (126), Expect = 3.324e-8
Identity = 26/72 (36.11%), Postives = 49/72 (68.06%), Query Frame = 1
Query:  265 DRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGF 480
            D  +P A ++K++K+ +P N +++ +A+E+V  C +E+I  I+SEA E C +  +KTI+ E ++  + +LGF
Sbjct:   10 DLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSDKKTISPEHVI-NLESLGF 79          
BLAST of nuclear factor Y complex B2 vs. Planmine SMEST
Match: SMESG000040141.1 (SMESG000040141.1)

HSP 1 Score: 409.838 bits (1052), Expect = 3.463e-146
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 1
Query:  130 MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAGHDSXXXXXXXXXXXDGSSSGNIYVTYPTXXXXXXXXXXXVDNSNL 795
            MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAGHDSTTATGTITLSTDGSSSGNIYVTYPTNLNTINGCNNNVDNSNL
Sbjct:    1 MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGRHMDNNMGNVENTIYLRDNIEYVQSEAGHDSTTATGTITLSTDGSSSGNIYVTYPTNLNTINGCNNNVDNSNL 222          
BLAST of nuclear factor Y complex B2 vs. Planmine SMEST
Match: SMESG000017262.1 (SMESG000017262.1)

HSP 1 Score: 144.436 bits (363), Expect = 4.634e-42
Identity = 67/102 (65.69%), Postives = 84/102 (82.35%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMD 558
            L++QDRFLPI NVSKIMKK +P + KI+K+AK+ VQEC SE+ISF++SEAAE CQ +KRKTINGED+L A ANLGF+  VE L+ FL  YREANK ++ I+D
Sbjct:   28 LKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIID 129          
BLAST of nuclear factor Y complex B2 vs. Planmine SMEST
Match: SMESG000017262.1 (SMESG000017262.1)

HSP 1 Score: 144.436 bits (363), Expect = 5.015e-42
Identity = 67/102 (65.69%), Postives = 84/102 (82.35%), Query Frame = 1
Query:  253 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMD 558
            L++QDRFLPI NVSKIMKK +P + KI+K+AK+ VQEC SE+ISF++SEAAE CQ +KRKTINGED+L A ANLGF+  VE L+ FL  YREANK ++ I+D
Sbjct:   24 LKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIID 125          
The following BLAST results are available for this feature:
BLAST of nuclear factor Y complex B2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFYB9.212e-4568.00nuclear transcription factor Y subunit beta [Sourc... [more]
NFYB9.212e-4568.00nuclear transcription factor Y subunit beta [Sourc... [more]
NFYB1.126e-4468.00nuclear transcription factor Y subunit beta [Sourc... [more]
POLE38.213e-1237.23DNA polymerase epsilon 3, accessory subunit [Sourc... [more]
POLE38.213e-1237.23DNA polymerase epsilon 3, accessory subunit [Sourc... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nfyb-13.361e-3157.00Nuclear transcription Factor Y, B (Beta) subunit ... [more]
nfyb-14.099e-2354.76Nuclear transcription Factor Y, B (Beta) subunit ... [more]
dro-16.762e-734.78DR1 (One) transcription factor family [Source:Uni... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nf-YB2.010e-4162.50gene:FBgn0032816 transcript:FBtr0343854[more]
Nf-YB2.010e-4162.50gene:FBgn0032816 transcript:FBtr0081289[more]
NC2beta1.382e-1343.90gene:FBgn0028926 transcript:FBtr0080695[more]
Chrac-141.397e-732.22gene:FBgn0043002 transcript:FBtr0100268[more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfybb4.507e-4569.00nuclear transcription factor Y, beta b [Source:ZFI... [more]
nfyba6.307e-4563.72nuclear transcription factor Y, beta a [Source:ZFI... [more]
nfyba6.307e-4563.72nuclear transcription factor Y, beta a [Source:ZFI... [more]
nfybb7.420e-4569.00nuclear transcription factor Y, beta b [Source:ZFI... [more]
nfybb1.611e-4469.00nuclear transcription factor Y, beta b [Source:ZFI... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdk5r16.360e-4468.00cyclin-dependent kinase 5, regulatory subunit 1 (p... [more]
cdk5r14.692e-4368.00cyclin-dependent kinase 5, regulatory subunit 1 (p... [more]
pole31.615e-1137.23polymerase (DNA directed), epsilon 3, accessory su... [more]
rad172.755e-1037.50RAD17 checkpoint clamp loader component [Source:Xe... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nfyb7.041e-4568.00nuclear transcription factor-Y beta [Source:MGI Sy... [more]
Nfyb2.116e-2270.91nuclear transcription factor-Y beta [Source:MGI Sy... [more]
Pole39.062e-1236.17polymerase (DNA directed), epsilon 3 (p17 subunit)... [more]
Dr12.900e-1037.50down-regulator of transcription 1 [Source:MGI Symb... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25209|NFYB_MAIZE4.230e-4969.72Nuclear transcription factor Y subunit B OS=Zea ma... [more]
sp|Q60EQ4|NFYB3_ORYSJ1.481e-4868.81Nuclear transcription factor Y subunit B-3 OS=Oryz... [more]
sp|Q5QMG3|NFYB2_ORYSJ4.858e-4867.89Nuclear transcription factor Y subunit B-2 OS=Oryz... [more]
sp|Q8VYK4|NFYB8_ARATH1.827e-4773.91Nuclear transcription factor Y subunit B-8 OS=Arab... [more]
sp|O23310|NFYB3_ARATH4.048e-4778.02Nuclear transcription factor Y subunit B-3 OS=Arab... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182BAE31.245e-142100.00Nuclear factor-Y subunit B2 OS=Schmidtea mediterra... [more]
A0A0F7GWX52.682e-81100.00Nuclear factor Y complex B2 (Fragment) OS=Schmidte... [more]
A0A5K3EN847.672e-5954.10Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3W2E28.814e-5966.67CBFD_NFYB_HMF domain-containing protein OS=Taenia ... [more]
A0A087W1141.663e-5866.42Nuclear transcription factor Y subunit beta OS=Ech... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nfyba5.762e-4571.58nuclear transcription factor Y subunit beta [Sourc... [more]
pole32.982e-1235.11DNA polymerase epsilon 3, accessory subunit [Sourc... [more]
dr12.996e-1037.50down-regulator of transcription 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfybb1.254e-4551.39Nuclear transcription factor Y subunit beta [Sour... [more]
ENSPMAT00000005397.11.322e-1036.11pep scaffold:Pmarinus_7.0:GL480146:24969:27649:-1 ... [more]
ENSPMAT00000000236.13.456e-729.07pep scaffold:Pmarinus_7.0:GL476858:192568:199959:1... [more]
ENSPMAT00000002618.15.135e-729.07pep scaffold:Pmarinus_7.0:GL480211:72207:74463:-1 ... [more]
ENSPMAT00000010174.16.439e-727.62pep scaffold:Pmarinus_7.0:GL481450:33143:34437:1 g... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HAP31.103e-3950.41Subunit of the Hap2p/3p/4p/5p CCAAT-binding comple... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO468688.026e-4573.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438391.995e-1335.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373071.151e-730.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nfyba2.397e-4465.42nuclear transcription factor Y subunit beta [Sourc... [more]
nfyba2.777e-4365.42nuclear transcription factor Y subunit beta [Sourc... [more]
ENSORLT00000000708.21.071e-1236.17DNA polymerase epsilon 3, accessory subunit [Sourc... [more]
dr13.324e-836.11down-regulator of transcription 1 [Source:NCBI gen... [more]
back to top
BLAST of nuclear factor Y complex B2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000040141.13.463e-146100.00SMESG000040141.1[more]
SMESG000017262.14.634e-4265.69SMESG000017262.1[more]
SMESG000017262.15.015e-4265.69SMESG000017262.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30017282
GenBankAKG62117.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017282 ID=SMED30017282|Name=nuclear factor Y complex B2|organism=Schmidtea mediterranea sexual|type=transcript|length=897bp
CATGAATTGAAATCATTGCACAATGTTTTGAATCACTAAATTTGTTTAAA
TATTTTGTTTTAACCAATCAAATCTATTTGAAGAAAATAATAATTTTTCT
AGATTTATATAAATAATAAATTTTAATAAATGGATTCTAATCAAGAAAAT
ATTGTAAGCGATAATAATTTTGACAGTTACTATGAAAATATGGACCACCA
AGTCCAGCAAGGTGATGGCGAATATACTCAAGAATTTGAGCAACTTTCGC
CACTTCGTGAACAAGATAGATTTTTGCCTATTGCAAATGTATCCAAAATA
ATGAAAAAAGCAGTACCAACCAATGGAAAAATATCGAAAGAAGCAAAAGA
AATAGTACAAGAATGTGTTAGCGAATATATTAGCTTCATTACTAGCGAAG
CCGCTGAAAAATGTCAGCAAGAAAAACGGAAGACGATAAATGGGGAAGAC
CTGTTATGGGCCATGGCAAATTTAGGATTTGAACAGAGTGTAGAACCACT
TAGATTGTTTTTAACTAAGTATCGTGAGGCTAATAAATTGGATTCATCGA
TTATGGACGACAGCATTGAAATGGGAAGACACATGGACAACAATATGGGA
AATGTTGAAAATACAATTTATCTGAGGGATAATATTGAGTATGTTCAGAG
TGAAGCCGGTCACGACAGTACAACAGCAACAGGAACAATTACTCTTAGTA
CCGACGGTTCATCATCAGGCAACATTTATGTAACTTATCCCACCAATCTA
AACACAATCAATGGATGCAATAACAATGTCGACAATTCCAACCTGTGAAC
GGGACATTTCCTCATCAACCGACTCATGTCAATATTTAATTATAATTATT
GAAATATTCATAAAAATGTAATGTACAGTTTCAATTGAATAAAGTCG
back to top

protein sequence of SMED30017282-orf-1

>SMED30017282-orf-1 ID=SMED30017282-orf-1|Name=SMED30017282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MDSNQENIVSDNNFDSYYENMDHQVQQGDGEYTQEFEQLSPLREQDRFLP
IANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKR
KTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMDDSIEMGR
HMDNNMGNVENTIYLRDNIEYVQSEAGHDSTTATGTITLSTDGSSSGNIY
VTYPTNLNTINGCNNNVDNSNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0004527copulatory region
Vocabulary: INTERPRO
TermDefinition
IPR003958CBFA_NFYB_domain
IPR009072Histone-fold
Vocabulary: molecular function
TermDefinition
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00615CCAATSUBUNTAcoord: 95..113
score: 43.78
coord: 114..132
score: 35.89
coord: 76..94
score: 51.2
NoneNo IPR availablePANTHERPTHR11064CCAAT-BINDING TRANSCRIPTION FACTOR-RELATEDcoord: 25..177
NoneNo IPR availablePANTHERPTHR11064:SF98coord: 25..177
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 40..162
e-value: 1.4E-40
score: 140.3
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 45..161
IPR003958Transcription factor CBF/NF-Y/archaeal histone domainPFAMPF00808CBFD_NFYB_HMFcoord: 48..112
e-value: 2.9E-28
score: 97.9