RING-CH-type domain-containing protein

Overview
NameRING-CH-type domain-containing protein
Smed IDSMED30017271
Length (bp)1181
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-CH-type domain-containing protein (SMED30017271) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-CH-type domain-containing protein (SMED30017271) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 82.4185 bits (202), Expect = 2.209e-17
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +   + E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   71 CRICHE-GSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 171          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF2 (membrane associated ring-CH-type finger 2 [Source:HGNC Symbol;Acc:HGNC:28038])

HSP 1 Score: 77.7962 bits (190), Expect = 9.898e-16
Identity = 36/101 (35.64%), Postives = 58/101 (57.43%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   NGE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + K+   +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   64 CRICHE-GANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGA 163          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF2 (membrane associated ring-CH-type finger 2 [Source:HGNC Symbol;Acc:HGNC:28038])

HSP 1 Score: 77.7962 bits (190), Expect = 9.898e-16
Identity = 36/101 (35.64%), Postives = 58/101 (57.43%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   NGE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + K+   +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   64 CRICHE-GANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGA 163          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF2 (membrane associated ring-CH-type finger 2 [Source:HGNC Symbol;Acc:HGNC:28038])

HSP 1 Score: 57.3806 bits (137), Expect = 3.358e-9
Identity = 25/56 (44.64%), Postives = 36/56 (64.29%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKK 593
            CRIC +   NGE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + K+
Sbjct:   64 CRICHE-GANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKR 118          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF1 (membrane associated ring-CH-type finger 1 [Source:HGNC Symbol;Acc:HGNC:26077])

HSP 1 Score: 56.225 bits (134), Expect = 2.928e-8
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMW 614
            CRIC         L++PCRC GT+  +H +CL +WI+ S+   CE+CK ++ M  K   +  W
Sbjct:   80 CRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKW 142          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-3 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:Q93227])

HSP 1 Score: 70.4774 bits (171), Expect = 4.291e-13
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 3
Query:  426 CRICLDLE--------KNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRH-----IYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQ 761
            CRIC+  E        + GE L+SPC+C GT+GL H +CLE W+ ++    CEICK  + +++K  +   ++R      +   R+   D    + ++P     +F  ++ AL+       A E++
Sbjct:   13 CRICMCGETSIPYLGQQAGEPLISPCKCSGTMGLFHRSCLEHWLTLTSTTNCEICKFAFKIKQKSRNFIDYIRQGGYKKLQSNRNPFIDFAFVLLILPFAFFGVFMSVEGALYAGRKYHYAFENR 137          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-2 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:Q18997])

HSP 1 Score: 60.4622 bits (145), Expect = 1.779e-10
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3
Query:  405 VRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDM 584
            V    + CRIC D + + + L+ PC C GTV  +H+ CLE+W+R +   QC IC+  +++
Sbjct:   18 VSTKTVICRICFDNDTSSDSLIKPCSCSGTVAYVHNGCLEQWVRTTSNIQCTICQDMFEL 77          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-6 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:Q400N4])

HSP 1 Score: 53.5286 bits (127), Expect = 1.814e-7
Identity = 25/63 (39.68%), Postives = 34/63 (53.97%), Query Frame = 3
Query:  420 LKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRK-KRADM 605
            L CR+C     N   L  PC C G++  +H  CL EW++ S+KE CE+C   Y  +   R DM
Sbjct:   51 LMCRVC---RGNEGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELCNHKYSFQPIYRQDM 110          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-1 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:B2D6L6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.966e-7
Identity = 23/51 (45.10%), Postives = 32/51 (62.75%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNY 578
            CRIC   E +   ++ PC C GT+G +H  CL +W+ +S K+ CEICK  Y
Sbjct:   52 CRICQMHEGD---MVRPCDCAGTMGDVHEECLTKWVNMSNKKTCEICKSEY 99          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG13442 (gene:FBgn0034546 transcript:FBtr0086240)

HSP 1 Score: 56.225 bits (134), Expect = 2.540e-8
Identity = 34/110 (30.91%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  411 ISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKK-----RADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALF 725
            +  L CRIC + + N E+L+SPC CKG++  +H  CLE WI  S    CE+C+  Y+  +         + +W      +R+   D   F  L    T+  F  I   L 
Sbjct:  162 VGSLVCRICHNAD-NPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQSLRLWYSRAMSRRALQEDCQMFSLL----TLVAFGIIGTLLV 266          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG17717 (gene:FBgn0029877 transcript:FBtr0070944)

HSP 1 Score: 55.0694 bits (131), Expect = 3.254e-8
Identity = 24/65 (36.92%), Postives = 37/65 (56.92%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLR 620
            CRIC     + E +  PC CKG+VG +H  CL+ WI      +CEIC   +++ ++RA +   +R
Sbjct:   91 CRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLKQMIR 155          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG4080 (gene:FBgn0035983 transcript:FBtr0309506)

HSP 1 Score: 51.9878 bits (123), Expect = 6.981e-7
Identity = 22/63 (34.92%), Postives = 33/63 (52.38%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMW 614
            CRIC         L++PC C G++  +H  CL++W+  SE   CE+CK  + M  K    + W
Sbjct:   43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG4080 (gene:FBgn0035983 transcript:FBtr0076494)

HSP 1 Score: 51.9878 bits (123), Expect = 6.981e-7
Identity = 22/63 (34.92%), Postives = 33/63 (52.38%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMW 614
            CRIC         L++PC C G++  +H  CL++W+  SE   CE+CK  + M  K    + W
Sbjct:   43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: zgc:158785 (zgc:158785 [Source:ZFIN;Acc:ZDB-GENE-070112-1712])

HSP 1 Score: 82.4185 bits (202), Expect = 1.076e-17
Identity = 36/110 (32.73%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQ---RSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGI 746
            CRIC +    G+ L+SPC C G++ ++H  CLE+W+  S    CE+C   Y + +       WL    MQ   R+  GD +CF+F+ P  +++ + C++ A+ L+   G+
Sbjct:   50 CRICHEDSAAGD-LLSPCECAGSLAMVHRVCLEQWLTASGTSSCELCHFQYALERLPKPFTEWLSAPSMQQQRRTLCGDVICFLFITPLASLSGWLCVQGAMDLYYSNGM 158          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march2 (membrane-associated ring finger (C3HC4) 2 [Source:NCBI gene;Acc:555611])

HSP 1 Score: 75.8702 bits (185), Expect = 3.281e-15
Identity = 35/103 (33.98%), Postives = 58/103 (56.31%), Query Frame = 3
Query:  426 CRICLDLEK--NGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRH---IYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC + +   N E L+SPC C GT+G +H +CLE+W+  S    CE+C   + + ++   +  WLR       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   64 CRICHEGQDVCNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIERRPRPLTEWLRDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGA 166          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 52.7582 bits (125), Expect = 5.938e-8
Identity = 28/93 (30.11%), Postives = 49/93 (52.69%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFI-FLIPSTTIAIF 701
            CRIC     +   L++PC C G++  +H  CL++WI+ S+   CE+CK ++ M  K   +  W + + M  S     MC + F + + T  ++
Sbjct:   53 CRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKYDFIMETKLKPLRKWEK-LQMTASERRKIMCSVTFHVIAITCVVW 144          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 52.7582 bits (125), Expect = 6.610e-8
Identity = 31/102 (30.39%), Postives = 52/102 (50.98%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLF 731
            CRIC     +   L++PC C G++  +H  CL++WI+ S+   CE+CK ++ M  K   +  W + + M  S     MC +       IAI  C+  +L++ 
Sbjct:   53 CRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKYDFIMETKLKPLRKWEK-LQMTASERRKIMCSVTF---HVIAI-TCVVWSLYVL 149          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 55.0694 bits (131), Expect = 8.266e-8
Identity = 33/111 (29.73%), Postives = 55/111 (49.55%), Query Frame = 3
Query:  399 NPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLF 731
            +P  +S   CRIC     +   L++PC C G++  +H  CL++WI+ S+   CE+CK ++ M  K   +  W   + M  S     MC +       IAI  C+  +L++ 
Sbjct:  343 SPYSLSGDCCRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKYDFIMETKLKPLRKW-EKLQMTASERRKIMCSVTF---HVIAI-TCVVWSLYVL 448          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: march3 (membrane associated ring-CH-type finger 3 [Source:NCBI gene;Acc:493225])

HSP 1 Score: 82.8037 bits (203), Expect = 1.500e-17
Identity = 37/102 (36.27%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +     E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   70 CRICHE-GSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 170          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: march3 (membrane associated ring-CH-type finger 3 [Source:NCBI gene;Acc:493225])

HSP 1 Score: 82.8037 bits (203), Expect = 1.564e-17
Identity = 37/102 (36.27%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +     E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   69 CRICHE-GSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 169          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: marchf2 (membrane associated ring-CH-type finger 2 [Source:NCBI gene;Acc:549760])

HSP 1 Score: 79.7221 bits (195), Expect = 1.967e-16
Identity = 38/132 (28.79%), Postives = 71/132 (53.79%), Query Frame = 3
Query:  333 HLKSPNKQMMXXXXXXXXXXXENPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
             + + + Q++++        ++ P+      CRIC +   NGE+L+SPC C GT+G +H TCLE+W+  S    CE+C   + + ++   +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   51 QVTAKDGQLLSTVIKALGTQSDGPI------CRICHE-GGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPRPVTEWLKDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGA 175          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: ube2a (ubiquitin conjugating enzyme E2 A [Source:Xenbase;Acc:XB-GENE-969236])

HSP 1 Score: 55.8398 bits (133), Expect = 6.843e-8
Identity = 32/111 (28.83%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  399 NPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLF 731
            N V   +  CRIC         L++PC C GT+  +H TCL +WI+ S+   CE+CK ++ M  K   +  W + + M +S     +C +       I    C+  +L++ 
Sbjct:  256 NDVSEDLDVCRICHCEGDEENPLITPCLCTGTLRFVHQTCLHQWIKSSDTRCCELCKYDFVMETKLKPLRKWEK-LQMTKSERSKIICSVTF----HIIALTCVMWSLYVL 361          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: ube2a (ubiquitin conjugating enzyme E2 A [Source:Xenbase;Acc:XB-GENE-969236])

HSP 1 Score: 55.4546 bits (132), Expect = 7.469e-8
Identity = 32/111 (28.83%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  399 NPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLF 731
            N V   +  CRIC         L++PC C GT+  +H TCL +WI+ S+   CE+CK ++ M  K   +  W + + M +S     +C +       I    C+  +L++ 
Sbjct:  276 NDVSEDLDVCRICHCEGDEENPLITPCLCTGTLRFVHQTCLHQWIKSSDTRCCELCKYDFVMETKLKPLRKWEK-LQMTKSERSKIICSVTF----HIIALTCVMWSLYVL 381          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March3 (membrane-associated ring finger (C3HC4) 3 [Source:MGI Symbol;Acc:MGI:2443667])

HSP 1 Score: 82.8037 bits (203), Expect = 7.396e-18
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +   + E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   71 CRICHE-GSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 171          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March3 (membrane-associated ring finger (C3HC4) 3 [Source:MGI Symbol;Acc:MGI:2443667])

HSP 1 Score: 82.4185 bits (202), Expect = 1.720e-17
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +   + E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   71 CRICHE-GSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 171          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March2 (membrane-associated ring finger (C3HC4) 2 [Source:MGI Symbol;Acc:MGI:1925915])

HSP 1 Score: 78.1814 bits (191), Expect = 1.094e-16
Identity = 36/101 (35.64%), Postives = 58/101 (57.43%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   NGE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + K+   +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:    3 CRICHE-GANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGA 102          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March2 (membrane-associated ring finger (C3HC4) 2 [Source:MGI Symbol;Acc:MGI:1925915])

HSP 1 Score: 78.5666 bits (192), Expect = 1.246e-16
Identity = 36/101 (35.64%), Postives = 58/101 (57.43%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   NGE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + K+   +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   64 CRICHE-GANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGA 163          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March2 (membrane-associated ring finger (C3HC4) 2 [Source:MGI Symbol;Acc:MGI:1925915])

HSP 1 Score: 79.337 bits (194), Expect = 1.376e-16
Identity = 36/101 (35.64%), Postives = 58/101 (57.43%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   NGE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + K+   +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   64 CRICHE-GANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGA 163          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BRX9|MARH3_MOUSE (E3 ubiquitin-protein ligase MARCHF3 OS=Mus musculus OX=10090 GN=Marchf3 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.173e-17
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +   + E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   71 CRICHE-GSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 171          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0IH10|MARH3_XENLA (E3 ubiquitin-protein ligase MARCHF3 OS=Xenopus laevis OX=8355 GN=marchf3 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.948e-17
Identity = 37/102 (36.27%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +     E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   70 CRICHE-GSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 170          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q68FA7|MARH3_XENTR (E3 ubiquitin-protein ligase MARCHF3 OS=Xenopus tropicalis OX=8364 GN=marchf3 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.286e-17
Identity = 37/102 (36.27%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +     E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   69 CRICHE-GSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 169          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86UD3|MARH3_HUMAN (E3 ubiquitin-protein ligase MARCHF3 OS=Homo sapiens OX=9606 GN=MARCHF3 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.061e-16
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +   + E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   71 CRICHE-GSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 171          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XIE5|MARH3_RAT (E3 ubiquitin-protein ligase MARCHF3 OS=Rattus norvegicus OX=10116 GN=Marchf3 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.203e-16
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC +   + E L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+    + +R+  GD +CF+F+ P  TI+ + C++ A+
Sbjct:   71 CRICHE-GSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAV 171          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A074ZXV0 (RING-CH-type domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_01686 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 7.230e-22
Identity = 67/206 (32.52%), Postives = 109/206 (52.91%), Query Frame = 3
Query:  303 QSASFEFKSDHLKSPNKQMMXXXXXXXXXXXENPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDM---RKK------------RADMH-MWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHY 872
            Q++ F  K+D    P++++            ++ +  +  +CRICLD  +    LMSPCRCKGTVGL+H  CL+ W+  S K +CE+C   Y M   R++            R D+   W+R    +R  + D +C + L PST I ++FCI  A+      G A+E+   W+ +GL  L++LL++ L  W I  ++H+L  F+ +
Sbjct:  213 QTSVFVQKTDRCAPPDEEV---------SQQQDDLSFNQFRCRICLDEGELEGPLMSPCRCKGTVGLVHRNCLQRWLYESGKVKCELCGYEYIMTPSRRRSLPTFTRPRSYTRLDLFCAWIRSNTTRRHLLADIICLVLLTPSTYIGVYFCIVGAM------GFAMENPFAWQAVGLWLLAILLIILLTSWMILAIRHHLSTFQRH 403          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A4Z2DHR3 (E3 ubiquitin-protein ligase MARCH3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000842 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.650e-21
Identity = 67/186 (36.02%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  399 NPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEIC--------------KCN--YDMRKKRAD---MHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQYRFSI 899
            N   + + +CRICL+     E L+SPCRCKGTVGL+H  CLE+W+  S K  CE+C              +C+  Y +R    D   +  WL     +R  I D +C I L P+T I ++FC   AL      G A  +   W+  GL  L+V+L+L L  W I  +KH+L +FR+Y+ +Q + ++
Sbjct:  102 NDTSLMIFRCRICLEEGNTNENLLSPCRCKGTVGLVHRKCLEKWLLTSGKPYCELCGYAYIMLPSKRNSSQCSSLYQIRHVNNDIRNIRNWLNWQRTRRHLIADIICMILLTPATYIGVYFCAIGAL------GYAEMNPFAWQVFGLWSLAVILILLLTTWMILAIKHHLSNFRNYQYHQQQIAL 281          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A183MEA8 (RING-CH-type domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14383 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.679e-20
Identity = 67/174 (38.51%), Postives = 98/174 (56.32%), Query Frame = 3
Query:  420 LKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMR--KKRADMH------------------MWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSN 881
             +CRICLD EK  E L+SPCRCKGT+GL+H  CL++W+  S K QCE+C   Y M+  K+ +  +                   WL+   +++  I D +C I LIP+T I ++FCI +A         A  +   W+ I L  L+V+L+L L IW I  +KH+L H+RHY+ +
Sbjct:   12 FRCRICLD-EKKEEGLLSPCRCKGTIGLVHKKCLQKWLLTSGKLQCELCGYMYLMKPSKQYSSFYSIKWNQFKQYNNELKQFCHWLQWHRIRKYLIIDIICMILLIPTTYIGVYFCIISAF------NYAEYNSFTWQVISLWGLAVILILLLTIWIILAIKHHLNHYRHYQHD 178          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A4S2LI31 (RING-CH-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007031 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 3.937e-20
Identity = 73/220 (33.18%), Postives = 113/220 (51.36%), Query Frame = 3
Query:  303 QSASFEFKSDHLKSPNKQMMXXXXXXXXXXXENPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDM---RKK------------RADMH-MWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHF-RHYRSNQYRFSIHNRR 911
            Q++ F  K+D    P+ ++            ++ +  +  +CRICLD  +    LMSPCRCKGTVGL+H  CL+ W+  S K +CE+C   Y M   R++            R D+   W+R    +R  + D +C + L PST I ++FCI  A+      G A+E+   W+ IGL  L++LL++ L  W I  ++H+L  F RH    + R  + N R
Sbjct:  270 QTSIFVPKTDRCAPPDGEV---------SQQQDDLSFNQFRCRICLDEGELEGPLMSPCRCKGTVGLVHRNCLQRWLYESGKVKCELCGYEYIMTPSRRRSLPTFTRPRSYTRLDLFCAWIRSNTTRRHLLADIICLVLLTPSTYIGVYFCIVGAM------GFAMENPFAWQAIGLWLLAILLIILLTSWMILAIRHHLSTFQRHMYYQRQRERLENER 474          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A095AL31 (E3 ubiquitin-protein ligase MARCH2 OS=Schistosoma haematobium OX=6185 GN=MS3_03003 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 4.526e-20
Identity = 76/212 (35.85%), Postives = 107/212 (50.47%), Query Frame = 3
Query:  417 VLKCRICLDLEKNG-----EKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMR--KKRADMH------------------MWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFL--FSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQ-----------------YRFSIHNRRKST 920
              +CRICLD  +N      E L+SPCRCKGT+GL+H  CL++W+  S K QCE+C   Y M+  KK +  H                   WL+   +++  I D +C I LIP+T I ++FC  +A     F+P          W+ I L  L+VLL+L L IW I  +KH+L H+RHY+ +Q                 YRFSI  R + +
Sbjct:  296 TFRCRICLDESQNNNNHEEEGLLSPCRCKGTIGLVHKKCLQKWLLTSGKLQCELCGYVYLMKPSKKYSSFHSIHWNQFRQYNDELRQFCHWLQWHRIRKHLIVDIICMILLIPTTYIGVYFCAVSAFSYAEFNPFT--------WQVISLWGLAVLLILLLTIWIILAIKHHLNHYRHYQHDQQQQLTLTETNPLNRLPRYRFSIQPRPRGS 499          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:NCBI gene;Acc:103035346])

HSP 1 Score: 84.3445 bits (207), Expect = 3.503e-18
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYM---QRSFIGDAMCFIFLIPSTTIAIFFCIKAAL 722
            CRIC D     E+L+SPC C GT+G +H +CLE W+  S    CE+C   + +++K   +  WLR+  +   +R+  GD +CF+ + P  TI+ + C++ A+
Sbjct:   86 CRICHD-GGGQEELLSPCECAGTLGTIHRSCLEHWLSASSTSFCELCHYQFSVQRKARPLLEWLRNPGLHQEKRTLFGDMVCFLLITPLATISGWLCLRGAV 186          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055541.1 (E3 ubiquitin-protein ligase MARCH3-like [Source:NCBI gene;Acc:103046723])

HSP 1 Score: 82.8037 bits (203), Expect = 8.114e-18
Identity = 48/169 (28.40%), Postives = 85/169 (50.30%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQ-RSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQYRFSIHNRRKSTINQ 929
            CRIC +    G+ L+SPC C GT+ ++H  CLE W+  S    CE+C   + + +       WL    MQ R+  GD +CF+F+ P  +++ + C++ AL L+   G+           GL+ L++ L    L W + ++++++  F+ +R    R  +   R +   Q
Sbjct:   64 CRICHEGLSAGD-LLSPCECAGTLAMVHRVCLEHWLTASGTSHCELCHFEFALERLPKPFTEWLATPSMQRRTLCGDIICFLFITPLASLSGWLCVQGALDLYYSNGM--------EAFGLLMLTLALFTIYLFWTVVSLRYHVHLFKSWRETNPRVRLQTPRPAQTPQ 223          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036351.1 (E3 ubiquitin-protein ligase MARCH3-like [Source:NCBI gene;Acc:103046723])

HSP 1 Score: 81.6481 bits (200), Expect = 1.544e-17
Identity = 48/169 (28.40%), Postives = 85/169 (50.30%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQ-RSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQYRFSIHNRRKSTINQ 929
            CRIC +    G+ L+SPC C GT+ ++H  CLE W+  S    CE+C   + + +       WL    MQ R+  GD +CF+F+ P  +++ + C++ AL L+   G+           GL+ L++ L    L W + ++++++  F+ +R    R  +   R +   Q
Sbjct:   43 CRICHEGLSAGD-LLSPCECAGTLAMVHRVCLEHWLTASGTSHCELCHFEFALERLPKPFTEWLATPSMQRRTLCGDIICFLFITPLASLSGWLCVQGALDLYYSNGM--------EAFGLLMLTLALFTIYLFWTVVSLRYHVHLFKSWRETNPRVRLQTPRPAQTPQ 202          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: march2 (membrane associated ring-CH-type finger 2 [Source:NCBI gene;Acc:103021975])

HSP 1 Score: 76.2554 bits (186), Expect = 1.613e-15
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   N E L+SPC C GT+G +H +CLE+W+  S    CE+C   + + ++   +  WLR       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   64 CRICHE-GGNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIERRPRPLTEWLRDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGA 163          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 53.5286 bits (127), Expect = 2.813e-7
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  399 NPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFI-FLIPSTTIAIF 701
            +P  +S   CRIC     +   L++PC C G++  +H  CL++WI+ S+   CE+CK  + M  K   +  W   + M  S     MC + F + + T  ++
Sbjct:  433 SPYSLSGDCCRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPLRKW-EKLQMTASERRKIMCSVTFHVIAITCVVW 533          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 79.7221 bits (195), Expect = 9.417e-18
Identity = 52/170 (30.59%), Postives = 91/170 (53.53%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIK-AALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQYRFSIHNRRKSTI 923
            CRIC +     E+L+SPC C GT+G +H +CLE W+  S    CE+C   + + +K   +  WLR+      +R+ + D +CF+F+ P   I+ + C++ AA  L S     LE+       GLI L+V L+   L W   +V+++++ ++ +R   +R  +   R + +
Sbjct:   11 CRICHEGSAQ-EELLSPCECTGTLGWVHRSCLEHWLAASNTSYCELCHFQFLVERKPQPLTQWLRNPSPKQERRTLLSDTLCFLFITPLAGISGWLCLRGAADHLESGNRSQLEAA------GLIGLTVALLTIYLFWTAVSVRYHIRLYQEWRKTHHRVKLLTPRPTGL 173          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 77.0258 bits (188), Expect = 1.260e-16
Identity = 47/165 (28.48%), Postives = 84/165 (50.91%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQYRFSIHNRR 911
            CRIC +   + E+L+SPC C GT+G +H  CLE W+  S    CE+C   + + +       WLR       +R+ + D +CF+F+ P   ++ + C++ A        I   S++     GLI L+V L+   L W   +V+++++ ++ +R   +R  +   R
Sbjct:   32 CRICHE-AGSAEELLSPCECMGTLGWVHRACLERWLAASNTSYCELCHFQFLVERTPQPFSQWLRRPSPKQERRTLLSDTLCFLFISPLAGVSGWLCLRGAA-----DHIESGSRSRLEAAGLIGLTVALLTIYLFWTAVSVRYHIRLYQEWRKTHHRVKLLTPR 190          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002279.1 (pep scaffold:Pmarinus_7.0:GL492175:3127:4977:-1 gene:ENSPMAG00000002079.1 transcript:ENSPMAT00000002279.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 4.891e-8
Identity = 19/48 (39.58%), Postives = 29/48 (60.42%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICK 569
            CR+C       + L  PC C G++  +H  CL +W++ S+KE CE+CK
Sbjct:    5 CRVCRSEGTAEKPLYHPCVCTGSIKYIHQDCLLQWLKHSKKEYCELCK 52          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008120.1 (pep scaffold:Pmarinus_7.0:GL478007:46546:54572:1 gene:ENSPMAG00000007338.1 transcript:ENSPMAT00000008120.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.656e-6
Identity = 19/48 (39.58%), Postives = 28/48 (58.33%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICK 569
            CR+C       + L  PC C G++  +H  CL +W++ S KE CE+CK
Sbjct:    8 CRVCRSEGTVDKPLFHPCVCTGSIKFIHQDCLLQWLKHSRKEYCELCK 55          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008124.1 (pep scaffold:Pmarinus_7.0:GL478007:47363:53431:1 gene:ENSPMAG00000007338.1 transcript:ENSPMAT00000008124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 3.593e-6
Identity = 19/48 (39.58%), Postives = 28/48 (58.33%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICK 569
            CR+C       + L  PC C G++  +H  CL +W++ S KE CE+CK
Sbjct:    4 CRVCRSEGTVDKPLFHPCVCTGSIKFIHQDCLLQWLKHSRKEYCELCK 51          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD2])

HSP 1 Score: 82.8037 bits (203), Expect = 5.520e-19
Identity = 43/106 (40.57%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWL---RHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFS 734
            CRIC D    G  ++SPC C GT+G +H  CLEEW+  S K +CEICK  Y +++       WL   R    +R  IGD  CFI L P    A   C + + + FS
Sbjct:    1 CRICRD-STAGCDVISPCHCSGTLGRVHVRCLEEWLSASNKNECEICKYEYHLQRTPKTFRQWLKNPRSRTERRYIIGDCACFIILTPLVIAATSLCAQGSFYYFS 105          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEJ1])

HSP 1 Score: 54.6842 bits (130), Expect = 5.370e-9
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFI-FLIPSTTIAIF 701
            CRIC    +  + L+SPC C G++  +H TCL+ WI+ S+ ++CE+C   + M  K      W + + M RS     MC + F I + T  ++
Sbjct:   10 CRICHCEAEPDQPLISPCHCSGSLQYVHQTCLQRWIKSSDTKKCELCNYEFIMEAKMKPFRKW-QALDMTRSERRKIMCSVSFHIIAITCVVW 101          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO40361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B1])

HSP 1 Score: 53.1434 bits (126), Expect = 5.090e-8
Identity = 23/63 (36.51%), Postives = 34/63 (53.97%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMW 614
            CRIC       E L++PC C G+   +H+TCL  W + + K  CE+C+C   ++KK      W
Sbjct:  114 CRICHS--AGEEPLVTPCHCSGSAKFVHATCLLTWFKKAVKNTCELCRCKVAIKKKGKPFAEW 174          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO31642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB2])

HSP 1 Score: 53.1434 bits (126), Expect = 6.195e-8
Identity = 22/66 (33.33%), Postives = 39/66 (59.09%), Query Frame = 3
Query:  426 CRICLDLEK---NGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMW 614
            CRIC +  +     E+L+ PC C GT+G  H +C+E+W+ ++EK++C IC+  +  +     +  W
Sbjct:   68 CRICQNTVQRMIGKEELIKPCLCNGTLGYAHRSCMEQWLTLTEKKKCTICEFTFKTKTVLKPITQW 133          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4C7])

HSP 1 Score: 50.0618 bits (118), Expect = 6.086e-7
Identity = 22/66 (33.33%), Postives = 36/66 (54.55%), Query Frame = 3
Query:  423 KCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLR 620
            +CRIC    +  E L+SPC+C G+   +H +CL  W ++S   +CE+C     ++K    +  W R
Sbjct:   87 ECRICHT--EGDEVLISPCKCSGSTKWVHESCLVLWFQVSRTSKCELCAEKISVKKYTKPVREWRR 150          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000017494.2 (E3 ubiquitin-protein ligase MARCH2 [Source:NCBI gene;Acc:101156120])

HSP 1 Score: 74.7146 bits (182), Expect = 6.143e-15
Identity = 34/104 (32.69%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  417 VLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            V  CRIC +    GE L+SPC C GT+G +H +CLE+W+  S    CE+C   + + ++   +  WL+       +R+ + D  CF+ + P   I+ + C++ A
Sbjct:   64 VGMCRICHE-GAGGETLLSPCDCTGTLGKVHKSCLEKWLSSSNTSYCELCHTEFTIERRPQPLTQWLKDPGPRSEKRTLLCDMACFLLITPLAAISGWLCLRGA 166          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march2 (E3 ubiquitin-protein ligase MARCH2 [Source:NCBI gene;Acc:101160153])

HSP 1 Score: 71.2478 bits (173), Expect = 1.153e-13
Identity = 33/101 (32.67%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHI---YMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   + E L+SPC C GT G +H +CLE+W+  S    CE+C   + + +++  +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:   66 CRICHE-GGSSEDLLSPCDCTGTQGAVHKSCLEKWLSSSNTSYCELCHTEFCIERQQRPLTEWLQEPGPRNEKRTLFWDMVCFLFITPLAAISGWLCLRGA 165          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march2 (E3 ubiquitin-protein ligase MARCH2 [Source:NCBI gene;Acc:101160153])

HSP 1 Score: 70.4774 bits (171), Expect = 3.262e-13
Identity = 33/101 (32.67%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRH---IYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAA 719
            CRIC +   + E L+SPC C GT G +H +CLE+W+  S    CE+C   + + +++  +  WL+       +R+   D +CF+F+ P   I+ + C++ A
Sbjct:  116 CRICHE-GGSSEDLLSPCDCTGTQGAVHKSCLEKWLSSSNTSYCELCHTEFCIERQQRPLTEWLQEPGPRNEKRTLFWDMVCFLFITPLAAISGWLCLRGA 215          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march1 (E3 ubiquitin-protein ligase MARCH1 [Source:NCBI gene;Acc:101155329])

HSP 1 Score: 53.9138 bits (128), Expect = 1.869e-7
Identity = 26/83 (31.33%), Postives = 44/83 (53.01%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFL 674
            CRIC     +   L+ PCRC G++  +H  CL +WI+ S+   CE+CK ++ M  K   ++ W + ++M +S      C +  
Sbjct:  295 CRICHCEGDDEFPLIMPCRCTGSLSFVHQACLNQWIKSSDTRCCELCKFDFIMETKLKPLNKWEK-LHMSKSERRKIFCSVLF 376          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march8 (membrane associated ring-CH-type finger 8 [Source:NCBI gene;Acc:101161433])

HSP 1 Score: 52.7582 bits (125), Expect = 2.054e-7
Identity = 34/118 (28.81%), Postives = 52/118 (44.07%), Query Frame = 3
Query:  426 CRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGI 779
            CRIC         L++PC C G++  +H  CL++WI+ S+   CE+CK  + M  K   +  W + + M  S     MC +       IAI   + +   L   T   + S     GI
Sbjct:   75 CRICHCEGDEESPLITPCHCTGSLRFVHQGCLQQWIKSSDTRCCELCKYEFIMETKFKPLRKWEK-LQMTASERRKIMCSVTF---HIIAITCVVWSLYVLIDRTADEIRSAGRIPGI 188          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003896.1 (SMESG000003896.1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 300/300 (100.00%), Postives = 300/300 (100.00%), Query Frame = 3
Query:   45 MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKKSTTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKSPNKQMMXXXXXXXXXXXENPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGXXXXXXXXXXXXXXXXXXTVKHYLKHFRHYRSNQYRFSIHNRRKSTINQGTLRC 944
            MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKKSTTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKSPNKQMMTSNNSKTSKTTENPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGLIFLSVLLVLCLLIWFIFTVKHYLKHFRHYRSNQYRFSIHNRRKSTINQGTLRC
Sbjct:    1 MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKKSTTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKSPNKQMMTSNNSKTSKTTENPVRISVLKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSFIGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGLIFLSVLLVLCLLIWFIFTVKHYLKHFRHYRSNQYRFSIHNRRKSTINQGTLRC 300          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000033177.1 (SMESG000033177.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.339e-70
Identity = 120/121 (99.17%), Postives = 121/121 (100.00%), Query Frame = 3
Query:   45 MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKKSTTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKSPNKQMMXXXXXXXXXXXENPV 407
            MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKKSTTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKSPNKQMMTSNNSKTSKTTENP+
Sbjct:    1 MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKKSTTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKSPNKQMMTSNNSKTSKTTENPL 121          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031839.1 (SMESG000031839.1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.477e-13
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  420 LKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIY----------MQR-SFIGDAMCFIFLIPSTTIAIFFCI 710
             KCR+CLD    G+ L+SPC CKG++G++H  CLE+W+  +   QCEIC   + +  K A    WL   +          +QR   +   +C   L+    I I+F I
Sbjct:   27 FKCRVCLDSCDMGD-LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTKTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLI 133          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000044972.1 (SMESG000044972.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.677e-12
Identity = 36/108 (33.33%), Postives = 54/108 (50.00%), Query Frame = 3
Query:  420 LKCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIY----------MQR-SFIGDAMCFIFLIPSTTIAIFFCI 710
             KCR+CLD    G+ L+SPC CKG++G++H  CLE+W+  +   QCEIC   + +    A    WL   +          +QR   +   +C   L+    I I+F I
Sbjct:   27 FKCRVCLDSCDMGD-LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLI 133          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031839.1 (SMESG000031839.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.442e-9
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 3
Query:  465 LMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIY----------MQR-SFIGDAMCFIFLIPSTTIAIFFCI 710
            L+SPC CKG++G++H  CLE+W+  +   QCEIC   + +  K A    WL   +          +QR   +   +C   L+    I I+F I
Sbjct:    4 LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTKTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLI 96          
The following BLAST results are available for this feature:
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARCHF32.209e-1736.27membrane associated ring-CH-type finger 3 [Source:... [more]
MARCHF29.898e-1635.64membrane associated ring-CH-type finger 2 [Source:... [more]
MARCHF29.898e-1635.64membrane associated ring-CH-type finger 2 [Source:... [more]
MARCHF23.358e-944.64membrane associated ring-CH-type finger 2 [Source:... [more]
MARCHF12.928e-838.10membrane associated ring-CH-type finger 1 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
marc-34.291e-1328.80MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
marc-21.779e-1038.33MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
marc-61.814e-739.68MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
marc-11.966e-745.10MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG134422.540e-830.91gene:FBgn0034546 transcript:FBtr0086240[more]
CG177173.254e-836.92gene:FBgn0029877 transcript:FBtr0070944[more]
CG40806.981e-734.92gene:FBgn0035983 transcript:FBtr0309506[more]
CG40806.981e-734.92gene:FBgn0035983 transcript:FBtr0076494[more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1587851.076e-1732.73zgc:158785 [Source:ZFIN;Acc:ZDB-GENE-070112-1712][more]
march23.281e-1533.98membrane-associated ring finger (C3HC4) 2 [Source:... [more]
march85.938e-830.11membrane-associated ring finger (C3HC4) 8 [Source:... [more]
march86.610e-830.39membrane-associated ring finger (C3HC4) 8 [Source:... [more]
march88.266e-829.73membrane-associated ring finger (C3HC4) 8 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
march31.500e-1736.27membrane associated ring-CH-type finger 3 [Source:... [more]
march31.564e-1736.27membrane associated ring-CH-type finger 3 [Source:... [more]
marchf21.967e-1628.79membrane associated ring-CH-type finger 2 [Source:... [more]
ube2a6.843e-828.83ubiquitin conjugating enzyme E2 A [Source:Xenbase;... [more]
ube2a7.469e-828.83ubiquitin conjugating enzyme E2 A [Source:Xenbase;... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
March37.396e-1836.27membrane-associated ring finger (C3HC4) 3 [Source:... [more]
March31.720e-1736.27membrane-associated ring finger (C3HC4) 3 [Source:... [more]
March21.094e-1635.64membrane-associated ring finger (C3HC4) 2 [Source:... [more]
March21.246e-1635.64membrane-associated ring finger (C3HC4) 2 [Source:... [more]
March21.376e-1635.64membrane-associated ring finger (C3HC4) 2 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BRX9|MARH3_MOUSE5.173e-1736.27E3 ubiquitin-protein ligase MARCHF3 OS=Mus musculu... [more]
sp|Q0IH10|MARH3_XENLA7.948e-1736.27E3 ubiquitin-protein ligase MARCHF3 OS=Xenopus lae... [more]
sp|Q68FA7|MARH3_XENTR8.286e-1736.27E3 ubiquitin-protein ligase MARCHF3 OS=Xenopus tro... [more]
sp|Q86UD3|MARH3_HUMAN1.061e-1636.27E3 ubiquitin-protein ligase MARCHF3 OS=Homo sapien... [more]
sp|Q5XIE5|MARH3_RAT1.203e-1636.27E3 ubiquitin-protein ligase MARCHF3 OS=Rattus norv... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZXV07.230e-2232.52RING-CH-type domain-containing protein OS=Opisthor... [more]
A0A4Z2DHR31.650e-2136.02E3 ubiquitin-protein ligase MARCH3 OS=Schistosoma ... [more]
A0A183MEA83.679e-2038.51RING-CH-type domain-containing protein OS=Schistos... [more]
A0A4S2LI313.937e-2033.18RING-CH-type domain-containing protein OS=Opisthor... [more]
A0A095AL314.526e-2035.85E3 ubiquitin-protein ligase MARCH2 OS=Schistosoma ... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARCHF33.503e-1836.27membrane associated ring-CH-type finger 3 [Source:... [more]
ENSAMXT00000055541.18.114e-1828.40E3 ubiquitin-protein ligase MARCH3-like [Source:NC... [more]
ENSAMXT00000036351.11.544e-1728.40E3 ubiquitin-protein ligase MARCH3-like [Source:NC... [more]
march21.613e-1534.65membrane associated ring-CH-type finger 2 [Source:... [more]
march82.813e-729.41membrane-associated ring finger (C3HC4) 8 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARCHF39.417e-1830.59membrane associated ring-CH-type finger 3 [Source:... [more]
MARCHF31.260e-1628.48membrane associated ring-CH-type finger 3 [Source:... [more]
ENSPMAT00000002279.14.891e-839.58pep scaffold:Pmarinus_7.0:GL492175:3127:4977:-1 ge... [more]
ENSPMAT00000008120.11.656e-639.58pep scaffold:Pmarinus_7.0:GL478007:46546:54572:1 g... [more]
ENSPMAT00000008124.13.593e-639.58pep scaffold:Pmarinus_7.0:GL478007:47363:53431:1 g... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372495.520e-1940.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378705.370e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403615.090e-836.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316426.195e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414976.086e-733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017494.26.143e-1532.69E3 ubiquitin-protein ligase MARCH2 [Source:NCBI ge... [more]
march21.153e-1332.67E3 ubiquitin-protein ligase MARCH2 [Source:NCBI ge... [more]
march23.262e-1332.67E3 ubiquitin-protein ligase MARCH2 [Source:NCBI ge... [more]
march11.869e-731.33E3 ubiquitin-protein ligase MARCH1 [Source:NCBI ge... [more]
march82.054e-728.81membrane associated ring-CH-type finger 8 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003896.10.000e+0100.00SMESG000003896.1[more]
SMESG000033177.11.339e-7099.17SMESG000033177.1[more]
SMESG000031839.14.477e-1334.26SMESG000031839.1[more]
SMESG000044972.11.677e-1233.33SMESG000044972.1[more]
SMESG000031839.11.442e-932.26SMESG000031839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017271 ID=SMED30017271|Name=RING-CH-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1181bp
CCGATCTCACAATTTCAATCCATTTTGTTTTGTAGAGTTTTCAGATGGAA
TTGGATAAATTATCAACTCCAACAGCTAGTTTTGTCAATAAAAAGTCTGA
TTTTTGTCCTCCTGGTACCCCGAGGCCTTCCAACCTACGCTTAGAACAAG
CCAGTTTTCAATCAACATCAGATTCTAAAGCATTTCCAAAAAAATCTACC
ACCAAAATTCCACGGTTGAGTTTATCTCCTAAACAAATTTCCTGCTCAAA
TATTCAATCAAAGGTTTCATTTGATCTGAATCAGAACACCACTAAACTAT
CTCAGTCGGCGTCATTCGAATTCAAGTCAGATCATTTAAAATCTCCAAAC
AAACAAATGATGACATCAAACAATTCAAAAACATCCAAAACTACAGAAAA
TCCCGTTAGAATATCGGTATTGAAATGCCGAATTTGTCTTGATCTTGAGA
AAAATGGTGAAAAATTAATGTCTCCCTGTCGATGCAAAGGAACAGTTGGA
TTGATGCATTCAACTTGTCTTGAGGAGTGGATAAGGATTTCCGAAAAAGA
GCAATGCGAAATTTGCAAATGTAATTATGACATGCGCAAGAAGAGAGCAG
ATATGCATATGTGGCTTAGACATATTTATATGCAAAGATCATTCATCGGA
GATGCGATGTGTTTCATTTTTCTCATTCCATCCACCACCATAGCTATATT
CTTTTGTATAAAGGCTGCGTTGTTCTTATTTTCACCAACAGGAATTGCAC
TAGAATCTCAAGCTCATTGGAGAGGCATAGGGTTAATATTCTTATCCGTT
TTACTAGTGTTATGTCTATTGATTTGGTTTATCTTCACTGTGAAACATTA
TCTGAAGCACTTTCGTCATTATCGATCTAACCAATATCGTTTTTCGATTC
ACAATCGTCGAAAAAGTACAATCAACCAAGGCACGCTTCGCTGTTGAGAG
GTTCTGTAATTTATGGAAATAAAATATTTTCAACTGTCCATACTAAAATT
GAACATCTAAAAATAGCAGCCAATCAAATTCAACCATTATAAGCAGATTT
TCTGGAGTCTGACTGCAAAATCTTTAGGTTTCTATTTCTTAATATGATAT
CGATGAAAGCCAAATAAACTAAAAACTATTTAGCATTAGAAATTTCAATG
AATATTAATATTTAAAAATTTTATGTACTTG
back to top

protein sequence of SMED30017271-orf-1

>SMED30017271-orf-1 ID=SMED30017271-orf-1|Name=SMED30017271-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=301bp
MELDKLSTPTASFVNKKSDFCPPGTPRPSNLRLEQASFQSTSDSKAFPKK
STTKIPRLSLSPKQISCSNIQSKVSFDLNQNTTKLSQSASFEFKSDHLKS
PNKQMMTSNNSKTSKTTENPVRISVLKCRICLDLEKNGEKLMSPCRCKGT
VGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIYMQRSF
IGDAMCFIFLIPSTTIAIFFCIKAALFLFSPTGIALESQAHWRGIGLIFL
SVLLVLCLLIWFIFTVKHYLKHFRHYRSNQYRFSIHNRRKSTINQGTLRC
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR011016Znf_RING-CH
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..29