H2A histone family, member Y

Overview
NameH2A histone family, member Y
Smed IDSMED30017270
Length (bp)1246
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of H2A histone family, member Y (SMED30017270) t-SNE clustered cells

Violin plots show distribution of expression levels for H2A histone family, member Y (SMED30017270) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of H2A histone family, member Y (SMED30017270) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for H2A histone family, member Y (SMED30017270) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017270

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017270h1SMcG0006091 Contig2797GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017270h1SMcG0006091 Contig2797GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30017270h1SMcG0006091 dd_Smed_v4_4487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017270h1SMcG0006091 dd_Smed_v4_4487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017270h1SMcG0006091 dd_Smed_v4_4487_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of H2A histone family, member Y vs. Ensembl Human
Match: MACROH2A1 (macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:4740])

HSP 1 Score: 184.882 bits (468), Expect = 5.582e-54
Identity = 151/369 (40.92%), Postives = 201/369 (54.47%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERT------------LFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G      P  LA K         + S GK    +    + K K  ++ K         K A K   K+   S++ S +   E T            LFLGQKL VVQ DI  + +DAVVHPT+  +  GG+VG++L  KGG +    V +LR     L+   AAVS    +P K++IH    S    A      LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK---------RGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHC--NSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 362          
BLAST of H2A histone family, member Y vs. Ensembl Human
Match: MACROH2A1 (macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:4740])

HSP 1 Score: 169.859 bits (429), Expect = 3.026e-48
Identity = 139/380 (36.58%), Postives = 199/380 (52.37%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHV------ILP------------STGR-------PLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V      +LP            S G+       P     K+ +  K VSK + GK       K+    K  +    T+                   + +    VL+ ++LFLGQKL ++  +I  +     +A+++PT+        +G++L  KGG +    V +LR     L+   AAVS    +P K++IH NSP W  +    +  LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKQGEVSKAASADSTTE------------------GTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEEL--LEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 364          
BLAST of H2A histone family, member Y vs. Ensembl Human
Match: MACROH2A2 (macroH2A.2 histone [Source:HGNC Symbol;Acc:HGNC:14453])

HSP 1 Score: 167.933 bits (424), Expect = 1.745e-47
Identity = 136/374 (36.36%), Postives = 203/374 (54.28%), Query Frame = 1
Query:   25 MTNKVIKQGFNK-SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKS-------LEVLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            M+ +  K+  +K S+S +AG+IFPV R  RYLKK    + +++IS+GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI+LA++ D E+NQ LK V + S G      P  LA K   GTK   K+ T     P K  +     K    K        SKK+  K+S ++ TS S S         +L+ ++L LGQKL + Q DI     M  + +VHPT+        +G +L   GG +    V +LR S+  L+  EAAVS +  +  K++IH         +      LE+ + N L +A+   ++S+A P   SG   +PKQ AA+  L+ I+++F   + S++K +YF+++D E++ +Y  E
Sbjct:    1 MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKK---GTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKK--RGTK--GKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHC--HIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. Ensembl Human
Match: MACROH2A1 (macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:4740])

HSP 1 Score: 107.071 bits (266), Expect = 5.496e-27
Identity = 54/100 (54.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGG 104          
BLAST of H2A histone family, member Y vs. Ensembl Human
Match: MACROH2A1 (macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:4740])

HSP 1 Score: 107.842 bits (268), Expect = 2.508e-25
Identity = 54/100 (54.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGG 104          

HSP 2 Score: 93.9745 bits (232), Expect = 1.486e-20
Identity = 72/183 (39.34%), Postives = 108/183 (59.02%), Query Frame = 1
Query:  559 VLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            VL+ ++LFLGQKL ++  +I  +     +A+++PT+        +G++L  KGG +    V +LR     L+   AAVS    +P K++IH NSP W  +    +  LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:  185 VLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEEL--LEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 97.0561 bits (240), Expect = 5.083e-24
Identity = 48/89 (53.93%), Postives = 64/89 (71.91%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+S +AGL FPV R HR+LK+R  SS R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   21 SRSARAGLQFPVGRIHRFLKQRTTSSGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATI 107          
BLAST of H2A histone family, member Y vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 97.0561 bits (240), Expect = 5.083e-24
Identity = 48/89 (53.93%), Postives = 64/89 (71.91%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+S +AGL FPV R HR+LK+R  SS R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   21 SRSARAGLQFPVGRIHRFLKQRTTSSGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATI 107          
BLAST of H2A histone family, member Y vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 97.0561 bits (240), Expect = 5.083e-24
Identity = 48/89 (53.93%), Postives = 64/89 (71.91%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+S +AGL FPV R HR+LK+R  SS R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   21 SRSARAGLQFPVGRIHRFLKQRTTSSGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATI 107          
BLAST of H2A histone family, member Y vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-21
Identity = 46/94 (48.94%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            S+S +AGL FPV R HR L+K    +   ++  GA VY A+VLEYL AE+ E AGNAAR  K  RI PRH+ LA+  D E+N+ L  V +   G
Sbjct:   18 SRSSRAGLQFPVGRLHRILRK---GNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGG 108          
BLAST of H2A histone family, member Y vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-21
Identity = 46/94 (48.94%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            S+S +AGL FPV R HR L+K    +   ++  GA VY A+VLEYL AE+ E AGNAAR  K  RI PRH+ LA+  D E+N+ L  V +   G
Sbjct:   18 SRSSRAGLQFPVGRLHRILRK---GNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGG 108          
BLAST of H2A histone family, member Y vs. Ensembl Fly
Match: His2Av (gene:FBgn0001197 transcript:FBtr0085062)

HSP 1 Score: 95.1301 bits (235), Expect = 3.621e-23
Identity = 47/89 (52.81%), Postives = 62/89 (69.66%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+S +AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSARAGLQFPVGRIHRHLKSRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Fly
Match: His2Av (gene:FBgn0001197 transcript:FBtr0334311)

HSP 1 Score: 95.1301 bits (235), Expect = 3.621e-23
Identity = 47/89 (52.81%), Postives = 62/89 (69.66%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+S +AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSARAGLQFPVGRIHRHLKSRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Fly
Match: His2A:CG33853 (gene:FBgn0053853 transcript:FBtr0091857)

HSP 1 Score: 86.6557 bits (213), Expect = 2.533e-20
Identity = 46/94 (48.94%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            S+S +AGL FPV R HR L+K    +   ++  GA VY A+V+EYL AE+ E AGNAAR  K  RI PRH+ LAI  D E+N+ L  V +   G
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRK---GNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGG 106          
BLAST of H2A histone family, member Y vs. Ensembl Fly
Match: His2A:CG33859 (gene:FBgn0053859 transcript:FBtr0091863)

HSP 1 Score: 86.6557 bits (213), Expect = 2.533e-20
Identity = 46/94 (48.94%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            S+S +AGL FPV R HR L+K    +   ++  GA VY A+V+EYL AE+ E AGNAAR  K  RI PRH+ LAI  D E+N+ L  V +   G
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRK---GNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGG 106          
BLAST of H2A histone family, member Y vs. Ensembl Fly
Match: His2A:CG33856 (gene:FBgn0053856 transcript:FBtr0091860)

HSP 1 Score: 86.6557 bits (213), Expect = 2.533e-20
Identity = 46/94 (48.94%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            S+S +AGL FPV R HR L+K    +   ++  GA VY A+V+EYL AE+ E AGNAAR  K  RI PRH+ LAI  D E+N+ L  V +   G
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRK---GNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGG 106          
BLAST of H2A histone family, member Y vs. Ensembl Zebrafish
Match: macroh2a1 (macroH2A.1 histone [Source:ZFIN;Acc:ZDB-GENE-060421-4796])

HSP 1 Score: 189.889 bits (481), Expect = 3.449e-56
Identity = 142/351 (40.46%), Postives = 203/351 (57.83%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            S+S +AG+IFPV R  R+ ++  P   +++IS+GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E++Q L+ V + + G      P  LA K E         S GK    V    S K  K    +K    K  + K     +    ++ +    VL+ ++LFLGQKL VVQ DI  + ++AVVHPT+  +  GG+VGS+L   GG +L++ V +LR S   L+   AA+S    +P K++IH    S +  +      LEK V N L  AD+  ++S+A PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:   14 SRSARAGVIFPVGRMLRFFRRGLP---KYRISVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELHQLLRGVTISAGGVLPNIHPELLAKKRE---------SRGKLEAAVTAPPSRKTSKTAAVRKLHSQKPSTGKRQSAKASGGQSASAGGFTVLSSKSLFLGQKLQVVQADIASIESEAVVHPTNSSFYMGGEVGSALEKIGGKELSDAVLELRKSNGPLEVAGAAISSGFGLPAKFVIHC--NSPAWGSDQCEEMLEKTVKNCLALADEQKLRSVAFPSIGSGRNGFPKQKAAQLILKAISSYFVTTMSSSIKTVYFVLFDNESIGIYVQE 350          
BLAST of H2A histone family, member Y vs. Ensembl Zebrafish
Match: macroh2a1 (macroH2A.1 histone [Source:ZFIN;Acc:ZDB-GENE-060421-4796])

HSP 1 Score: 189.889 bits (481), Expect = 3.449e-56
Identity = 142/351 (40.46%), Postives = 203/351 (57.83%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            S+S +AG+IFPV R  R+ ++  P   +++IS+GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E++Q L+ V + + G      P  LA K E         S GK    V    S K  K    +K    K  + K     +    ++ +    VL+ ++LFLGQKL VVQ DI  + ++AVVHPT+  +  GG+VGS+L   GG +L++ V +LR S   L+   AA+S    +P K++IH    S +  +      LEK V N L  AD+  ++S+A PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:   14 SRSARAGVIFPVGRMLRFFRRGLP---KYRISVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELHQLLRGVTISAGGVLPNIHPELLAKKRE---------SRGKLEAAVTAPPSRKTSKTAAVRKLHSQKPSTGKRQSAKASGGQSASAGGFTVLSSKSLFLGQKLQVVQADIASIESEAVVHPTNSSFYMGGEVGSALEKIGGKELSDAVLELRKSNGPLEVAGAAISSGFGLPAKFVIHC--NSPAWGSDQCEEMLEKTVKNCLALADEQKLRSVAFPSIGSGRNGFPKQKAAQLILKAISSYFVTTMSSSIKTVYFVLFDNESIGIYVQE 350          
BLAST of H2A histone family, member Y vs. Ensembl Zebrafish
Match: h2az2b (H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE-050506-24])

HSP 1 Score: 98.2117 bits (243), Expect = 2.445e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKTRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Zebrafish
Match: h2az2a (H2A.Z variant histone 2a [Source:NCBI gene;Acc:252913])

HSP 1 Score: 98.2117 bits (243), Expect = 2.848e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKTRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Zebrafish
Match: h2az2b (H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE-050506-24])

HSP 1 Score: 97.8265 bits (242), Expect = 2.906e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKTRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Xenopus
Match: cit (citron rho-interacting serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-981097])

HSP 1 Score: 109.383 bits (272), Expect = 6.211e-26
Identity = 81/185 (43.78%), Postives = 111/185 (60.00%), Query Frame = 1
Query:  544 SKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            S    VL+ ++LFLGQKL VV+ DI  + +DAVVHPTS     GG+VG++L  KGG +    V +L+     L    AAVS    +P K++IH    S S  +      LEK V N L  AD+  I+SIA PSI SG  G+PKQ AA+ IL+ I++YF     S+IK +YFV++D E++ +Y  E
Sbjct:  180 SDGFTVLSTKSLFLGQKLQVVKADIATIDSDAVVHPTSSDLYTGGEVGNALEKKGGKEFVEAVTELKKKNGPLDIAGAAVSSGHGLPAKFVIHC--NSPSWGSDKCEELLEKTVKNCLALADEKKIKSIAFPSIGSGRNGFPKQTAAQLILKAISNYFVSTMSSSIKTVYFVLFDSESIGIYVQE 362          

HSP 2 Score: 106.301 bits (264), Expect = 6.162e-25
Identity = 52/93 (55.91%), Postives = 66/93 (70.97%), Query Frame = 1
Query:   64 KSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            +S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:   15 RSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKSRVTPRHILLAVANDEELNQLLKGVTIASGG 104          
BLAST of H2A histone family, member Y vs. Ensembl Xenopus
Match: cit (citron rho-interacting serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-981097])

HSP 1 Score: 106.686 bits (265), Expect = 3.927e-25
Identity = 52/94 (55.32%), Postives = 67/94 (71.28%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            ++S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:    6 TRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKSRVTPRHILLAVANDEELNQLLKGVTIASGG 96          

HSP 2 Score: 93.5893 bits (231), Expect = 1.936e-20
Identity = 74/190 (38.95%), Postives = 112/190 (58.95%), Query Frame = 1
Query:  538 SQSKSLEVLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            + S    VL+ ++LFLGQKL ++  +I  +     +AV++PT+        +G++L  KGG +    V +L+     L    AAVS    +P K++IH NSPSW ++    +  LEK V N L  AD+  I+SIA PSI SG  G+PKQ AA+ IL+ I++YF     S+IK +YFV++D E++ +Y  E
Sbjct:  170 TPSDGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAVINPTNADIDLKDDIGNALEKKGGKEFVEAVTELKKKNGPLDIAGAAVSSGHGLPAKFVIHCNSPSWGSDKCEEL--LEKTVKNCLALADEKKIKSIAFPSIGSGRNGFPKQTAAQLILKAISNYFVSTMSSSIKTVYFVLFDSESIGIYVQE 357          
BLAST of H2A histone family, member Y vs. Ensembl Xenopus
Match: cit (citron rho-interacting serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-981097])

HSP 1 Score: 106.301 bits (264), Expect = 6.670e-25
Identity = 52/93 (55.91%), Postives = 66/93 (70.97%), Query Frame = 1
Query:   64 KSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            +S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:   15 RSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKSRVTPRHILLAVANDEELNQLLKGVTIASGG 104          

HSP 2 Score: 93.2041 bits (230), Expect = 2.318e-20
Identity = 74/190 (38.95%), Postives = 112/190 (58.95%), Query Frame = 1
Query:  538 SQSKSLEVLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            + S    VL+ ++LFLGQKL ++  +I  +     +AV++PT+        +G++L  KGG +    V +L+     L    AAVS    +P K++IH NSPSW ++    +  LEK V N L  AD+  I+SIA PSI SG  G+PKQ AA+ IL+ I++YF     S+IK +YFV++D E++ +Y  E
Sbjct:  178 TPSDGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAVINPTNADIDLKDDIGNALEKKGGKEFVEAVTELKKKNGPLDIAGAAVSSGHGLPAKFVIHCNSPSWGSDKCEEL--LEKTVKNCLALADEKKIKSIAFPSIGSGRNGFPKQTAAQLILKAISNYFVSTMSSSIKTVYFVLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. Ensembl Xenopus
Match: arrdc2 (arrestin domain containing 2 [Source:Xenbase;Acc:XB-GENE-946088])

HSP 1 Score: 98.2117 bits (243), Expect = 4.058e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKTRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Xenopus
Match: macroh2a2 (macroH2A.2 histone [Source:NCBI gene;Acc:448772])

HSP 1 Score: 101.293 bits (251), Expect = 3.267e-23
Identity = 49/94 (52.13%), Postives = 67/94 (71.28%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            S+S +AG+IFPV R  RYL++    + +++I +GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI+LA++ D E+NQ L+ V + S G
Sbjct:   14 SRSARAGVIFPVGRMMRYLRR---GTHKYRIGMGAPVYMAAVIEYLAAEILELAGNAARDNKKGRITPRHILLAVANDEELNQLLRGVTIASGG 104          

HSP 2 Score: 79.337 bits (194), Expect = 1.061e-15
Identity = 64/183 (34.97%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  559 VLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            +L+ ++L +GQKL + Q D+     M  + ++HPTS        +G++L   GG +    V +LR S   L+   AA+S A  +  K++IH + P W ++       LEK + N L  A+   ++S+A PS  SG  G+PKQ AA+ ILR I+S+F+  + S +K IYF+++D E++ +Y  E
Sbjct:  175 ILSSKSLMVGQKLSLTQSDLAHIGSMKVEGIIHPTSAEIDLKEDIGNALEKAGGKEFLEAVKELRKSHGPLELTGAALSQANGLAAKFVIHCHIPQWGSDKCEEQ--LEKTIKNCLSVAEDKKLKSVAFPSFPSGRNGFPKQTAAQVILRAISSHFSASSSSTVKNIYFLLFDSESIGIYVQE 355          
BLAST of H2A histone family, member Y vs. Ensembl Mouse
Match: Macroh2a1 (macroH2A.1 histone [Source:MGI Symbol;Acc:MGI:1349392])

HSP 1 Score: 184.111 bits (466), Expect = 8.284e-54
Identity = 149/369 (40.38%), Postives = 201/369 (54.47%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERT------------LFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G      P  LA K         + S GK    +    + K K  ++ K         K A K   K+   S++ S +   E T            LFLGQKL VVQ DI  + +DAVVHPT+  +  GG+VG++L  KGG +    V +LR     L+   AA+S    +P K++IH    S    A      LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YF+++D E++ +Y  E
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK---------RGSKGKLEAIITPPPAKKAKSPSQKKPVAKKTGGKKGARKSKKKQGEVSKAASADSTTEGTPTDGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYTGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPAKFVIHC--NSPVWGADKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFMLFDSESIGIYVQE 362          
BLAST of H2A histone family, member Y vs. Ensembl Mouse
Match: Macroh2a2 (macroH2A.2 histone [Source:MGI Symbol;Acc:MGI:3037658])

HSP 1 Score: 168.703 bits (426), Expect = 7.096e-48
Identity = 136/374 (36.36%), Postives = 204/374 (54.55%), Query Frame = 1
Query:   25 MTNKVIKQGFNK-SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKS-------LEVLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            M+ +  K+  +K S+S +AG+IFPV R  RYLKK    + +++IS+GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI+LA++ D E+NQ LK V + S G      P  LA K   GTK   K+ T     P K  +     K    K        SKK+  K+S ++ TS S S         +L+ ++L LGQKL + Q DI     M  + +VHPT+       ++G +L   GG +    V +LR S+  L+  EAAVS +  +  K++IH         +      LE+ + N L +A+   ++S+A P   SG   +PKQ AA+  L+ I+++F   + S++K +YF+++D E++ +Y  E
Sbjct:    1 MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKK---GTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKK--RGTK--GKSETILSPPPEKRGRKAASGKKGGKKSKATKPRTSKKSKAKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEEIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHC--HIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSSSSLKNVYFLLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. Ensembl Mouse
Match: Macroh2a1 (macroH2A.1 histone [Source:MGI Symbol;Acc:MGI:1349392])

HSP 1 Score: 107.457 bits (267), Expect = 1.918e-25
Identity = 54/100 (54.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGG 104          

HSP 2 Score: 92.4337 bits (228), Expect = 3.195e-20
Identity = 70/183 (38.25%), Postives = 108/183 (59.02%), Query Frame = 1
Query:  559 VLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            VL+ ++LFLGQKL ++  +I  +     +A+++PT+        +G++L  KGG +    V +LR     L+   AA+S    +P K++IH NSP W  +    +  LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YF+++D E++ +Y  E
Sbjct:  185 VLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPAKFVIHCNSPVWGADKCEEL--LEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFMLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. Ensembl Mouse
Match: H2az1 (H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI:1888388])

HSP 1 Score: 98.2117 bits (243), Expect = 2.748e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKSRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Mouse
Match: H2az2 (H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI:1924855])

HSP 1 Score: 98.2117 bits (243), Expect = 3.073e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKTRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. UniProt/SwissProt
Match: sp|Q02874|H2AY_RAT (Core histone macro-H2A.1 OS=Rattus norvegicus OX=10116 GN=Macroh2a1 PE=1 SV=4)

HSP 1 Score: 172.94 bits (437), Expect = 1.136e-48
Identity = 138/365 (37.81%), Postives = 193/365 (52.88%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTK-----SVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G      P  LA K  +  K     +   A   K     K        K    K  +  +V    +    ++  PT       VL+ ++LFLGQKL ++  +I  +     +A+++PT+        +GS+L  KGG +    V +LR     L+   AAVS    +P K++IH    S    A      LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVAKKTGGKKGARKSKKQGEVSKAASADSTTEGAPTD---GFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGSTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHC--NSPVWGADKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 364          
BLAST of H2A histone family, member Y vs. UniProt/SwissProt
Match: sp|Q8CCK0|H2AW_MOUSE (Core histone macro-H2A.2 OS=Mus musculus OX=10090 GN=Macroh2a2 PE=1 SV=3)

HSP 1 Score: 168.703 bits (426), Expect = 4.963e-47
Identity = 136/374 (36.36%), Postives = 204/374 (54.55%), Query Frame = 1
Query:   25 MTNKVIKQGFNK-SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKS-------LEVLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            M+ +  K+  +K S+S +AG+IFPV R  RYLKK    + +++IS+GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI+LA++ D E+NQ LK V + S G      P  LA K   GTK   K+ T     P K  +     K    K        SKK+  K+S ++ TS S S         +L+ ++L LGQKL + Q DI     M  + +VHPT+       ++G +L   GG +    V +LR S+  L+  EAAVS +  +  K++IH         +      LE+ + N L +A+   ++S+A P   SG   +PKQ AA+  L+ I+++F   + S++K +YF+++D E++ +Y  E
Sbjct:    1 MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKK---GTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKK--RGTK--GKSETILSPPPEKRGRKAASGKKGGKKSKATKPRTSKKSKAKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEEIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHC--HIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSSSSLKNVYFLLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. UniProt/SwissProt
Match: sp|Q9P0M6|H2AW_HUMAN (Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=MACROH2A2 PE=1 SV=3)

HSP 1 Score: 167.933 bits (424), Expect = 8.378e-47
Identity = 136/374 (36.36%), Postives = 203/374 (54.28%), Query Frame = 1
Query:   25 MTNKVIKQGFNK-SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKS-------LEVLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            M+ +  K+  +K S+S +AG+IFPV R  RYLKK    + +++IS+GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI+LA++ D E+NQ LK V + S G      P  LA K   GTK   K+ T     P K  +     K    K        SKK+  K+S ++ TS S S         +L+ ++L LGQKL + Q DI     M  + +VHPT+        +G +L   GG +    V +LR S+  L+  EAAVS +  +  K++IH         +      LE+ + N L +A+   ++S+A P   SG   +PKQ AA+  L+ I+++F   + S++K +YF+++D E++ +Y  E
Sbjct:    1 MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKK---GTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKK--RGTK--GKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHC--HIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. UniProt/SwissProt
Match: sp|O93327|H2AY_CHICK (Core histone macro-H2A.1 OS=Gallus gallus OX=9031 GN=MACROH2A1 PE=1 SV=3)

HSP 1 Score: 167.933 bits (424), Expect = 9.110e-47
Identity = 139/372 (37.37%), Postives = 195/372 (52.42%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNE------------RTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G      P  LA K         + S GK    +    + K K  ++ K         K A K   K+   S+S S +   E            ++LFLGQKL ++  +I  +     +A+++PT+        +GS+L  KGG +    V +LR     L    A VS    +P K++IH    S    +      LEK V N L  AD+  ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK---------RGSKGKLEAIITPPPAKKAKSPSQKKTVSKKTGGKKGARKSKKKQGEVSKSASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGSTLEKKGGKEFVEAVIELRKKNGPLDIAGAVVSAGHGLPAKFVIHC--NSPGWGSDKCEELLEKTVKNCLALADEKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. UniProt/SwissProt
Match: sp|O75367|H2AY_HUMAN (Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=4)

HSP 1 Score: 107.842 bits (268), Expect = 1.205e-24
Identity = 54/100 (54.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            K+    S+S KAG+IFPV R  RY+KK  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + S G
Sbjct:    8 KKSTKTSRSAKAGVIFPVGRMLRYIKKGHP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGG 104          

HSP 2 Score: 93.9745 bits (232), Expect = 7.136e-20
Identity = 72/183 (39.34%), Postives = 108/183 (59.02%), Query Frame = 1
Query:  559 VLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            VL+ ++LFLGQKL ++  +I  +     +A+++PT+        +G++L  KGG +    V +LR     L+   AAVS    +P K++IH NSP W  +    +  LEK V N L  AD   ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:  185 VLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEEL--LEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 365          
BLAST of H2A histone family, member Y vs. TrEMBL
Match: W4YF99 (Macro domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.065e-58
Identity = 160/359 (44.57%), Postives = 218/359 (60.72%), Query Frame = 1
Query:   46 QGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLE---VLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            +G + S+S KAG++FPV R  RYL+    S+  ++I  GA VY A+V+EYL AEI E AGNAAR  K  R+ PRHI+LA++ D E++  LK+V + S G      P  L  K   G+K+ S    G+ T               K +   + K   KKA          S+ K++    +L E+ LFLGQKL VV+ D+ E+TADA+VHPT+  Y   G+VGS+L   GG     EV KLR ++ SL    AA+  A N+P KY+IHVNSPSW    + +   LEK + N L  AD+ +I SIAIPS+SSG  G+PKQ+AAETILRTI+ YF  V  S++KQIYFV++D+E+++VY  E
Sbjct:   19 RGKSTSRSAKAGVLFPVGRMDRYLRM---STHHYRIGSGAPVYLAAVIEYLTAEILELAGNAARDNKKARVTPRHILLAVANDEELHHLLKNVTIASGGVLPQIHPELLMKK--RGSKAKSVFDFGQKTPAAVPVPKKPKTPAEKKQLPAVKKPVVKKAALTPKPNAAVSKGKTISGKSILGEKKLFLGQKLTVVKADLTEITADALVHPTNSTYAMAGEVGSALEKVGGRAFVEEVAKLRAAQ-SLDISGAAICPAHNLPAKYVIHVNSPSWGGANAVSN--LEKCIKNCLALADEKNITSIAIPSVSSGRAGFPKQIAAETILRTISHYFVSVMASSLKQIYFVLFDQESVEVYVTE 369          
BLAST of H2A histone family, member Y vs. TrEMBL
Match: R7TQH7 (Macro domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_2551 PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 2.536e-56
Identity = 141/357 (39.50%), Postives = 200/357 (56.02%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGT-----KSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            +++S +AG++FPV R HR+LK R   +  F+IS  A VY A+V+EYL AEI E AGNAAR  +  RI PRHI+LAI+ D E++Q L+HV + S G      P  L+ K  + +      SV   S   P    + K         K    + I   +  + K  S   P +   +  +L+E+ LFLGQKL V+QGDIV + ADA++HPT+     GG+VG ++   GG +   EV  L  +   L    A +    N P K++IH           ++   LE+ V N L  AD+  ++S+A PSI SG  G+PKQ AA+ ILR IN+YF  V  S++KQIYFV+YD E++ VY +E
Sbjct:   13 RTRSARAGVLFPVGRMHRFLKAR---THHFRISAAAPVYQAAVIEYLTAEILELAGNAARDNRKARITPRHILLAIANDEELHQLLRHVTIASGGVLPKIHPELLSRKKTSKSLFTPPPSVEPMSPASPPPVKRQKVVPTSPAARKMPPKKAILSAAGASAKGESSGGPAADPGAFTILSEKKLFLGQKLTVLQGDIVNVVADAIIHPTNASLYMGGEVGQTIERTGGKEFQQEVKDLLSTNGDLDTAGALLCRGYNFPAKFVIHC--NGPRWKDVDSQQLLEQTVKNCLSLADEKQLKSLAFPSIGSGRAGFPKQTAAQIILRAINNYFVTVVSSSLKQIYFVLYDMESIGVYTSE 364          
BLAST of H2A histone family, member Y vs. TrEMBL
Match: A0A3P8WFS2 (H2A histone family, member Y OS=Cynoglossus semilaevis OX=244447 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.192e-55
Identity = 147/351 (41.88%), Postives = 196/351 (55.84%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E+NQ LK V + + G      P  LA K     K  S  S      P   KKS   K   +  + +  K                S   S  VL+ ++LFLGQKL VVQ DI  + +DAVVHPT+     GGQVGS+L  KGG + T+ + +L+     L+   A ++  V +P KYIIH    S    +      LEK V N L  AD+  ++S+A PSI SG  G+PKQ AA+ IL+ I+SYF     S IK +YFV++D E++ +Y  E
Sbjct:   14 SRSTKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYLAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELNQLLKGVTIAAGGVLPNIHPELLAKKRGAKGKLESPVSPAPEKKPKPVKKSAAKKLSGRKGRGKAKKQGEVSKAASADSTTEGSPGDSFTVLSTKSLFLGQKLQVVQADISIVESDAVVHPTNSSLYTGGQVGSALEKKGGKEFTDALQELKKKNGPLEVAGAVLTTGVGLPAKYIIHC--NSPGWGSDKCEELLEKTVKNCLALADEKKLKSVAFPSIGSGSNGFPKQTAAQLILKAISSYFVATMSSTIKTVYFVLFDSESIGIYVQE 359          
BLAST of H2A histone family, member Y vs. TrEMBL
Match: A0A3Q3GYK0 (H2A histone family, member Y OS=Labrus bergylta OX=56723 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 2.740e-55
Identity = 144/357 (40.34%), Postives = 198/357 (55.46%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E+NQ LK V + + G      P  LA K     K  +  S      P   KKST  K   +    +  K                S   S  VL+ ++LFLGQKL VVQ DI  + +DAVVHPT+     GG+VG++L  KGG + T+ V +L+     L+   A ++G   +P KY+IH    S    +      L+K V N L  AD+  ++S+A PS+ SG  G+PKQ AA+ IL+ I+SYF     S IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSTKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYLAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELNQLLKGVTIAAGGVLPNIHPELLAKKRGAKGKLEAPVSPAPEKKPKPIKKSTAKKTSGRKPGGKAKKQGELSKAATADSTTEGSPGDSFTVLSTKSLFLGQKLQVVQADISIVESDAVVHPTNSSLYTGGEVGNALEKKGGKEFTDAVQELKKKNGPLEVAGAVLTGGFGLPAKYVIHC--NSPGWGSDKCEEMLDKTVKNCLALADEKKLKSVAFPSVGSGRNGFPKQTAAQLILKAISSYFVATMSSTIKTVYFVLFDSESIGIYVQE 359          
BLAST of H2A histone family, member Y vs. TrEMBL
Match: A0A3Q4H4U6 (H2A histone family, member Y OS=Neolamprologus brichardi OX=32507 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 9.186e-55
Identity = 146/357 (40.90%), Postives = 198/357 (55.46%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E+NQ LK V + + G      P  LA K     K  +  S      P   KK+T  K   K    +  K                S S S  VL+ ++LFLGQKL VVQ DI  + +DAVVHPT+     GG+VGS+L  KGG + T+ V +L+     L+   A ++    +P KY+IH    S    +      L+K V N L  AD+  ++S+A PSI SG  G+PKQ AA+ IL+ I+SYF     S IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSTKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYLAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELNQLLKGVTIAAGGVLPNIHPELLAKKRGAKGKLETPVSPAPEKKPKPVKKTTAKKLSGKKAGGKAKKQGEVSKAASADSTTEGSPSDSFTVLSTKSLFLGQKLQVVQADISIVESDAVVHPTNSSLYTGGEVGSALEKKGGKEFTDAVQELKKKNGPLEVAGAVLTAGFGLPAKYVIHC--NSPGWGSDKCEEMLDKTVKNCLALADEKKLKSVAFPSIGSGRNGFPKQTAAQLILKAISSYFVATMSSTIKTVYFVLFDSESIGIYVQE 359          
BLAST of H2A histone family, member Y vs. Ensembl Cavefish
Match: macroh2a1 (core histone macro-H2A.1 [Source:NCBI gene;Acc:103035252])

HSP 1 Score: 190.274 bits (482), Expect = 8.858e-56
Identity = 140/357 (39.22%), Postives = 196/357 (54.90%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + + G      P  LA K   G+K   +A    P                +  K      K   +   ++     S S    VL+ ++LFLGQKL VVQ DI  + +DAV+HPT+     GG+VGS+L  KGG +    V +LR     L+   A ++    +P K++IH    S    +      L+K V N L  AD+  ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:   65 KKSTKTSRSTKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIAAGGVLPNIHPELLAKK--RGSKGKLEAVITPPPAKKSKSTKKSGTAKKQGTKKSSRTKKGDGSKSASADSTTDSPSDGFTVLSTKSLFLGQKLQVVQADITTIDSDAVIHPTNSSLYTGGEVGSALEKKGGKEFVEAVLELRKKNGPLEVAGAVLTSGYGLPAKFVIHC--NSPGWGSDKCEEMLDKTVKNCLALADEKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 414          
BLAST of H2A histone family, member Y vs. Ensembl Cavefish
Match: macroh2a1 (core histone macro-H2A.1 [Source:NCBI gene;Acc:103035252])

HSP 1 Score: 172.17 bits (435), Expect = 2.392e-49
Identity = 130/360 (36.11%), Postives = 190/360 (52.78%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + + G      P  LA K   G+K   +A    P                +  K      K   +   ++     S S    VL+ ++LFLGQKL ++  +I  +     + V++PT+        +GS+L  KGG +    V +LR     L+   A ++    +P K++IH    S    +      L+K V N L  AD+  ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSTKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIAAGGVLPNIHPELLAKK--RGSKGKLEAVITPPPAKKSKSTKKSGTAKKQGTKKSSRTKKGDGSKSASADSTTDSPSDGFTVLSTKSLFLGQKLNLIHSEISNLAGFDVEGVINPTNADIDLKDDLGSALEKKGGKEFVEAVLELRKKNGPLEVAGAVLTSGYGLPAKFVIHC--NSPGWGSDKCEEMLDKTVKNCLALADEKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 360          
BLAST of H2A histone family, member Y vs. Ensembl Cavefish
Match: macroh2a2 (core histone macro-H2A.2 [Source:NCBI gene;Acc:103028519])

HSP 1 Score: 157.147 bits (396), Expect = 8.348e-44
Identity = 121/354 (34.18%), Postives = 188/354 (53.11%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGD---IVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            S+S +AG+IFPV R  RYL+     + +++I +GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI LA++ D E+NQ L+ V + + G      P  L+ K  +  K  S+A T + T           KK       +  K         N+      +     +L+ ++LFLGQKL + + +   I  +  + +++PT+        VG++L   GG D  + V +LR S   L+   A VS A  +  ++IIH         +      LEK V N L +A++  ++S+A PS+ +G  G+PKQ AA+ IL+ I+++F     S++K IYFV++D E++ +Y  E
Sbjct:   14 SRSSRAGVIFPVGRMMRYLRT---GTHKYRIGMGAPVYMAAVIEYLAAEILELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGSRVKVDSQAITPEKTEKQSKSNKRSAKKGRGKPGRKPRKTTENDKDGSNTVDDGPGE--GFTILSAKSLFLGQKLSLTESELSKIGNIKVEGIINPTNADIDLKDGVGNALEKAGGKDFLDAVKELRKSHSPLEVASAVVSQASGMAARFIIHC--NVPQWGSERCEDQLEKTVKNCLSAAEEKKLKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSATTSSLKNIYFVLFDSESIGIYLQE 360          
BLAST of H2A histone family, member Y vs. Ensembl Cavefish
Match: macroh2a1 (core histone macro-H2A.1 [Source:NCBI gene;Acc:103035252])

HSP 1 Score: 106.686 bits (265), Expect = 1.772e-25
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LA++ D E+NQ LK V + + G
Sbjct:    8 KKSTKTSRSTKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIAAGG 104          

HSP 2 Score: 92.8189 bits (229), Expect = 1.287e-20
Identity = 72/169 (42.60%), Postives = 104/169 (61.54%), Query Frame = 1
Query:  592 KLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            KL VVQ DI  + +DAV+HPT+     GG+VGS+L  KGG +    V +LR     L+   A ++    +P K++IH NSP W ++    +  L+K V N L  AD+  ++SIA PSI SG  G+PKQ AA+ IL+ I+SYF     S+IK +YFV++D E++ +Y  E
Sbjct:  157 KLQVVQADITTIDSDAVIHPTNSSLYTGGEVGSALEKKGGKEFVEAVLELRKKNGPLEVAGAVLTSGYGLPAKFVIHCNSPGWGSDKCEEM--LDKTVKNCLALADEKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQE 323          
BLAST of H2A histone family, member Y vs. Ensembl Cavefish
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:103037668])

HSP 1 Score: 98.2117 bits (243), Expect = 2.413e-24
Identity = 48/89 (53.93%), Postives = 63/89 (70.79%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+SQ+AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   19 SRSQRAGLQFPVGRIHRHLKTRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 105          
BLAST of H2A histone family, member Y vs. Ensembl Sea Lamprey
Match: macroh2a2 (macroH2A.2 histone [Source:ZFIN;Acc:ZDB-GENE-050913-114])

HSP 1 Score: 108.997 bits (271), Expect = 7.294e-27
Identity = 80/182 (43.96%), Postives = 114/182 (62.64%), Query Frame = 1
Query:  544 SKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVY 1089
            S ++ VL+ +TLFLGQKL VV+ DI  +  DAV+HPT   +  GGQVG++L+ KGG +L + V  LR S   L    AA+S A  +  + +IH    S S     +   LEK V N L  AD+  + ++A+PSI SGG G+PKQ AA+ IL+ I++YF     S++K IYFV+YD E++ +Y
Sbjct:  174 SGAVTVLSSKTLFLGQKLQVVKADIATLKCDAVIHPTGNNFYMGGQVGNALAKKGGKELADAVQNLRNSNGPLDIAGAAMSLAPGLEAENVIHC--NSPSWGTDRSAELLEKTVKNCLALADEKKLVTVALPSIGSGGNGFPKQTAAQLILKAISNYFISTMDSSLKNIYFVLYDSESIGIY 353          

HSP 2 Score: 84.3445 bits (207), Expect = 2.737e-18
Identity = 43/95 (45.26%), Postives = 62/95 (65.26%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            +S+S +AGL+FPV R  RYL+       R +I++GA +Y A+V EYL AE+ E AGN AR     RI PRHI L+++ D E+ + L+ V + S+G
Sbjct:   13 QSRSARAGLLFPVGRMLRYLRTGI---YRKRIAMGAPIYLAAVTEYLAAEVLELAGNIARDSMKARITPRHIHLSMALDEELQKMLRGVTIASSG 104          
BLAST of H2A histone family, member Y vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005345.1 (pep scaffold:Pmarinus_7.0:GL476820:833184:834000:-1 gene:ENSPMAG00000004868.1 transcript:ENSPMAT00000005345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 5.510e-22
Identity = 47/95 (49.47%), Postives = 61/95 (64.21%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            KS+S +AGL FP+ R HR L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LA+  D E+N+ +  V +P  G
Sbjct:   16 KSRSSRAGLQFPMRRVHRLLRK---GNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDKELNKLMGGVTIPQGG 107          
BLAST of H2A histone family, member Y vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011253.1 (pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-1 gene:ENSPMAG00000010226.1 transcript:ENSPMAT00000011253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 7.772e-22
Identity = 49/95 (51.58%), Postives = 60/95 (63.16%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            KS+S +AGL FPV R HR L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LAI  D E+N+ L  V +   G
Sbjct:   16 KSRSSRAGLQFPVGRVHRLLRK---GNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGG 107          
BLAST of H2A histone family, member Y vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005338.1 (pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-1 gene:ENSPMAG00000004859.1 transcript:ENSPMAT00000005338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 2.451e-21
Identity = 47/95 (49.47%), Postives = 60/95 (63.16%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            KS+S +AGL FPV R HR L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LA+  D E+N+ +  V +   G
Sbjct:   16 KSRSSRAGLQFPVGRVHRLLRK---GNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGG 107          
BLAST of H2A histone family, member Y vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002388.1 (pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1 gene:ENSPMAG00000002177.1 transcript:ENSPMAT00000002388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 4.080e-21
Identity = 47/95 (49.47%), Postives = 60/95 (63.16%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            KS+S +AGL FPV R HR L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LA+  D E+N+ +  V +   G
Sbjct:   16 KSRSSRAGLQFPVGRVHRLLRK---GNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGG 107          
BLAST of H2A histone family, member Y vs. Ensembl Yeast
Match: HTA2 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p [Source:SGD;Acc:S000000099])

HSP 1 Score: 87.8113 bits (216), Expect = 1.938e-21
Identity = 48/95 (50.53%), Postives = 60/95 (63.16%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            +S+S KAGL FPV R HR L++    +   +I  GA VY  +VLEYL AEI E AGNAAR  K  RI PRH+ LAI  D E+N+ L +V +   G
Sbjct:   17 QSRSAKAGLTFPVGRVHRLLRR---GNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGG 108          
BLAST of H2A histone family, member Y vs. Ensembl Yeast
Match: HTA1 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p; N-terminally propionylated in vivo [Source:SGD;Acc:S000002633])

HSP 1 Score: 87.8113 bits (216), Expect = 1.938e-21
Identity = 48/95 (50.53%), Postives = 60/95 (63.16%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            +S+S KAGL FPV R HR L++    +   +I  GA VY  +VLEYL AEI E AGNAAR  K  RI PRH+ LAI  D E+N+ L +V +   G
Sbjct:   17 QSRSAKAGLTFPVGRVHRLLRR---GNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGG 108          
BLAST of H2A histone family, member Y vs. Ensembl Yeast
Match: HTZ1 (Histone variant H2AZ; exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin; Htz1p-containing nucleosomes facilitate RNA Pol II passage by affecting correct assembly and modification status of RNA Pol II elongation complexes and by favoring efficient nucleosome remodeling [Source:SGD;Acc:S000005372])

HSP 1 Score: 87.4261 bits (215), Expect = 2.374e-21
Identity = 48/109 (44.04%), Postives = 67/109 (61.47%), Query Frame = 1
Query:   73 KAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI-----LPSTGRPLNLAVKTENGTK 384
            +AGL FPV R  RYLK+   ++ R ++   AA+Y  +VLEYL AE+ E AGNAA+ +KVKRI PRH+ LAI  D E++  ++  I     LP   + L L V+ +   K
Sbjct:   28 RAGLQFPVGRIKRYLKRH--ATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSKK 134          
BLAST of H2A histone family, member Y vs. Ensembl Nematostella
Match: EDO45515 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RST0])

HSP 1 Score: 188.348 bits (477), Expect = 3.360e-56
Identity = 145/359 (40.39%), Postives = 201/359 (55.99%), Query Frame = 1
Query:   31 NKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLA---VKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
             K  K+    S+S KAGL FPVSR HRYL+K    +  ++IS  A VY A+V+EYL AEI E AGNAAR  K  RI PRHI+LA++ D E+++ LK V + S G   N+    +K   G K VS                    K  K K       K   + KK   +          VL+E+TLFLGQKL VVQGDI  + ADAVV PT+  +   G+VG +L   GG +  +E+ KL      L   +AA+    N P  Y+I ++SP +S +++ A  +LEKAV N+L  AD+ +++ +AIPSI +G   YPK +AA+  L+ I++YF     S++KQIYFV+ D E + +Y  E
Sbjct:    6 GKAAKRAKAVSRSAKAGLQFPVSRVHRYLRK---CTHHYRISAAAPVYQAAVMEYLTAEILELAGNAARDNKKTRIIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKGGKLVSPEEL----------------KSKKPKPAPPPSPKKPVSSKKGRGKADKGPGDGFSVLSEKTLFLGQKLTVVQGDIAAIDADAVVLPTNAKFKLEGEVGEALKKAGGKEFKDEIKKLSEDNGDLALLDAAICDGHNFPAAYVISLHSPVYSEDSTTASDDLEKAVKNVLTIADEKNLKILAIPSIGTGSNKYPKDLAAQVTLKAISNYFVSAMASSLKQIYFVLSDPENIGMYTME 345          
BLAST of H2A histone family, member Y vs. Ensembl Nematostella
Match: EDO46289 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQH8])

HSP 1 Score: 95.1301 bits (235), Expect = 9.841e-24
Identity = 47/89 (52.81%), Postives = 62/89 (69.66%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVI 327
            S+S +AGL FPV R HR+LK R  S  R  +   AAVY+A++LEYL AE+ E AGNA++ +KVKRI PRH+ LAI  D E++  +K  I
Sbjct:   18 SRSARAGLQFPVGRIHRHLKNRTTSHGR--VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATI 104          
BLAST of H2A histone family, member Y vs. Ensembl Nematostella
Match: EDO49641 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RFQ0])

HSP 1 Score: 92.0485 bits (227), Expect = 1.907e-22
Identity = 47/95 (49.47%), Postives = 62/95 (65.26%), Query Frame = 1
Query:   58 KSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            K++S +AGL FPV R HR+L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LA+  D E+N+ L+ V +   G
Sbjct:   15 KTRSSRAGLQFPVGRIHRFLRK---GNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVTIAQGG 106          
BLAST of H2A histone family, member Y vs. Ensembl Nematostella
Match: EDO46356 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQF5])

HSP 1 Score: 90.8929 bits (224), Expect = 3.404e-22
Identity = 49/96 (51.04%), Postives = 61/96 (63.54%), Query Frame = 1
Query:   55 NKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
             KS+S KAGL FPV R HR+L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LA+  D E+N+ L  V +   G
Sbjct:   14 GKSRSAKAGLQFPVGRVHRFLRK---GNYAKRVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGG 106          
BLAST of H2A histone family, member Y vs. Ensembl Nematostella
Match: EDO46397 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RPX5])

HSP 1 Score: 90.1225 bits (222), Expect = 4.621e-22
Identity = 47/96 (48.96%), Postives = 63/96 (65.62%), Query Frame = 1
Query:   55 NKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            +K++S +AGL FPV R HR+L+K    +   ++  GA VY A+VLEYL AEI E AGNAAR  K  RI PRH+ LA+  D E+N+ L+ V +   G
Sbjct:    7 SKTRSSRAGLQFPVGRIHRHLRK---GNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLRGVTIAQGG 99          
BLAST of H2A histone family, member Y vs. Ensembl Medaka
Match: macroh2a1 (core histone macro-H2A.1 [Source:NCBI gene;Acc:101170450])

HSP 1 Score: 190.274 bits (482), Expect = 2.426e-56
Identity = 140/357 (39.22%), Postives = 194/357 (54.34%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E+N  LK V + + G      P  LA K     K  +  S          KK    K   K    +  +                S + +  VL+ ++LFLGQKL VVQ DI  + +DAV+HPT+     GG+VGS+L  KGG + T+ V +L+     L+   A ++    +P KY+IH    S    +      LEK V N L  AD+  ++S+A PSI SG  G+PKQ AA+ IL+ I+SYF     S IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSVKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYLAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELNMLLKGVTIAAGGVLPNIHPELLAKKRGAKGKLETPVSPAPEKKLKTAKKPAAKKMSRKKAGGKAKRQGEVSKTASADSTTEGSPADNFTVLSTKSLFLGQKLQVVQADISIVESDAVIHPTNSSLHTGGEVGSALEKKGGKEFTDAVQELKKKNGPLEVAGATLTAGFGLPAKYVIHC--NSPGWGSDKCEEMLEKTVKNCLALADEKKLKSVAFPSIGSGRNGFPKQTAAQLILKAISSYFVATMSSTIKTVYFVLFDSESIGIYVQE 359          
BLAST of H2A histone family, member Y vs. Ensembl Medaka
Match: macroh2a1 (core histone macro-H2A.1 [Source:NCBI gene;Acc:101170450])

HSP 1 Score: 173.711 bits (439), Expect = 5.672e-50
Identity = 129/360 (35.83%), Postives = 188/360 (52.22%), Query Frame = 1
Query:   43 KQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTA---DAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            K+    S+S KAG+IFPV R  RY+K+  P   +++I +GA VY A+VLEYL AEI E AGNAAR  K  R+ PRHI+LAI+ D E+N  LK V + + G      P  LA K     K  +  S          KK    K   K    +  +                S + +  VL+ ++LFLGQKL ++  ++  +     + V++PT+        +GS+L  KGG + T+ V +L+     L+   A ++    +P KY+IH    S    +      LEK V N L  AD+  ++S+A PSI SG  G+PKQ AA+ IL+ I+SYF     S IK +YFV++D E++ +Y  E
Sbjct:    8 KKSTKTSRSVKAGVIFPVGRMLRYIKRGLP---KYRIGVGAPVYLAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAIANDEELNMLLKGVTIAAGGVLPNIHPELLAKKRGAKGKLETPVSPAPEKKLKTAKKPAAKKMSRKKAGGKAKRQGEVSKTASADSTTEGSPADNFTVLSTKSLFLGQKLNLIHSEVSNLAGFDVEGVINPTNAELELKDDLGSALEKKGGKEFTDAVQELKKKNGPLEVAGATLTAGFGLPAKYVIHC--NSPGWGSDKCEEMLEKTVKNCLALADEKKLKSVAFPSIGSGRNGFPKQTAAQLILKAISSYFVATMSSTIKTVYFVLFDSESIGIYVQE 362          
BLAST of H2A histone family, member Y vs. Ensembl Medaka
Match: macroh2a2 (core histone macro-H2A.2 [Source:NCBI gene;Acc:101166735])

HSP 1 Score: 152.14 bits (383), Expect = 1.178e-41
Identity = 128/379 (33.77%), Postives = 205/379 (54.09%), Query Frame = 1
Query:    4 IVNFNI*MTNKVIKQGFNK-----SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKAST-GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            +V ++    NK+  +G  K     S+S +AG+IFPV R  RYL+     + +++I +GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI LA++ D E+NQ L+ V + + G      P  L+ K  +  K+ S+AS   K     K+KK  K  K  K K+ +  K          +            +L+ ++LFLGQKL + + +I +   +  +A+++PT+        VG +L   GG +    V +LR ++  L+    AVS A  +  ++IIH         +      LEK+V + L +A+   ++S+A PS+ +G  G+PKQ AA+ IL+ I+++F   + S++K IYFV++D E++ +Y  E
Sbjct:   17 VVTWSTVRQNKMSARGGKKKVTKLSRSSRAGVIFPVGRMMRYLRT---GTHKYRIGMGAPVYMAAVIEYLAAEILELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGSRVKTDSQASVPDKQEERSKSKKPVKAFKKVKGKRGRRPKGTDNDRDSVATSAMEDGPGDGFTILSTKSLFLGQKLSLTESEISKIGFIKVEAIINPTNAEMDLKDGVGGALEKAGGREFLEGVKELRKAQGPLEVASVAVSQASGMAARFIIHC--NVPQWGSEKCEDQLEKSVKSCLTAAEDKKLKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSSSSSSLKNIYFVLFDSESIGIYLQE 390          
BLAST of H2A histone family, member Y vs. Ensembl Medaka
Match: macroh2a2 (core histone macro-H2A.2 [Source:NCBI gene;Acc:101166735])

HSP 1 Score: 150.599 bits (379), Expect = 2.504e-41
Identity = 123/355 (34.65%), Postives = 195/355 (54.93%), Query Frame = 1
Query:   61 SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKAST-GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVE---MTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            S+S +AG+IFPV R  RYL+     + +++I +GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI LA++ D E+NQ L+ V + + G      P  L+ K  +  K+ S+AS   K     K+KK  K  K  K K+ +  K          +            +L+ ++LFLGQKL + + +I +   +  +A+++PT+        VG +L   GG +    V +LR ++  L+    AVS A  +  ++IIH         +      LEK+V + L +A+   ++S+A PS+ +G  G+PKQ AA+ IL+ I+++F   + S++K IYFV++D E++ +Y  E
Sbjct:   14 SRSSRAGVIFPVGRMMRYLRT---GTHKYRIGMGAPVYMAAVIEYLAAEILELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGSRVKTDSQASVPDKQEERSKSKKPVKAFKKVKGKRGRRPKGTDNDRDSVATSAMEDGPGDGFTILSTKSLFLGQKLSLTESEISKIGFIKVEAIINPTNAEMDLKDGVGGALEKAGGREFLEGVKELRKAQGPLEVASVAVSQASGMAARFIIHC--NVPQWGSEKCEDQLEKSVKSCLTAAEDKKLKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSSSSSSLKNIYFVLFDSESIGIYLQE 363          
BLAST of H2A histone family, member Y vs. Ensembl Medaka
Match: macroh2a2 (core histone macro-H2A.2 [Source:NCBI gene;Acc:101166735])

HSP 1 Score: 150.984 bits (380), Expect = 4.965e-41
Identity = 127/370 (34.32%), Postives = 201/370 (54.32%), Query Frame = 1
Query:   31 NKVIKQGFNK-----SKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG-----RPLNLAVKTENGTKSVSKAST-GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMT---ADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIHVXXXXXXXXXXXXXXXLEKAVNNILDSADQFDXXXXXXXXXXXXXXXYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKETLDVYKAE 1098
            NK+  +G  K     S+S +AG+IFPV R  RYL+     + +++I +GA VY A+V+EYL AEI E AGNAAR  K  RI PRHI LA++ D E+NQ L+ V + + G      P  L+ K  +  K+ S+AS   K     K+KK  K  K  K K+ +  K          +            +L+ ++LFLGQKL + + +I ++     +A+++PT+        VG +L   GG +    V +LR ++  L+    AVS A  +  ++IIH         +      LEK+V + L +A+   ++S+A PS+ +G  G+PKQ AA+ IL+ I+++F   + S++K IYFV++D E++ +Y  E
Sbjct:   40 NKMSARGGKKKVTKLSRSSRAGVIFPVGRMMRYLR---TGTHKYRIGMGAPVYMAAVIEYLAAEILELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGSRVKTDSQASVPDKQEERSKSKKPVKAFKKVKGKRGRRPKGTDNDRDSVATSAMEDGPGDGFTILSTKSLFLGQKLSLTESEISKIGFIKVEAIINPTNAEMDLKDGVGGALEKAGGREFLEGVKELRKAQGPLEVASVAVSQASGMAARFIIHC--NVPQWGSEKCEDQLEKSVKSCLTAAEDKKLKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSSSSSSLKNIYFVLFDSESIGIYLQE 404          
BLAST of H2A histone family, member Y vs. Planmine SMEST
Match: SMESG000012903.1 (SMESG000012903.1)

HSP 1 Score: 420.624 bits (1080), Expect = 9.927e-148
Identity = 265/266 (99.62%), Postives = 265/266 (99.62%), Query Frame = 1
Query:   25 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIH 822
            MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKKTQIIKVKSKKAVKKNSKRQPT QSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIH
Sbjct:    1 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKKTQIIKVKSKKAVKKNSKRQPTIQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIH 266          
BLAST of H2A histone family, member Y vs. Planmine SMEST
Match: SMESG000012903.1 (SMESG000012903.1)

HSP 1 Score: 416.001 bits (1068), Expect = 6.264e-146
Identity = 240/267 (89.89%), Postives = 241/267 (90.26%), Query Frame = 1
Query:   25 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIH 822
            MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGK        K +   K     K   I     KKAVKKNSKRQPT QSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIH
Sbjct:    1 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKKTQIIKVKSVKKAVKKNSKRQPTIQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAVNIPYKYIIH 267          
BLAST of H2A histone family, member Y vs. Planmine SMEST
Match: SMESG000012903.1 (SMESG000012903.1)

HSP 1 Score: 398.667 bits (1023), Expect = 3.072e-139
Identity = 255/257 (99.22%), Postives = 256/257 (99.61%), Query Frame = 1
Query:   25 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAV 795
            MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKKTQIIKVKSKKAVKKNSKRQPT QSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGA+
Sbjct:    1 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKKTQIIKVKSKKAVKKNSKRQPTIQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAL 257          
BLAST of H2A histone family, member Y vs. Planmine SMEST
Match: SMESG000012903.1 (SMESG000012903.1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.456e-137
Identity = 230/258 (89.15%), Postives = 232/258 (89.92%), Query Frame = 1
Query:   25 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTXXXXXXXXXXXXXLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAV 795
            MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGK        K +   K     K   I     KKAVKKNSKRQPT QSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGA+
Sbjct:    1 MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKKTQIIKVKSVKKAVKKNSKRQPTIQSKSLEVLNERTLFLGQKLVVVQGDIVEMTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACEAAVSGAL 258          
BLAST of H2A histone family, member Y vs. Planmine SMEST
Match: SMESG000015784.1 (SMESG000015784.1)

HSP 1 Score: 101.679 bits (252), Expect = 8.298e-26
Identity = 52/99 (52.53%), Postives = 70/99 (70.71%), Query Frame = 1
Query:   49 GFNKSKSQKAGLIFPVSRFHRYLKK-RFPSSCRFKISIGAAVYAASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHVILPSTG 342
            G  ++K+QKAGL+ PVSR  RYLKK R+      +IS GAAVY ++V+EYLVAE+ E +GNAA+  K + I PRHIML +  D E+N+ LK+V + S G
Sbjct:   13 GKRQTKTQKAGLVMPVSRLQRYLKKGRYAQ----RISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGG 107          
The following BLAST results are available for this feature:
BLAST of H2A histone family, member Y vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MACROH2A15.582e-5440.92macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:47... [more]
MACROH2A13.026e-4836.58macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:47... [more]
MACROH2A21.745e-4736.36macroH2A.2 histone [Source:HGNC Symbol;Acc:HGNC:14... [more]
MACROH2A15.496e-2754.00macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:47... [more]
MACROH2A12.508e-2554.00macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:47... [more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htz-15.083e-2453.93Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
htz-15.083e-2453.93Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
htz-15.083e-2453.93Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
his-356.583e-2148.94Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-356.583e-2148.94Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2Av3.621e-2352.81gene:FBgn0001197 transcript:FBtr0085062[more]
His2Av3.621e-2352.81gene:FBgn0001197 transcript:FBtr0334311[more]
His2A:CG338532.533e-2048.94gene:FBgn0053853 transcript:FBtr0091857[more]
His2A:CG338592.533e-2048.94gene:FBgn0053859 transcript:FBtr0091863[more]
His2A:CG338562.533e-2048.94gene:FBgn0053856 transcript:FBtr0091860[more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
macroh2a13.449e-5640.46macroH2A.1 histone [Source:ZFIN;Acc:ZDB-GENE-06042... [more]
macroh2a13.449e-5640.46macroH2A.1 histone [Source:ZFIN;Acc:ZDB-GENE-06042... [more]
h2az2b2.445e-2453.93H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
h2az2a2.848e-2453.93H2A.Z variant histone 2a [Source:NCBI gene;Acc:252... [more]
h2az2b2.906e-2453.93H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cit6.211e-2643.78citron rho-interacting serine/threonine kinase [So... [more]
cit3.927e-2555.32citron rho-interacting serine/threonine kinase [So... [more]
cit6.670e-2555.91citron rho-interacting serine/threonine kinase [So... [more]
arrdc24.058e-2453.93arrestin domain containing 2 [Source:Xenbase;Acc:X... [more]
macroh2a23.267e-2352.13macroH2A.2 histone [Source:NCBI gene;Acc:448772][more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Macroh2a18.284e-5440.38macroH2A.1 histone [Source:MGI Symbol;Acc:MGI:1349... [more]
Macroh2a27.096e-4836.36macroH2A.2 histone [Source:MGI Symbol;Acc:MGI:3037... [more]
Macroh2a11.918e-2554.00macroH2A.1 histone [Source:MGI Symbol;Acc:MGI:1349... [more]
H2az12.748e-2453.93H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2az23.073e-2453.93H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of H2A histone family, member Y vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02874|H2AY_RAT1.136e-4837.81Core histone macro-H2A.1 OS=Rattus norvegicus OX=1... [more]
sp|Q8CCK0|H2AW_MOUSE4.963e-4736.36Core histone macro-H2A.2 OS=Mus musculus OX=10090 ... [more]
sp|Q9P0M6|H2AW_HUMAN8.378e-4736.36Core histone macro-H2A.2 OS=Homo sapiens OX=9606 G... [more]
sp|O93327|H2AY_CHICK9.110e-4737.37Core histone macro-H2A.1 OS=Gallus gallus OX=9031 ... [more]
sp|O75367|H2AY_HUMAN1.205e-2454.00Core histone macro-H2A.1 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of H2A histone family, member Y vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4YF992.065e-5844.57Macro domain-containing protein OS=Strongylocentro... [more]
R7TQH72.536e-5639.50Macro domain-containing protein OS=Capitella telet... [more]
A0A3P8WFS22.192e-5541.88H2A histone family, member Y OS=Cynoglossus semila... [more]
A0A3Q3GYK02.740e-5540.34H2A histone family, member Y OS=Labrus bergylta OX... [more]
A0A3Q4H4U69.186e-5540.90H2A histone family, member Y OS=Neolamprologus bri... [more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
macroh2a18.858e-5639.22core histone macro-H2A.1 [Source:NCBI gene;Acc:103... [more]
macroh2a12.392e-4936.11core histone macro-H2A.1 [Source:NCBI gene;Acc:103... [more]
macroh2a28.348e-4434.18core histone macro-H2A.2 [Source:NCBI gene;Acc:103... [more]
macroh2a11.772e-2552.00core histone macro-H2A.1 [Source:NCBI gene;Acc:103... [more]
h2az2a2.413e-2453.93histone H2A.V [Source:NCBI gene;Acc:103037668][more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
macroh2a27.294e-2743.96macroH2A.2 histone [Source:ZFIN;Acc:ZDB-GENE-05091... [more]
ENSPMAT00000005345.15.510e-2249.47pep scaffold:Pmarinus_7.0:GL476820:833184:834000:-... [more]
ENSPMAT00000011253.17.772e-2251.58pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-... [more]
ENSPMAT00000005338.12.451e-2149.47pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-... [more]
ENSPMAT00000002388.14.080e-2149.47pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1... [more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HTA21.938e-2150.53Histone H2A; core histone protein required for chr... [more]
HTA11.938e-2150.53Histone H2A; core histone protein required for chr... [more]
HTZ12.374e-2144.04Histone variant H2AZ; exchanged for histone H2A in... [more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455153.360e-5640.39Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RST0][more]
EDO462899.841e-2452.81Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQH8][more]
EDO496411.907e-2249.47Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RFQ0][more]
EDO463563.404e-2251.04Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQF5][more]
EDO463974.621e-2248.96Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RPX5][more]
back to top
BLAST of H2A histone family, member Y vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
macroh2a12.426e-5639.22core histone macro-H2A.1 [Source:NCBI gene;Acc:101... [more]
macroh2a15.672e-5035.83core histone macro-H2A.1 [Source:NCBI gene;Acc:101... [more]
macroh2a21.178e-4133.77core histone macro-H2A.2 [Source:NCBI gene;Acc:101... [more]
macroh2a22.504e-4134.65core histone macro-H2A.2 [Source:NCBI gene;Acc:101... [more]
macroh2a24.965e-4134.32core histone macro-H2A.2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of H2A histone family, member Y vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012903.19.927e-14899.62SMESG000012903.1[more]
SMESG000012903.16.264e-14689.89SMESG000012903.1[more]
SMESG000012903.13.072e-13999.22SMESG000012903.1[more]
SMESG000012903.11.456e-13789.15SMESG000012903.1[more]
SMESG000015784.18.298e-2652.53SMESG000015784.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017270 ID=SMED30017270|Name=H2A histone family, member Y|organism=Schmidtea mediterranea sexual|type=transcript|length=1246bp
TTTATTGTAAACTTTAATATTTAAATGACTAATAAAGTAATAAAACAGGG
ATTTAACAAATCTAAATCACAGAAGGCTGGTTTAATTTTCCCAGTTTCTC
GTTTTCATAGGTATCTTAAAAAAAGATTTCCTTCTTCATGTAGATTTAAA
ATTTCTATCGGCGCCGCAGTCTATGCTGCATCGGTACTAGAATATTTAGT
TGCTGAAATCACCGAACAAGCTGGAAATGCTGCAAGAATCATGAAAGTGA
AAAGAATTAACCCAAGACATATCATGTTAGCTATATCTCAAGATATGGAA
ATGAATCAAACCCTTAAGCATGTGATATTACCATCAACCGGTAGGCCTTT
AAATCTAGCTGTGAAAACAGAAAATGGTACCAAATCAGTTTCAAAAGCAT
CGACTGGTAAGCCTACAATCCCAGTAAAAACTAAGAAGTCCACGAAAATT
AAAAAAGTTACCAAAACTAAAAAAACTCAAATAATAAAAGTTAAATCTAA
AAAGGCCGTTAAGAAAAATTCAAAACGACAGCCTACTTCTCAGTCCAAAA
GTCTTGAAGTTTTAAATGAAAGAACATTATTCCTTGGACAAAAACTTGTT
GTTGTACAAGGAGATATTGTTGAAATGACAGCTGATGCAGTGGTTCACCC
TACTAGTGGAGGTTATGGATTTGGTGGTCAAGTTGGCTCTTCATTGTCGA
ATAAAGGAGGTGTGGATTTGACAAACGAAGTCAATAAATTACGCGTTTCG
AAGCCATCCCTCAAAGCTTGTGAAGCTGCAGTCAGTGGGGCTGTAAATAT
TCCATACAAATACATCATACATGTCAATTCTCCCAGCTGGTCCAATAACG
CAAGCAACGCCATTTCTAATTTAGAAAAAGCAGTAAATAATATTCTGGAC
TCGGCAGATCAATTTGATATTCAATCAATTGCAATTCCATCAATTAGTAG
TGGGGGAGGAGGATATCCCAAACAAGTCGCCGCAGAAACAATTTTGAGGA
CAATTAATTCTTACTTTGCGGGAGTAGCTAAATCGAACATCAAGCAAATA
TATTTTGTTATTTATGACAAGGAAACTCTCGATGTCTACAAAGCTGAATT
GACACGTCTTGCGTAACTGACATTTGCACGATTATCAATGATATCTTCGT
CTGGTATACTGTCCAGGTTTTATATATCCACTTTGGTTTTTTAGATTTTA
TTAGCTTTAAAATAAACGATTTTTATTATCTAAATATATACTAATA
back to top

protein sequence of SMED30017270-orf-1

>SMED30017270-orf-1 ID=SMED30017270-orf-1|Name=SMED30017270-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MTNKVIKQGFNKSKSQKAGLIFPVSRFHRYLKKRFPSSCRFKISIGAAVY
AASVLEYLVAEITEQAGNAARIMKVKRINPRHIMLAISQDMEMNQTLKHV
ILPSTGRPLNLAVKTENGTKSVSKASTGKPTIPVKTKKSTKIKKVTKTKK
TQIIKVKSKKAVKKNSKRQPTSQSKSLEVLNERTLFLGQKLVVVQGDIVE
MTADAVVHPTSGGYGFGGQVGSSLSNKGGVDLTNEVNKLRVSKPSLKACE
AAVSGAVNIPYKYIIHVNSPSWSNNASNAISNLEKAVNNILDSADQFDIQ
SIAIPSISSGGGGYPKQVAAETILRTINSYFAGVAKSNIKQIYFVIYDKE
TLDVYKAELTRLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR002119Histone_H2A
IPR002589Macro_dom
IPR007125Histone_H2A/H2B/H3
IPR009072Histone-fold
IPR032458Histone_H2A_CS
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0070062extracellular exosome
GO:0000784nuclear chromosome, telomeric region
GO:0000785chromatin
GO:0000790nuclear chromatin
GO:0001740Barr body
GO:0005654nucleoplasm
GO:0005694chromosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0031490chromatin DNA binding
GO:0044212transcription regulatory region DNA binding
Vocabulary: biological process
TermDefinition
GO:0045814negative regulation of gene expression, epigenetic
GO:0071169establishment of protein localization to chromatin
GO:1901837negative regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006334nucleosome assembly
GO:0006342chromatin silencing
GO:0007420brain development
GO:0007549dosage compensation
GO:0016569covalent chromatin modification
GO:0045618positive regulation of keratinocyte differentiation