Major facilitator superfamily domain-containing protein 3

Overview
NameMajor facilitator superfamily domain-containing protein 3
Smed IDSMED30017266
Length (bp)1932
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Major facilitator superfamily domain-containing protein 3 (SMED30017266) t-SNE clustered cells

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing protein 3 (SMED30017266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Major facilitator superfamily domain-containing protein 3 (SMED30017266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing protein 3 (SMED30017266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017266SMESG000044308.1 Contig7485newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017266SMESG000044308.1 Contig7485uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30017266SMESG000044308.1 SmedASXL_047599SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30017266SMESG000044308.1 SmedASXL_000846SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30017266SMESG000071238.1 SMESG000044309.1 SMESG000044308.1 Contig9060newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017266SMESG000071238.1 SMESG000044309.1 SMESG000044308.1 Contig9060uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30017266SMESG000044308.1 dd_Smed_v4_37111_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Human
Match: MFSD3 (major facilitator superfamily domain containing 3 [Source:HGNC Symbol;Acc:HGNC:25157])

HSP 1 Score: 91.6633 bits (226), Expect = 4.252e-19
Identity = 67/262 (25.57%), Postives = 125/262 (47.71%), Query Frame = 1
Query:  157 LLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTS------VLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLW 924
            LL +  +Y+VQGLPYG+Q+  LP+ LR  G SL+ +G+ K+LY P +L+  +AP+++   S +  +  S      V  L          +      +    +++N   ++QDV+LD L + +L+   +  GN  QVV YK+                            ++   LF L+++ +      +++     ++ +   +    +   + ++ +    T  T G++L YK+GEQGA+++ PL L+D   +  E+GLW
Sbjct:    5 LLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYAPWLLKLAWAPLVDAQGSARAWVTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAMQDVALDALAVQLLEPAELGPGNTVQVVAYKL-------------GAALAGGALLALLPTFSWPQLFLLLAATYWLAAALAWAAPALRRLPQQPPSEQRPHTAHLLRDVLAVPGTVWTAGFVLTYKLGEQGASSLFPLLLLDHGVSAPELGLW 253          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Zebrafish
Match: MFSD3 (si:dkey-229d2.4 [Source:ZFIN;Acc:ZDB-GENE-060526-263])

HSP 1 Score: 150.599 bits (379), Expect = 2.790e-39
Identity = 121/404 (29.95%), Postives = 207/404 (51.24%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVI--NFVVMNFLCSIQDVSLDTLTMSVLK-DNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSL 1359
            +Y +QG+PYG+Q+  LP+YLR  G SL+ + + K+LY P +L+ L+AP+++    TK C     +        +S   T ++ Y+ +  + + MN L S+QD++ D   + +L+    +  GN  QVVGYK G++  GG ++       W  +F +    Y    LF   +     E           Q    + +   M   K+++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+G+W G+V    S+ GS+    ++ ++ S    +R +          +   IS  F +    ++ P      + V+ ++  + I+G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL F++  G   D  G+  ++ILF  L  +++L
Sbjct:   12 LYFIQGIPYGLQSSLLPVYLRGAGHSLTRISLTKILYFPWVLKVLWAPLVD-RTGTKRCWLVGTVAGLAMTCLLSATITPDVQYMSVAGSLLAMNVLASVQDIAADGAAVRLLRGQGELGLGNTVQVVGYKAGSVFAGGGLLAVIDVAGWGWMFALLACVYGGVALFVWGAPVLDGEPARG-------QGEGRRGSKDLMQPWKVWRKLLSVPGTTWTMFYVLTYKLGEQGAITMFPLFLLDHHMTARELGVWNGVVAMAFSICGSSIG-GFLLSQYSIGLLMRRV---------FMMRTISMVFQSSLLVVLEPSPMMKVMAVLSLSLQHFIAGLITTLTFTTMMNCTQRAEESIQATHYSFLATLEVLGKLSFSALAGGMVDTVGFPIAFILFLFLTSSSAL 397          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Zebrafish
Match: MFSD3 (si:dkey-229d2.4 [Source:ZFIN;Acc:ZDB-GENE-060526-263])

HSP 1 Score: 150.214 bits (378), Expect = 3.396e-39
Identity = 121/404 (29.95%), Postives = 207/404 (51.24%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVI--NFVVMNFLCSIQDVSLDTLTMSVLK-DNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSL 1359
            +Y +QG+PYG+Q+  LP+YLR  G SL+ + + K+LY P +L+ L+AP+++    TK C     +        +S   T ++ Y+ +  + + MN L S+QD++ D   + +L+    +  GN  QVVGYK G++  GG ++       W  +F +    Y    LF   +     E           Q    + +   M   K+++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+G+W G+V    S+ GS+    ++ ++ S    +R +          +   IS  F +    ++ P      + V+ ++  + I+G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL F++  G   D  G+  ++ILF  L  +++L
Sbjct:   11 LYFIQGIPYGLQSSLLPVYLRGAGHSLTRISLTKILYFPWVLKVLWAPLVD-RTGTKRCWLVGTVAGLAMTCLLSATITPDVQYMSVAGSLLAMNVLASVQDIAADGAAVRLLRGQGELGLGNTVQVVGYKAGSVFAGGGLLAVIDVAGWGWMFALLACVYGGVALFVWGAPVLDGEPARG-------QGEGRRGSKDLMQPWKVWRKLLSVPGTTWTMFYVLTYKLGEQGAITMFPLFLLDHHMTARELGVWNGVVAMAFSICGSSIG-GFLLSQYSIGLLMRRV---------FMMRTISMVFQSSLLVVLEPSPMMKVMAVLSLSLQHFIAGLITTLTFTTMMNCTQRAEESIQATHYSFLATLEVLGKLSFSALAGGMVDTVGFPIAFILFLFLTSSSAL 396          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Mouse
Match: Mfsd3 (major facilitator superfamily domain containing 3 [Source:MGI Symbol;Acc:MGI:1916822])

HSP 1 Score: 147.132 bits (370), Expect = 4.585e-38
Identity = 121/413 (29.30%), Postives = 203/413 (49.15%), Query Frame = 1
Query:  148 HQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFL------CSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIG-ALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFH------NRFPRLIFPLCVIVVNCI-NLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILA 1344
            H  LL +  +Y+VQGLPYG+Q+  LPI LR RG SL+ +G+ K LY P +L+  +AP+++   + ++ L  S L L      ++ L         +   VM  L       ++QDV+LDTL + +L+   +  GN  QVV YK+G AL GGG+++ F           +A  ++             +     +     ++   +   +    +YL   ++ +    T  T G++L YK+GEQGA ++ PL L+D   +  ++GLW G+     S+ GS+     +      +  ++ L   +   +  L    +  FH      +  P  +    V++  C+     G++TTATFT+MM CSQ     LQ+T+Y+ LAT+E+LGKLL  +  G+  D  G    + +F +L+
Sbjct:    2 HGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTLSTLSLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVLFPTLSWPLLFLLLAATYW------------LAAALAWAAPALGRLPWPQASEHTPHSSYL--LQDLLAVPGTLWTAGFVLTYKLGEQGAGSLFPLLLLDHGASASDLGLWSGLGAVTCSIAGSSLGGALLARH---WQPLKLLKTVLQLRLGSLACQTALLFHLNSPGASVDPGTVMRGAVLLSLCLQQFFGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLPGTLAGVLADSLGPHLCFAVFLVLS 397          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q4V8E5|MFSD3_RAT (Major facilitator superfamily domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Mfsd3 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 9.338e-39
Identity = 126/416 (30.29%), Postives = 207/416 (49.76%), Query Frame = 1
Query:  148 HQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFIC--ISFLKTFNLTYLVINFVVMNFL------CSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIG-ALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXX----XXXXXXXAYAVVYVKNKRSTYTAVRN---LCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCI-NLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILA 1344
            H  LL +  +Y+VQGLPYG+Q+  LPI LR RG SL+ +G+ K LY P +L+  +AP+++   + ++ L  S + L    +C  ++ L         +   VM  L       ++QDV+LDTL + +L+   +  GN  QVV YK+G AL GGG+++            F   L + L  L    +   +     +     ++   +V  +    +YL   ++ +    T  T G++L YKMGEQGA ++ PL L+D   +  ++GLW G+         S +G A    +  + R     +R+   L L      T L + ++    +  P  +     ++  C+   + G++TTATFT+MM CSQ     LQ+T+Y+ LAT+E+LGKLL  +  G+  D  G    +  F +L+
Sbjct:    2 HGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTFSTVCL--GLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLV------------FFPTLSWPLLFLLLTATYWLAAALAWAAPALGRLSRPQVSEHTPHTSYL--LQDLLAVPGTLWTAGFVLTYKMGEQGAGSLFPLLLLDHGASASDLGLWSGLGAATCSIAGSSLGGALLARHCSHPRQPLKLLRSVLQLRLGGLACQTALLLHLNTPGASLDPGTVMRGAALLSLCLQQFLGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLPGTLAGVLADGLGPRLCFAAFLVLS 401          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q5U419|MFSD3_MOUSE (Major facilitator superfamily domain-containing protein 3 OS=Mus musculus OX=10090 GN=Mfsd3 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.940e-31
Identity = 121/413 (29.30%), Postives = 203/413 (49.15%), Query Frame = 1
Query:  148 HQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFL------CSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIG-ALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFH------NRFPRLIFPLCVIVVNCI-NLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILA 1344
            H  LL +  +Y+VQGLPYG+Q+  LPI LR RG SL+ +G+ K LY P +L+  +AP+++   + ++ L  S L L      ++ L         +   VM  L       ++QDV+LDTL + +L+   +  GN  QVV YK+G AL GGG+++ F           +A  ++             +     +     ++   +   +    +YL   ++ +    T  T G++L YK+GEQGA ++ PL L+D   +  ++GLW G+     S+ GS+     +      +  ++ L   +   +  L    +  FH      +  P  +    V++  C+     G++TTATFT+MM CSQ     LQ+T+Y+ LAT+E+LGKLL  +  G+  D  G    + +F +L+
Sbjct:    2 HGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTLSTLSLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVLFPTLSWPLLFLLLAATYW------------LAAALAWAAPALGRLPWPQASEHTPHSSYL--LQDLLAVPGTLWTAGFVLTYKLGEQGAGSLFPLLLLDHGASASDLGLWSGLGAVTCSIAGSSLGGALLARH---WQPLKLLKTVLQLRLGSLACQTALLFHLNSPGASVDPGTVMRGAVLLSLCLQQFFGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLLGTLAGVLADSLGPHLCFAVFLVLS 397          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q96ES6|MFSD3_HUMAN (Major facilitator superfamily domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MFSD3 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.042e-18
Identity = 67/262 (25.57%), Postives = 125/262 (47.71%), Query Frame = 1
Query:  157 LLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTS------VLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLW 924
            LL +  +Y+VQGLPYG+Q+  LP+ LR  G SL+ +G+ K+LY P +L+  +AP+++   S +  +  S      V  L          +      +    +++N   ++QDV+LD L + +L+   +  GN  QVV YK+                            ++   LF L+++ +      +++     ++ +   +    +   + ++ +    T  T G++L YK+GEQGA+++ PL L+D   +  E+GLW
Sbjct:    5 LLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYAPWLLKLAWAPLVDAQGSARAWVTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAMQDVALDALAVQLLEPAELGPGNTVQVVAYKL-------------GAALAGGALLALLPTFSWPQLFLLLAATYWLAAALAWAAPALRRLPQQPPSEQRPHTAHLLRDVLAVPGTVWTAGFVLTYKLGEQGASSLFPLLLLDHGVSAPELGLW 253          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. TrEMBL
Match: A0A5K4F2H2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.424e-54
Identity = 155/431 (35.96%), Postives = 254/431 (58.93%), Query Frame = 1
Query:  157 LLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICI-----SFLKTFNLTYLVINFVVM--NFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQN-----NMTFM----NYLKIFKNSIYDY--STCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCS-QKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEF 1392
            L+++FY+Y+++G+PYG+Q++FLP+  R +G SL++LG+ KLL++P +L++ YAP+I+ +++ ++ L  S   LFF  + +       +   N     I+F +   NF  + QD+++D+LT+S L  N ++ GN  QVVGYK GA+IGGG +   S F+    LF      YA G+ F LI   +       F     +Q+ E +N     ++T +    +Y K FK ++ D   S C+ +  LLIYK+GEQG+ NMLPL L+D   ++ ++G W G+VGQ+ S+IGS       K  RS  T+V +L +  A L   LT++  K      P + F +  ++++ + ++SG +TT  FT+MM C+  + S   Q+T+Y+IL+T E+LGKLLF +    FTD +GY  +Y+ F IL+    L++  ++  F F
Sbjct:    4 LIVLFYLYLLEGIPYGVQSRFLPLIFRNKGLSLTSLGLHKLLHIPWLLKSFYAPVIDRHVNKRVWLFISFSGLFFCTVLLFHESEQLVSGNNYFMFTISFCLFMYNFWAASQDITVDSLTLSTLASNQISLGNTIQVVGYKCGAIIGGGFLAWLSAFVEISYLFISLSCLYASGMCFCLIGKFWKFCNVKQFHEKTYIQVNENENSDGEGDLTIVSKEYSYTKAFKIALGDSGGSRCLIV-LLLIYKLGEQGSMNMLPLMLLDRGFSLSKVGFWTGVVGQLASIIGSTSGYYIQKKLRSPLTSVLSLMIIRACLQFPLTMIAFKSIWTSAPNVSFWIGCLLMDSLLVVSGGITTIIFTLMMHCTCSETSKAYQATHYSILSTAELLGKLLFGTIAAYFTDVFGYGMAYLCFLILSILPILYVYKYSGKFRF 433          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. TrEMBL
Match: A0A1I8GVL2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.506e-54
Identity = 151/405 (37.28%), Postives = 229/405 (56.54%), Query Frame = 1
Query:  178 YVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLF--------YALGILFTLISSGFSDEYTNSFSVYE----QVQITEVQNNMTFMNYLKIFKNSIYD--YSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKN--KRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILA 1344
            Y+VQG+PYG Q++FLPIYLRT G SLS L  +KLLY P +L+TL+AP+++ Y S +  L  S+  L    + +  L+   L  L       N L S+QD+++D   +  L  + +  GNVAQVVGYK+GA++GGG ++T + +L W      +GLF         A+G++    S G  D+   S    +    +      +  ++   Y +   +++      T    G +L+YK+GEQGA  MLPLFL+D   ++G++G W G+VGQ+ SV+GSA     +     RS   A    C    PL+  L    S   H     ++ P  V+++N   L+SG++TT+TF +MM+CSQ      ++T+YT LAT+EVLGKL+F+S+ G+  D  GY  SY+LF +LA
Sbjct:   10 YMVQGIPYGFQSRFLPIYLRTHGLSLSILSSLKLLYTPWLLKTLWAPLVDAYRSKRWWLIVSMSGLLATCLGLGCLEPTQLWVLAGFMATQNLLASLQDIAVDAFAIVSLSPSQLGSGNVAQVVGYKLGAVLGGGCLVTLADWLPW------SGLFVGLAAIYAAAIGVVAASTSLGPDDDARRSGPDNKIDGNKKSSAAPEQALSLGAYARTLSSALRSGGSDTASMAGLVLLYKLGEQGALGMLPLFLVDRGVSLGQVGFWTGVVGQVTSVLGSALGGPALARWPARSVLLAC---CCVRLPLLCGLAACASSGVHGAS-DMVLPASVLLMNASLLVSGLITTSTFALMMRCSQTAPPACRATHYTGLATLEVLGKLIFSSASGVIVDGLGYGASYVLFLVLA 404          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. TrEMBL
Match: A0A1I8GEB0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018921g3 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.775e-54
Identity = 151/405 (37.28%), Postives = 229/405 (56.54%), Query Frame = 1
Query:  178 YVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLF--------YALGILFTLISSGFSDEYTNSFSVYE----QVQITEVQNNMTFMNYLKIFKNSIYD--YSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKN--KRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILA 1344
            Y+VQG+PYG Q++FLPIYLRT G SLS L  +KLLY P +L+TL+AP+++ Y S +  L  S+  L    + +  L+   L  L       N L S+QD+++D   +  L  + +  GNVAQVVGYK+GA++GGG ++T + +L W      +GLF         A+G++    S G  D+   S    +    +      +  ++   Y +   +++      T    G +L+YK+GEQGA  MLPLFL+D   ++G++G W G+VGQ+ SV+GSA     +     RS   A    C    PL+  L    S   H     ++ P  V+++N   L+SG++TT+TF +MM+CSQ      ++T+YT LAT+EVLGKL+F+S+ G+  D  GY  SY+LF +LA
Sbjct:   10 YMVQGIPYGFQSRFLPIYLRTHGLSLSILSSLKLLYTPWLLKTLWAPLVDAYRSKRWWLIVSMSGLLATCLGLGCLEPTQLWVLAGFMATQNLLASLQDIAVDAFAIVSLSPSQLGSGNVAQVVGYKLGAVLGGGCLVTLADWLPW------SGLFVGLAAIYAAAIGVVAASTSLGPDDDARRSGPDNKIDGNKKSSAAPEQALSLGAYARTLSSALRSGGSDTASMAGLVLLYKLGEQGALGMLPLFLVDRGVSLGQVGFWTGVVGQVTSVLGSALGGPALARWPARSVLLAC---CCVRLPLLCGLAACASSGVHGAS-DMVLPASVLLMNASLLVSGLITTSTFALMMRCSQTAPPACRATHYTGLATLEVLGKLIFSSASGVIVDGLGYGASYVLFLVLA 404          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. TrEMBL
Match: A0A1I8G530 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027954g2 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.668e-53
Identity = 150/403 (37.22%), Postives = 227/403 (56.33%), Query Frame = 1
Query:  178 YVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLI------SSGFSDEYTNSFSVYE----QVQITEVQNNMTFMNYLKIFKNSIYD--YSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKN--KRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILA 1344
            Y+VQG+PYG Q++FLPIYLRT G SLS L  +KLLY P +L+TL+AP+++ Y S +  L  S+  L    + +  L+   L  L       N L S+QD+++D   +  L  + +  GNVAQVVGYK+GA++GGG ++T + +L W      +GLF  L  ++         S G  D+   S    +    +      +  ++   Y +   +++      T    G +L+YK+GEQGA  MLPLFL+D   ++G++G W G+VGQ+ SV+GSA     +     RS   A    C    PL+  L    S   H     ++ P  V+++N   L+SG++TT+TF +MM+CSQ      ++T+YT LAT+EVLGKL+F+S+ G+  D  GY  SY+LF +LA
Sbjct:   10 YMVQGIPYGFQSRFLPIYLRTHGLSLSILSSLKLLYTPWLLKTLWAPLVDAYRSKRWWLIVSMSGLLATCLGLGCLEPTQLWVLAGFMATQNLLASLQDIAVDAFAIVSLSPSQLGSGNVAQVVGYKLGAVLGGGCLVTLADWLPW------SGLFVGLAAIYAAAIYAASTSLGPDDDARRSGPDNKIDGNKKSSAAPEQALSLGAYARTLSSALRSGGSDTASMAGLVLLYKLGEQGALGMLPLFLVDRGVSLGQVGFWTGVVGQVTSVLGSALGGPALARWPARSVLLAC---CCVRLPLLCGLAACASSGVHGAS-DMVLPASVLLMNASLLVSGLITTSTFALMMRCSQTAPPACRATHYTGLATLEVLGKLMFSSASGVIVDGLGYGASYVLFLVLA 402          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. TrEMBL
Match: A0A5K4F2U4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.024e-50
Identity = 152/437 (34.78%), Postives = 250/437 (57.21%), Query Frame = 1
Query:  157 LLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICI-----SFLKTFNLTYLVINFVVM--NFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLF------YALGILFTLISSGFSDEYTNSFSVYEQVQITEVQN-----NMTFM----NYLKIFKNSIYDY--STCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCS-QKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEF 1392
            L+++FY+Y+++G+PYG+Q++FLP+  R +G SL++LG+ KLL++P +L++ YAP+I+ +++ ++ L  S   LFF  + +       +   N     I+F +   NF  + QD+++D+LT+S L  N ++ GN  QVVGYK GA+IG                  I+ LF      YA G+ F LI   +       F     +Q+ E +N     ++T +    +Y K FK ++ D   S C+ +  LLIYK+GEQG+ NMLPL L+D   ++ ++G W G+VGQ+ S+IGS       K  RS  T+V +L +  A L   LT++  K      P + F +  ++++ + ++SG +TT  FT+MM C+  + S   Q+T+Y+IL+T E+LGKLLF +    FTD +GY  +Y+ F IL+    L++  ++  F F
Sbjct:    4 LIVLFYLYLLEGIPYGVQSRFLPLIFRNKGLSLTSLGLHKLLHIPWLLKSFYAPVIDRHVNKRVWLFISFSGLFFCTVLLFHESEQLVSGNNYFMFTISFCLFMYNFWAASQDITVDSLTLSTLASNQISLGNTIQVVGYKCGAIIG-----------------EISYLFISLSCLYASGMCFCLIGKFWKFCNVKQFHEKTYIQVNENENSDGEGDLTIVSKEYSYTKAFKIALGDSGGSRCLIV-LLLIYKLGEQGSMNMLPLMLLDRGFSLSKVGFWTGVVGQLASIIGSTSGYYIQKKLRSPLTSVLSLMIIRACLQFPLTMIAFKSIWTSAPNVSFWIGCLLMDSLLVVSGGITTIIFTLMMHCTCSETSKAYQATHYSILSTAELLGKLLFGTIAAYFTDVFGYGMAYLCFLILSILPILYVYKYSGKFRF 422          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Cavefish
Match: si:dkey-229d2.4 (major facilitator superfamily domain containing 3 [Source:HGNC Symbol;Acc:HGNC:25157])

HSP 1 Score: 123.25 bits (308), Expect = 7.731e-30
Identity = 114/406 (28.08%), Postives = 204/406 (50.25%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVIN--FVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGY---KIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISS--GFSDEYTNSFSVYE----QVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTIL 1341
            +Y +QG+PYG+Q+  LP+YLR  G SL+ + + K+LY P +L+ L+AP+++   + +  L T+V  L    + +S        Y+ +    + MN L S+QD+++D   + +L+    + G V     +   +     GGG++           +  +AG     G +FTL++   G    +     V +    + Q    + +   M   ++++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+ +W G+V    S+ GS+ A  ++ ++ S    +R +          +   IS  F      ++ P      + V+ ++  + I+G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL F++  G   D  G+  +++LF  L
Sbjct:   12 LYFIQGIPYGLQSSLLPVYLRGAGHSLTRISLTKVLYFPWVLKVLWAPLVDRTGTKRCWLVTTVAGLALTCL-VSATVAPESQYVAVAGALLAMNVLASVQDIAVDGAAVRLLR-GRASWGWVTLRRWWATRRAPCFAGGGLL----------AVIDVAGW----GWMFTLLACVYGGVALFVWGAPVLDGEAGRTQTETRRGSRDVMRPWRVWRKLMAVPGTPWTMLYVLTYKLGEQGAITMFPLFLLDHHMTSRELSMWNGVVAMAFSICGSS-AGGFLLSRYSIGLLMRRV---------FVIRTISMVFQCSLLTVLEPSPLMKGMSVLSLSVQHFIAGLITTLTFTSMMNCTQRAEESIQATHYSFLATLEVLGKLSFSALAGGMVDTVGFPVAFLLFLFL 391          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Cavefish
Match: si:dkey-229d2.4 (major facilitator superfamily domain containing 3 [Source:HGNC Symbol;Acc:HGNC:25157])

HSP 1 Score: 123.25 bits (308), Expect = 7.731e-30
Identity = 114/406 (28.08%), Postives = 204/406 (50.25%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVIN--FVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGY---KIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISS--GFSDEYTNSFSVYE----QVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTIL 1341
            +Y +QG+PYG+Q+  LP+YLR  G SL+ + + K+LY P +L+ L+AP+++   + +  L T+V  L    + +S        Y+ +    + MN L S+QD+++D   + +L+    + G V     +   +     GGG++           +  +AG     G +FTL++   G    +     V +    + Q    + +   M   ++++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+ +W G+V    S+ GS+ A  ++ ++ S    +R +          +   IS  F      ++ P      + V+ ++  + I+G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL F++  G   D  G+  +++LF  L
Sbjct:   12 LYFIQGIPYGLQSSLLPVYLRGAGHSLTRISLTKVLYFPWVLKVLWAPLVDRTGTKRCWLVTTVAGLALTCL-VSATVAPESQYVAVAGALLAMNVLASVQDIAVDGAAVRLLR-GRASWGWVTLRRWWATRRAPCFAGGGLL----------AVIDVAGW----GWMFTLLACVYGGVALFVWGAPVLDGEAGRTQTETRRGSRDVMRPWRVWRKLMAVPGTPWTMLYVLTYKLGEQGAITMFPLFLLDHHMTSRELSMWNGVVAMAFSICGSS-AGGFLLSRYSIGLLMRRV---------FVIRTISMVFQCSLLTVLEPSPLMKGMSVLSLSVQHFIAGLITTLTFTSMMNCTQRAEESIQATHYSFLATLEVLGKLSFSALAGGMVDTVGFPVAFLLFLFL 391          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: MFSD3 (major facilitator superfamily domain containing 3 [Source:HGNC Symbol;Acc:HGNC:25157])

HSP 1 Score: 50.8322 bits (120), Expect = 3.266e-7
Identity = 41/134 (30.60%), Postives = 72/134 (53.73%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTF-----NLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDN-NVNEGNVAQVVGYK 558
            +Y VQG+PYG+Q+ +LP+Y+R  G S     + ++LY+P +L+  +AP++    S +  L  S   +    +C+           +L    +  +++N L S+QDV++DT  + +L     +  GN  QVV YK
Sbjct:   11 LYCVQGMPYGLQSGYLPLYMRAAGASYGLAAITRVLYVPWLLKFAWAPLVGQCGSLQAWLLGSTGAM--GLVCLVGGAVLPEPRSSLAPNAVLLLLLNALASVQDVAVDTCAVRLLAGGARLAWGNAVQVVAYK 142          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO45315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT20])

HSP 1 Score: 132.109 bits (331), Expect = 1.921e-33
Identity = 90/255 (35.29%), Postives = 150/255 (58.82%), Query Frame = 1
Query:  163 IIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSD-EYTNSFSVYEQVQITEV-QNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGL 921
            ++F +Y  QGLP+G Q   LPI LRTR  SLS +   +LL LP +L+ +++P ++   S    L  + L +   F+  +FL   N + +V   + +N + ++QD+++D + + VLK + +  GN+AQVVGYK+GAL GGGV+I  S F++W +LF +  ++Y L  L  L S   SD + T S  + E  +  ++ Q+N+T  N +++ K   + +     + Y+ +YK GEQG   M+PL+L+D      ++GL
Sbjct:    7 LLFSLYFSQGLPFGFQTSLLPILLRTRNVSLSKVSFSRLLSLPWLLKIVFSPSVDRLSSLWSWLGCTFLAMSAIFVVPAFLGVDNTSVVVGAVLGLNAMAALQDIAVDAMAIKVLKSSELGLGNIAQVVGYKLGALAGGGVLIWLSTFITWEKLFAVIAIWYGLNGLSALQSHIKSDKQKTRSRDITESSESKDISQSNITKANVMELMKTKDFKW----ILLYVGVYKAGEQGMVTMMPLYLLDSSVTATDVGL 257          

HSP 2 Score: 59.3066 bits (142), Expect = 2.473e-9
Identity = 29/66 (43.94%), Postives = 45/66 (68.18%), Query Frame = 1
Query: 1117 VIVVNC-INLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGY 1311
            +I+  C + L+ G +TTATFT+MMQ + + +   Q+T++T LATVE+LGKL   S  G+  + +GY
Sbjct:  319 LIITECALQLVGGAITTATFTLMMQHTMETANQAQATHFTALATVELLGKLTMMSVSGMVVEVFGY 384          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO43961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX38])

HSP 1 Score: 75.8702 bits (185), Expect = 1.073e-14
Identity = 105/404 (25.99%), Postives = 197/404 (48.76%), Query Frame = 1
Query:  139 SQYHQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSL---SALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICIS-FLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLL------IYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVR---NLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGY 1311
            +++  F + IF +Y++QG  YG+Q ++LPI LR  G SL   S+LG++    +P ++R L++P+IN +   +L LQ  ++ +  + + +  FL +    +LV+ F ++N   S++D+ + +L++S           V+ +   KI A   G ++           L     LF ++ +++ ++    S    NS  + +Q    EV  +  F N+        Y  STC + G L       IYK    G+  M  + L+D+   +  IGL  GI G ++S+  +      + + R++ TAV+   ++   ++ L+ +LTI   +  HN    + F L  +V+       G   T  +T ++Q +Q+     Q+T Y+I +TVE +G  L  ++ G+  +  GY
Sbjct:    4 ARHVSFHVFIFILYILQGGLYGLQTRYLPILLRKSGTSLSFISSLGLVT--LIPWVIRPLWSPVINRFSPQRL-LQGCMVGIAGSLLLVPLFLHS--RAFLVVAF-LLNVFSSVKDLVVGSLSLS-------RSCKVSSIATIKITAYKLGALLAGGGGLWLLPSLSNTGELFNSMALIYIVVM--ISTRRRNSL-IAKQ----EVTGSSHFANFRHAISEDTY-VSTCSSPGALWLLVCLTIYKFASHGSNMMFTMALVDKGVAVSNIGLVSGIFGHVVSLAIAGLTGTILVSSRTSVTAVQLLVSISGVVSILVQLLTIFGQEAIHNNLVLISFALQHVVL-------GAEATPMYTRILQVTQQAPTRTQATLYSIFSTVETVGVRLGLAAAGVLAEHAGY 379          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Medaka
Match: si:dkey-229d2.4 (major facilitator superfamily domain containing 3 [Source:NCBI gene;Acc:101158952])

HSP 1 Score: 150.214 bits (378), Expect = 3.976e-39
Identity = 121/411 (29.44%), Postives = 211/411 (51.34%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVIN-FVVMNFLCSIQDVSLDTLTMSVLKD-NNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMT--------FMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSL 1359
            +Y VQG+PYG+Q+  LP+YLR  G SL+ +G  K+LY P +L+ L+AP+++   + +  +  +V  L    +  + L      + V    + MN L S+QD+++D   + +LK    +  GN AQVVGYK G++  GG ++          +  +AG  +   +L T + SG +  +     V +   +   Q + T         +   +I++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+G W G++    S+ GS+   + +  + S    +R +          +   IS  F +    ++ P      + V+ ++  + + G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL+F +  G   D +G+  +++ F  L+  T+L
Sbjct:   11 LYFVQGIPYGLQSSLLPLYLRGAGHSLTRIGFTKILYFPWVLKVLWAPLVDRVGTKRRWVVATVCGLALTCLSSAALAPEAHIWGVAGTLLAMNTLASVQDIAVDGAAVGLLKGRGELGLGNTAQVVGYKAGSVFAGGGLLA---------VIDVAGWSWMF-VLLTFVYSGMA-LFVWGTPVLDHETVRGQQADGTKRGGQGGEALRPWRIWRKLLAVPGTPWTVLYVLTYKLGEQGAVTMFPLFLLDHHMTARELGFWNGVISMGFSICGSSLGGLLLA-QFSIGALMRRV---------FVLRTISMVFQSSLLTVLEPSPLMKGMAVLSMSVQHFLGGLITTLTFTTMMHCTQRAEESIQATHYSFLATLEVLGKLMFGALAGGLVDWFGFQVAFLFFLSLSAGTAL 400          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Medaka
Match: si:dkey-229d2.4 (major facilitator superfamily domain containing 3 [Source:NCBI gene;Acc:101158952])

HSP 1 Score: 150.214 bits (378), Expect = 3.976e-39
Identity = 121/411 (29.44%), Postives = 211/411 (51.34%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVIN-FVVMNFLCSIQDVSLDTLTMSVLKD-NNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMT--------FMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSL 1359
            +Y VQG+PYG+Q+  LP+YLR  G SL+ +G  K+LY P +L+ L+AP+++   + +  +  +V  L    +  + L      + V    + MN L S+QD+++D   + +LK    +  GN AQVVGYK G++  GG ++          +  +AG  +   +L T + SG +  +     V +   +   Q + T         +   +I++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+G W G++    S+ GS+   + +  + S    +R +          +   IS  F +    ++ P      + V+ ++  + + G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL+F +  G   D +G+  +++ F  L+  T+L
Sbjct:   11 LYFVQGIPYGLQSSLLPLYLRGAGHSLTRIGFTKILYFPWVLKVLWAPLVDRVGTKRRWVVATVCGLALTCLSSAALAPEAHIWGVAGTLLAMNTLASVQDIAVDGAAVGLLKGRGELGLGNTAQVVGYKAGSVFAGGGLLA---------VIDVAGWSWMF-VLLTFVYSGMA-LFVWGTPVLDHETVRGQQADGTKRGGQGGEALRPWRIWRKLLAVPGTPWTVLYVLTYKLGEQGAVTMFPLFLLDHHMTARELGFWNGVISMGFSICGSSLGGLLLA-QFSIGALMRRV---------FVLRTISMVFQSSLLTVLEPSPLMKGMAVLSMSVQHFLGGLITTLTFTTMMHCTQRAEESIQATHYSFLATLEVLGKLMFGALAGGLVDWFGFQVAFLFFLSLSAGTAL 400          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Medaka
Match: si:dkey-229d2.4 (major facilitator superfamily domain containing 3 [Source:NCBI gene;Acc:101158952])

HSP 1 Score: 143.28 bits (360), Expect = 6.228e-37
Identity = 117/402 (29.10%), Postives = 204/402 (50.75%), Query Frame = 1
Query:  157 LLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVIN-FVVMNFLCSIQDVSLDTLTMSVLKD-NNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMT--------FMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFP------LCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYF 1314
            L+ +  +Y VQG+PYG+Q+  LP+YLR  G SL+ +G  K+LY P +L+ L+AP+++   + +  +  +V  L    +  + L      + V    + MN L S+QD+++D   + +LK    +  GN AQVVGYK G++  GG ++          +  +AG  +   +L T + SG +  +     V +   +   Q + T         +   +I++  +    T  T+ Y+L YK+GEQGA  M PLFL+D      E+G W G++    S+ GS+   + +  + S    +R +          +   IS  F +    ++ P      + V+ ++  + + G++TT TFT MM C+Q+    +Q+T+Y+ LAT+EVLGKL+F +  G   D + + 
Sbjct:    5 LVFLGLLYFVQGIPYGLQSSLLPLYLRGAGHSLTRIGFTKILYFPWVLKVLWAPLVDRVGTKRRWVVATVCGLALTCLSSAALAPEAHIWGVAGTLLAMNTLASVQDIAVDGAAVGLLKGRGELGLGNTAQVVGYKAGSVFAGGGLLA---------VIDVAGWSWMF-VLLTFVYSGMA-LFVWGTPVLDHETVRGQQADGTKRGGQGGEALRPWRIWRKLLAVPGTPWTVLYVLTYKLGEQGAVTMFPLFLLDHHMTARELGFWNGVISMGFSICGSSLGGLLLA-QFSIGALMRRV---------FVLRTISMVFQSSLLTVLEPSPLMKGMAVLSMSVQHFLGGLITTLTFTTMMHCTQRAEESIQATHYSFLATLEVLGKLMFGALAGGLVDWHSHL 385          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000044308.1 (SMESG000044308.1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 423/423 (100.00%), Postives = 423/423 (100.00%), Query Frame = 1
Query:  175 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM 1443
            MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKLLYLPLILRTLYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLTIAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM
Sbjct:    1 MYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKLLYLPLILRTLYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLTIAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM 423          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000044308.1 (SMESG000044308.1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 332/332 (100.00%), Postives = 332/332 (100.00%), Query Frame = 1
Query:  448 MNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM 1443
            MNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLTIAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM
Sbjct:    1 MNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLTIAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM 332          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000044308.1 (SMESG000044308.1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 1
Query:  496 MSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM 1443
            MSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLTIAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM
Sbjct:    1 MSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLTIAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM 316          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000031444.1 (SMESG000031444.1)

HSP 1 Score: 239.58 bits (610), Expect = 3.152e-72
Identity = 168/413 (40.68%), Postives = 256/413 (61.99%), Query Frame = 1
Query:  148 HQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGGVMITXXXXXXXXXXXXIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLFLIDEKQNIGEIGLWXXXXXXXXXXXXXAYAVVYVKNKRSTYTAVRNLCXXXXXXXXXXXXXXSKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMMMQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILFTILAWATSLFLILFNNAF 1386
             +F+ ++F +Y +QG+PYGIQ++FLP+YLR++ FSL+ LG+MKLLY+P I++T YAP ++ YL+  + L+ SV LL    I ISF+   +   LV     +N   + QD++LD + ++ L D+ +  GN+AQVVGYK+GA++GGG +I  S ++ W  +FFI  + Y +G++     S F  + T      E+ Q        + +NY  +FK+      T     ++LIYK+GEQGA N+ PLFL+D  + + EIG W GI+GQ++S+ GS++A +     R  +  +  L +   PL  I  ++IS    N   +L F   V +VN +  +SGI TT  F +MM+CSQ   V +QST+YT LAT+EVLGKL+F++ VG+FTD +GYF SY LF IL++   +FL  +   F
Sbjct:    3 RRFIFMLFLLYGIQGIPYGIQSRFLPVYLRSQSFSLTVLGLMKLLYIPWIMKTFYAPFVDGYLTKVIWLEISVFLLLLTSIFISFISYKSTMLLVFGLFFLNLFSATQDIALDGVMIAKLSDSEIGVGNIAQVVGYKMGAVVGGGFLIFLSYYVGWNTIFFIISMLYMVGLM-----SIFLLKKTMHSRPCEKNQF-----QFSVVNYFNMFKSCFNSPGTLTLSLFVLIYKLGEQGAMNLFPLFLLDSGKTLNEIGFWTGIIGQLVSIFGSSFAALI--QTRGLWINLYLLSVISVPLHFIFVVIISTFLSNS--KLHFYFSVSMVNILLFLSGIRTTTAFCLMMKCSQSAPVSVQSTHYTFLATIEVLGKLIFSAFVGIFTDHFGYFCSYCLFFILSFCLLVFLHFYRELF 401          
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000075997.1 (SMESG000075997.1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.190e-6
Identity = 37/156 (23.72%), Postives = 77/156 (49.36%), Query Frame = 1
Query:  142 QYHQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKXXXXXXXXXXXYAPIINVYLSTKLCLQTSVL----------LLFFNFICISFLK-TFNLTYLVINFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIG 576
            Q  Q + ++ ++Y++QG+P G+ A  +P+ L+++  S S       ++ P  L+ L+API++   S+K   + + L          + + +F    +L     +  L   F ++NFL + QD+++D   +++L   +V   +    VG  +G  I 
Sbjct:   35 QDKQSICVLTFLYILQGIPLGL-AGSVPLMLQSKKVSYSTQATFSFVFWPFSLKILWAPIVDSMYSSKFGRRKTWLVPCQYLIGLTMFYVSFNAQKWLSGDIEILKLTSAFFLLNFLAATQDIAVDGWALTMLSKTSVGWASTCNSVGQTVGYFIA 189          
The following BLAST results are available for this feature:
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MFSD34.252e-1925.57major facilitator superfamily domain containing 3 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MFSD32.790e-3929.95si:dkey-229d2.4 [Source:ZFIN;Acc:ZDB-GENE-060526-2... [more]
MFSD33.396e-3929.95si:dkey-229d2.4 [Source:ZFIN;Acc:ZDB-GENE-060526-2... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mfsd34.585e-3829.30major facilitator superfamily domain containing 3 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q4V8E5|MFSD3_RAT9.338e-3930.29Major facilitator superfamily domain-containing pr... [more]
sp|Q5U419|MFSD3_MOUSE1.940e-3129.30Major facilitator superfamily domain-containing pr... [more]
sp|Q96ES6|MFSD3_HUMAN2.042e-1825.57Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F2H21.424e-5435.96Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1I8GVL21.506e-5437.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GEB02.775e-5437.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G5307.668e-5337.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K4F2U41.024e-5034.78Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-229d2.47.731e-3028.08major facilitator superfamily domain containing 3 ... [more]
si:dkey-229d2.47.731e-3028.08major facilitator superfamily domain containing 3 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MFSD33.266e-730.60major facilitator superfamily domain containing 3 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO453151.921e-3335.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439611.073e-1425.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-229d2.43.976e-3929.44major facilitator superfamily domain containing 3 ... [more]
si:dkey-229d2.43.976e-3929.44major facilitator superfamily domain containing 3 ... [more]
si:dkey-229d2.46.228e-3729.10major facilitator superfamily domain containing 3 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044308.10.000e+0100.00SMESG000044308.1[more]
SMESG000044308.10.000e+0100.00SMESG000044308.1[more]
SMESG000044308.10.000e+0100.00SMESG000044308.1[more]
SMESG000031444.13.152e-7240.68SMESG000031444.1[more]
SMESG000075997.18.190e-623.72SMESG000075997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017266 ID=SMED30017266|Name=Major facilitator superfamily domain-containing protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1932bp
TATAAGAGTAAGATGAATCGATAAAAACTTATAATAACTTAGTTTTTTTA
ATTTTAGTTAAGAGTTAATTTAGTTTTTTTTAATGAAGTGTAATTTATTG
AAATCTATGTCATAAATAGATAAAAGTTTATTATGATATCTCAATATCAC
CAATTTTTGTTGATAATATTTTACATGTATGTAGTTCAGGGTCTACCATA
TGGAATTCAAGCAAAGTTTTTGCCCATTTATTTAAGAACTCGTGGGTTTT
CACTTAGTGCACTAGGAGTAATGAAACTGCTTTACTTACCACTAATATTG
CGTACATTGTACGCTCCAATTATCAATGTGTATCTTTCTACGAAGCTGTG
TCTTCAAACCAGCGTTTTATTGCTATTTTTTAATTTTATTTGTATATCAT
TTTTAAAAACATTTAATCTCACTTATTTGGTTATTAATTTTGTTGTAATG
AATTTTCTTTGTTCTATTCAAGATGTATCTTTGGACACATTAACAATGAG
TGTTTTGAAAGATAATAATGTTAATGAAGGAAATGTTGCACAAGTTGTTG
GATATAAAATCGGTGCTCTAATTGGTGGAGGAGTAATGATAACTTTCAGT
CAATTTCTCAGTTGGTTTCAGTTGTTTTTTATAGCAGGACTTTTTTATGC
ACTTGGAATTTTATTTACTCTAATATCCAGTGGATTTTCAGATGAATATA
CTAATTCTTTTTCTGTTTACGAACAAGTTCAAATAACGGAAGTTCAAAAT
AATATGACGTTTATGAATTATTTGAAGATATTTAAAAACTCAATATACGA
TTACTCAACTTGCATAACAATAGGTTATCTCCTTATTTATAAAATGGGAG
AACAAGGGGCAACTAATATGTTACCGCTATTTTTGATTGATGAAAAACAA
AACATTGGAGAAATCGGTCTATGGATTGGAATAGTTGGGCAAATCATTTC
TGTCATTGGTTCTGCATATGCTGTTGTTTATGTCAAAAATAAAAGGAGTA
CATATACAGCTGTAAGAAATCTATGCCTAACAATTGCACCTTTAATAACT
ATTTTGACAATAGTAATTTCTAAACAATTCCATAACAGGTTTCCTCGATT
AATTTTTCCATTATGTGTTATTGTGGTGAATTGTATAAATCTCATCAGTG
GAATTCTAACCACCGCAACTTTCACAATGATGATGCAGTGCTCACAGAAA
GTTTCAGTGCATCTCCAGTCAACAAACTACACGATCCTTGCAACTGTAGA
AGTTTTAGGAAAATTACTTTTTACATCATCTGTTGGATTATTTACTGATA
AATACGGTTACTTCTACAGTTACATTCTGTTCACAATTCTAGCATGGGCC
ACATCCCTGTTTTTGATTTTATTTAACAATGCTTTCGAATTTTCTATTTT
CCGTTACTCGTATCGACCTAGATCTATATGTATCGATGACATGTAGAAAC
CTTTTTTTTAATAAGATCTCTTTAATTTATTTTTAAAATTTACCATCTAA
ATTTTACACACGCATACACATGTAAAAAGATTATTTAGATTTTTTGTTTA
AGTTATGTATTAAATTTATTTTTCTTTTGATTGTATGGAGTTATGAGGAA
TAGAAATTTAACGTGTTTGGCTCTATCAACTAGAATTAGATCATTTTCAT
CGAAGTACCATCATTTGTAAAGTCAATATTTTTTGGAGTAAACTATAAGA
TAAAGCAAGCAAATTTGATACTTAAAAGTCGATAAGTAATGTTCTTTGAA
AAATTGCCAATAATTAATTAAGTGGGTATCCAAGCTTGGCGAATGCGATA
TTGTTCTATGAAACAGGAAAGACGGATGAACCCAAAGTAATAATCGATGT
GAGTGCCAAAATCGAATTTCGTCGATGAAAGTTAAATCCCGATCCTACTC
GTGTTCAACAAATCATATTTCTAGATGCTGCG
back to top

protein sequence of SMED30017266-orf-1

>SMED30017266-orf-1 ID=SMED30017266-orf-1|Name=SMED30017266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=438bp
MISQYHQFLLIIFYMYVVQGLPYGIQAKFLPIYLRTRGFSLSALGVMKLL
YLPLILRTLYAPIINVYLSTKLCLQTSVLLLFFNFICISFLKTFNLTYLV
INFVVMNFLCSIQDVSLDTLTMSVLKDNNVNEGNVAQVVGYKIGALIGGG
VMITFSQFLSWFQLFFIAGLFYALGILFTLISSGFSDEYTNSFSVYEQVQ
ITEVQNNMTFMNYLKIFKNSIYDYSTCITIGYLLIYKMGEQGATNMLPLF
LIDEKQNIGEIGLWIGIVGQIISVIGSAYAVVYVKNKRSTYTAVRNLCLT
IAPLITILTIVISKQFHNRFPRLIFPLCVIVVNCINLISGILTTATFTMM
MQCSQKVSVHLQSTNYTILATVEVLGKLLFTSSVGLFTDKYGYFYSYILF
TILAWATSLFLILFNNAFEFSIFRYSYRPRSICIDDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR004752AmpG_permease/AT-1
IPR036259MFS_trans_sf
IPR024371AcetylCoA_trans_1-like
IPR020846MFS_dom
Vocabulary: molecular function
TermDefinition
GO:0008521acetyl-CoA transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0015876acetyl-CoA transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024371Acetyl-coenzyme A transporter 1-likePFAMPF13000Acatncoord: 92..156
e-value: 1.4E-5
score: 23.8
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 9..415
e-value: 2.6E-9
score: 38.3
NoneNo IPR availablePANTHERPTHR12778:SF10MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN 3coord: 5..410
NoneNo IPR availableCDDcd17485MFS_MFSD3coord: 11..413
e-value: 2.34878E-76
score: 240.977
NoneNo IPR availableTMHMMTMhelixcoord: 262..284
NoneNo IPR availableTMHMMTMhelixcoord: 323..345
NoneNo IPR availableTMHMMTMhelixcoord: 291..313
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 164..186
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR004752AmpG-like permease/Acetyl-coenzyme A transporter 1PANTHERPTHR12778SOLUTE CARRIER FAMILY 33 ACETYL-COA TRANSPORTER -RELATEDcoord: 5..410
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 9..415