Protocadherin gamma

Overview
NameProtocadherin gamma
Smed IDSMED30017265
Length (bp)3731
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin gamma (SMED30017265) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin gamma (SMED30017265) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin gamma (SMED30017265) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin gamma (SMED30017265) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017265

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017265SMESG000046654.1 dd_Smed_v4_11223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 257.684 bits (657), Expect = 2.251e-69
Identity = 227/791 (28.70%), Postives = 376/791 (47.53%), Query Frame = 1
Query:  301 LSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            + +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++++V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P   +   K  + ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V                 N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:   47 VCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPN----KSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR-VSRSSSAKVTINVVDVNDNKPVFIV--------------PPYNYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 790          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 255.373 bits (651), Expect = 2.489e-69
Identity = 227/791 (28.70%), Postives = 376/791 (47.53%), Query Frame = 1
Query:  301 LSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            + +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++++V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P   +   K  + ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V                 N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:   47 VCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPN----KSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPE-NSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAED-GGRVSRSSSAKVTINVVDVNDNKPVFIVP--------------PYNYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 790          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 254.988 bits (650), Expect = 2.806e-69
Identity = 223/787 (28.34%), Postives = 373/787 (47.40%), Query Frame = 1
Query:  301 LSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            + +VF       NYTI+E  P  + +G +  D+  + IPN  L   +     +   D       +    +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++++V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P   +   K  + ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V                 N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:   36 VCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPE-NSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAED-GGRVSRSSSAKVTINVVDVNDNKPVFIVP--------------PYNYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 779          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 254.988 bits (650), Expect = 2.806e-69
Identity = 223/787 (28.34%), Postives = 373/787 (47.40%), Query Frame = 1
Query:  301 LSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            + +VF       NYTI+E  P  + +G +  D+  + IPN  L   +     +   D       +    +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++++V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P   +   K  + ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V                 N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:   36 VCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPE-NSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAED-GGRVSRSSSAKVTINVVDVNDNKPVFIVP--------------PYNYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 779          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 257.299 bits (656), Expect = 2.933e-69
Identity = 230/807 (28.50%), Postives = 380/807 (47.09%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP-------EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            Y+   +L+    +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++ +V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P         Y+P      ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V  +              N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:    8 YIFAVLLA---CVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPN----KSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYNFYVP------ENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR-VSRSSSAKVTINVVDVNDNKPVFIVPPS--------------NCSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 758          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 157.532 bits (397), Expect = 2.478e-38
Identity = 153/572 (26.75%), Postives = 267/572 (46.68%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEF-RQTYEIPV--YATD-GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN----FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL----KRNG--SLFSKITFDRELK-DEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI 2280
            L   + + I + D ND+ P       +  ++E +  +G+ +    AID+D +  N  + Y +  + D     I  +++  ++ TK +D ET   Y L + A + G   L +   I + + D+ND  P F K  + + + E    G  II L+A D D+D K+ Y +       +RE F++ + G+   + ++  E  RQ +++ V   ATD G       + +F+ DVN+  P +N +P S+ + E+ P    V  +  +D D  D   + R    +  S      F  DP+   ++V  D      LDRE+  T ++ +   D       TST  I + + D+NDN P F+   Y A I E+  +G   LQV A D D   N  + Y + E  ++     F ++  SG +    +LDRE+     L I A ++   +L +A + + + ++D NDN P    L   L I EN      +G I++ D D G+N    F +    +   FD+    ++NG   + ++  FD E K +++   ++ +   +    SST P+ +++ D NDN P +
Sbjct:  100 LSSTVPLTINVIDINDHAPTLIAAQKMITLEENV-AIGEEVGRVYAIDED-SGPNGIIKYSMEGSEDF----IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRI----EEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD---NARIVYSIDSSQF----FRIDPSSGDISVSSD------LDREDRATFSVIVTASDHASPPLNTSTQ-IEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL-SAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL----SSTVPVRIHVSDVNDNKPAL 641          

HSP 2 Score: 146.747 bits (369), Expect = 4.571e-35
Identity = 182/660 (27.58%), Postives = 294/660 (44.55%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR----NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMK 2571
            V+I + D NDN P+F   S+   I E +  +   I   KA D+D    N +V Y +  +S    L I   +T  + L + ID +      + + A +     L S + + I +ID+ND  P        + L+EN  IG+ + ++ A D+D   +  + Y M  S      E F + E +G +   K LD E    Y + V A D       +++ I + ++D+N++ P+++    ++T+ E  P    +  I +K VD +D +  I  +       +  +  + D     L+V        +L R++   R        GGL  R     V+ + + DVN  P     PF   +I E++ IG  V+ + A D D  +NA+I YSI    + FF I+P+SG I+    LDRE++  + + + A + +   L N +T + + + D NDN P+         I E++        + + D D G NG   + L  S  +    L R    +G+L      DRE      L I   D G P S S+   I + + D NDNAP           +QL     S +L        + EN   G  + T VA DAD+G+NA ++F +    D    A LF I+ED     + RI++R    DY+ K
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENIT-IPAVIATVKATDEDFG-TNGKVHYSMASSSGIGGLTIDY-STGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS------EDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQI--ITLKAVD-NDEDQKITYRIEEADREVFSILDIGDQGAI-LSVSG------ELKRQDHKVRVEISATDQGGLQGRC----VVNVFIDDVNSAPYFNDHPF-SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPL-NTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTF---------EQL-----SYDL-------YIAENSPVGSTVGTIVARDADEGDNADISFRIFGGAD----AKLFDIEEDAEQNGVVRILTRAEF-DYEAK 606          

HSP 3 Score: 112.079 bits (279), Expect = 2.115e-24
Identity = 147/556 (26.44%), Postives = 241/556 (43.35%), Query Frame = 1
Query:  955 IKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            ++I ++D+ND  PVF    + + + EN  I  +I  ++ATD+D   + K+ Y M SS+  I   T     TGEV L + +D +      + + A DG     +S   + I V D+N+H P+       +TLEEN      VG++   D D S  NG I+          +D     D      T          LDRE     ++ +   D G     TST+ I + + D+NDN P F    Y   I E    G +++ + A D D  E+ +I Y I E     FSI  + G   AI  +  E K       + I+ + +        VN+ + D N        P  ++I E+      +  + +ED D G+N + V+S+ +S+   +F +   +G +      DRE +  + + +  +D   P   +ST+ I V + D NDN+P            Q  S + +  +  +I         G       A DAD G N  V + + + + S  I  LF +D  +G++++S  + R+      + I A D+G  SL
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG-IGGLTIDYS-TGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIK----YSMEGSEDFIIDEDSGLIKTT--------KLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI-LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ---FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ-IEVILDDINDNSP------------QFTSSSYAATISEDI-------PVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQ-LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL 513          

HSP 4 Score: 92.0485 bits (227), Expect = 2.247e-18
Identity = 118/475 (24.84%), Postives = 197/475 (41.47%), Query Frame = 1
Query: 1261 IRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQD---QLESKNNSQ---------NLGSEIIKASVYENP-------------GFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            + I V DVN++ P +  +  ++T+ EN     ++  +   D D    NG +        S +  L       E  L        R ++D + +P   +  I    G    L+ST  +T+ V+D+ND+ P          ++EN  IG++V +V A D+D   N  IKYS +EG  +F  I+ +SG I   + LDRE    Y L + A +    +L N +TT+ + + D NDN P            + K Y      ISE+   G+   T+ ++ N ++              KIT+  E  D                         +ILD  D   ++SV   LK QD   ++E     Q         N+  + + ++ Y N              G+ + T  A+D D+G+NA++ +++    DS+Q    F ID  +G I +S  + R+    + + + A D     L T
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFG-TNGKVH-YSMASSSGIGGLTIDYSTGEVTL--------RERIDAKNSPITAV--IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYS-MEGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSL-NTSTTIAVVLKDINDNAPTF----------DKKEYNV---TISEEMPRGSQIITLKAVDNDED-------------QKITYRIEEADREVF---------------------SILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI----DSSQ---FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNT 407          

HSP 5 Score: 87.8113 bits (216), Expect = 4.138e-17
Identity = 80/294 (27.21%), Postives = 139/294 (47.28%), Query Frame = 1
Query: 1606 VITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQI 2481
            ++ + V+DVNDN PVF+   Y   I EN  I   +  V A D+D   N ++ YS+         +I+ ++G +T   R+D   K +   A++      +   ++T  + I V D ND+ P +   +K+  + EN+   + +G + + D+D G NG   +S+  S+  D+   + +G + +    DRE    Y L +   D+G P   +ST  I V + D NDNAP      T  +++   + +     GS+II     +N   +  T   ++AD+       F++ DI D   I
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID--AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE--DFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAP------TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADRE-----VFSILDIGDQGAI 278          

HSP 6 Score: 67.3958 bits (163), Expect = 7.723e-11
Identity = 89/355 (25.07%), Postives = 148/355 (41.69%), Query Frame = 1
Query:  343 TIQENHPSG---IQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLE----ILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKD----NTPRLRLTKDIDYETKN---FYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNH--PPSYNLNPASLTLEENQPPNIL 1359
            TI E+ P G   +QV  I +DI   PN  +  FL+ S   +     + F LDR S  L+ + K+D E    I+ P F  D G               L     + + + D NDN P F   S+   I E    VG T+    A D D  + N+ + +++   +D     I +D       R+    + DYE K    F+EL          +L S + ++I + D+ND +P  K  +  +   +N ++ + I  + A D D+++ L Y  +   + I  E +  K   +    + +DV F+         +DG  T  S  R     V       S+ L+ A +T+++   P + 
Sbjct:  433 TISEDIPVGTSFLQVSAIDADIG--PNGIVDYFLNES---SSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT------------PSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAE-NSPVGSTVGTIVARDADEGD-NADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFEL-----QASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEY-FLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTC------VSDGANTECSTCRFIHVLVEPEWLSESFTLSLARMTVDDFWDPLVF 756          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 157.147 bits (396), Expect = 3.483e-38
Identity = 153/572 (26.75%), Postives = 267/572 (46.68%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEF-RQTYEIPV--YATD-GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN----FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL----KRNG--SLFSKITFDRELK-DEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI 2280
            L   + + I + D ND+ P       +  ++E +  +G+ +    AID+D +  N  + Y +  + D     I  +++  ++ TK +D ET   Y L + A + G   L +   I + + D+ND  P F K  + + + E    G  II L+A D D+D K+ Y +       +RE F++ + G+   + ++  E  RQ +++ V   ATD G       + +F+ DVN+  P +N +P S+ + E+ P    V  +  +D D  D   + R    +  S      F  DP+   ++V  D      LDRE+  T ++ +   D       TST  I + + D+NDN P F+   Y A I E+  +G   LQV A D D   N  + Y + E  ++     F ++  SG +    +LDRE+     L I A ++   +L +A + + + ++D NDN P    L   L I EN      +G I++ D D G+N    F +    +   FD+    ++NG   + ++  FD E K +++   ++ +   +    SST P+ +++ D NDN P +
Sbjct:  459 LSSTVPLTINVIDINDHAPTLIAAQKMITLEENV-AIGEEVGRVYAIDED-SGPNGIIKYSMEGSEDF----IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRI----EEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD---NARIVYSIDSSQF----FRIDPSSGDISVSSD------LDREDRATFSVIVTASDHASPPLNTSTQ-IEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL-SAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL----SSTVPVRIHVSDVNDNKPAL 1000          

HSP 2 Score: 148.288 bits (373), Expect = 1.673e-35
Identity = 190/711 (26.72%), Postives = 314/711 (44.16%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR----NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMK 2571
              ++ +S V++TA  +D E L         +  L+++ +     +      V+I + D NDN P+F   S+   I E +  +   I   KA D+D    N +V Y +  +S    L I   +T  + L + ID +      + + A +     L S + + I +ID+ND  P        + L+EN  IG+ + ++ A D+D   +  + Y M  S      E F + E +G +   K LD E    Y + V A D       +++ I + ++D+N++ P+++    ++T+ E  P    +  I +K VD +D +  I  +       +  +  + D     L+V        +L R++   R        GGL  R     V+ + + DVN  P     PF   +I E++ IG  V+ + A D D  +NA+I YSI    + FF I+P+SG I+    LDRE++  + + + A + +   L N +T + + + D NDN P+         I E++        + + D D G NG   + L  S  +    L R    +G+L      DRE      L I   D G P S S+   I + + D NDNAP           +QL     S +L        + EN   G  + T VA DAD+G+NA ++F +    D    A LF I+ED     + RI++R    DY+ K
Sbjct:  318 LAINAKSGVIQTAAPLDRETL--------SLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENI-TIPAVIATVKATDEDFG-TNGKVHYSMASSSGIGGLTIDY-STGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS------EDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQI--ITLKAVD-NDEDQKITYRIEEADREVFSILDIGDQGAI-LSVSG------ELKRQDHKVRVEISATDQGGLQGRC----VVNVFIDDVNSAPYFNDHPF-SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPL-NTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTF---------EQL-----SYDL-------YIAENSPVGSTVGTIVARDADEGDNADISFRIFGGAD----AKLFDIEEDAEQNGVVRILTRAEF-DYEAK 965          

HSP 3 Score: 140.969 bits (354), Expect = 2.820e-33
Identity = 189/717 (26.36%), Postives = 312/717 (43.51%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIH--DQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            FTLD  S  ++ AK +D E+L      D  +    L V  ++        +  +V+H  D  DN P+F   S+  +I+E    +G T+    A D D  E N  + Y L + +    L I+   +  ++    +D ET +   L +IA + G  + +S   ++I ++D+ND  PVF    + + + EN  I  +I  ++ATD+D   + K+ Y M SS+  I   T     TGEV L + +D +      + + A DG     +S   + I V D+N+H P+       +TLEEN      VG++   D D S  NG I+          +D     D      T          LDRE     ++ +   D G     TST+ I + + D+NDN P F    Y   I E    G +++ + A D D  E+ +I Y I E     FSI  + G   AI  +  E K       + I+ + +        VN+ + D N        P  ++I E+      +  + +ED D G+N + V+S+ +S+   +F +   +G +      DRE +  + + +  +D   P   +ST+ I V + D NDN+P            Q  S + +  +  +I         G       A DAD G N  V + + + + S  I  LF +D  +G++++S  + R+      + I A D+G  SL
Sbjct:  213 FTLDTMSGEIRLAKSMDREVL------DKHI----LKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDA-PIGTTVLSVFARDLDSGE-NGEIEYSLGEGNGKNLLAINA-KSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG-IGGLTIDYS-TGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIK----YSMEGSEDFIIDEDSGLIKTT--------KLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI-LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ---FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ-IEVILDDINDNSP------------QFTSSSYAATISEDI-------PVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQ-LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL 872          

HSP 4 Score: 139.813 bits (351), Expect = 6.467e-33
Identity = 109/343 (31.78%), Postives = 165/343 (48.10%), Query Frame = 1
Query: 1591 LTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            +++++ + + VLDV DN P+F    Y  +I+E+  IG  VL V A D D  EN +I+YS+ EG   N  +IN  SG I     LDRE     +L ++A +K       +T  V I V D NDN P        + I+EN+     I  + + D+DFG NGK  +S+ +S       +    G +  +   D +        IR  D   P + SST P+ +N++D ND+AP      TL    ++ +   +  +G E+    VY           A D D G N  + ++ME   D       FIIDED+G IK ++++ R+    Y +K+ A D G  SL T
Sbjct:  250 ISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKR-ESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAP------TLIAAQKMITLEENVAIGEEV--GRVY-----------AIDEDSGPNGIIKYSMEGSED-------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNT 563          

HSP 5 Score: 67.0106 bits (162), Expect = 9.970e-11
Identity = 89/355 (25.07%), Postives = 148/355 (41.69%), Query Frame = 1
Query:  343 TIQENHPSG---IQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLE----ILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKD----NTPRLRLTKDIDYETKN---FYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNH--PPSYNLNPASLTLEENQPPNIL 1359
            TI E+ P G   +QV  I +DI   PN  +  FL+ S   +     + F LDR S  L+ + K+D E    I+ P F  D G               L     + + + D NDN P F   S+   I E    VG T+    A D D  + N+ + +++   +D     I +D       R+    + DYE K    F+EL          +L S + ++I + D+ND +P  K  +  +   +N ++ + I  + A D D+++ L Y  +   + I  E +  K   +    + +DV F+         +DG  T  S  R     V       S+ L+ A +T+++   P + 
Sbjct:  792 TISEDIPVGTSFLQVSAIDADIG--PNGIVDYFLNES---SSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT------------PSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAE-NSPVGSTVGTIVARDADEGD-NADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFEL-----QASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEY-FLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTC------VSDGANTECSTCRFIHVLVEPEWLSESFTLSLARMTVDDFWDPLVF 1115          

HSP 6 Score: 62.7734 bits (151), Expect = 2.144e-9
Identity = 72/280 (25.71%), Postives = 118/280 (42.14%), Query Frame = 1
Query: 1717 VVAHDKDDKENAQIKYSILEGPT-----NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN---PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKI 2526
            ++A  K    ++Q  Y  +  P      N F+++  SG I   + +DRE    + L + A  + +    +A+TTV + V D  DN P         EI E+      + ++ + D D G NG+  +SL      +   +  ++G + +    DRE      L++  +D G P  R ST  + + ++D NDNAPV                       S+    ++ EN   P   IAT  A D D G N +V ++M     S+ I  L  ID   G + +
Sbjct:  183 IIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYER-VDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTP-KRESTAMVEITVVDVNDNAPV---------------------FASDSYNVTILENITIPAV-IATVKATDEDFGTNGKVHYSM---ASSSGIGGL-TIDYSTGEVTL 434          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 148.288 bits (373), Expect = 1.862e-35
Identity = 153/587 (26.06%), Postives = 263/587 (44.80%), Query Frame = 1
Query:  859 LTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFTSN---SKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQIN-VKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP-VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            + K  D+E +  Y+ T+IA N   +   S + I+++  D+ND  P+F    + L + E  K  + ++ + A+D D  +   +G VS        +F++   TGEV   K L    R  + + V A DG   S+   + I I V D +   P ++ +   +   E+  P I +G +  +  V  S  +GD            QD  F  D     + V   +         +A      L+     L    ++ + + + + D NDNPP FS    +  I+E+  + +    V A DKD K+N +++YSI+   P +   I+  +G ++    LD E   NY+L + A +  +    ++  T+ I V D NDN PE       +E++EN  P   +G +++ DKD   NG+ V+ + N  E  YF + ++ G++++K + DRE+     ++I   D GVP  RSST    +++LD NDN P  +S+   +               GS +  A         I T VA D DKG N  V +         Q+     + + NG + + R ++       ++ +I  D+G
Sbjct:  597 IQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGT---FGEVSYHILSESSSFSINPVTGEVFAQKPLA---RGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGD------------QDHNFSIDEDTGKIYVTRYL---------DADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR-SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE--YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVP-PRSSTASARISVLDVNDNPPSCLSITPIVVPA------------GSPLSTA---------IGTIVAMDPDKGLNGSVLYRA-------QLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQG 1122          

HSP 2 Score: 140.198 bits (352), Expect = 5.386e-33
Identity = 174/658 (26.44%), Postives = 297/658 (45.14%), Query Frame = 1
Query:  637 IVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF-TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            + I D NDN P +        +     G  +T+    A D D+ + N  + Y +    DT  + I K+ T R+ +   ID    +  +  + A + G   L + L++  +++D     P F+K L+++ + E+T IG  ++K+ A +       ++ Y + +    +  +T +    G V + KT D E +++Y+  V AT+    TS S I I ++DVN++ P +  N   LT+ E   P   +  ++  D+D S   G++     L +S+     F  +P      V  ++F++  L R       + +   DGG      S + I + V+D +   P FS   Y+ +  E+   G  +  V A  K       +KYSI  G  +  FSI+ ++G I   R LD +    +   +L I  +L +  +  T V I + D NDN P+      ++ I E+LK ++    + + DKD   NG+  +S+I+S      ++ +  G L +    D E    Y L ++  DLG+P  RSS   + +++LD NDNAP        K    +E   NS               P   +   VA D D  EN Q+ +    IT+ ++    F IDE  G++   R + R+VI    + I+A DKG
Sbjct:  429 LTIGDINDNAPQWHSSQIHISLNRT-QGGSRTL---TAKDPDLGQ-NGWIRYSV---LDTELVSIDKE-TGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMS----GTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMD-SGTFGEV-SYHILSESS----SFSINP------VTGEVFAQKPLARGRF---HLVVSAKDGGGQSSENSAN-IHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADV---HDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIP-PRSSNMTLFIHVLDVNDNAPEFE-----KSWYTMEVLENSP--------------PKTIVGKVVARDKDSLENGQIVYR---ITNGSE---YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKG 1021          

HSP 3 Score: 112.079 bits (279), Expect = 2.249e-24
Identity = 143/598 (23.91%), Postives = 258/598 (43.14%), Query Frame = 1
Query:  451 FTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELP----KAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYAT--DGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIR----CQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVP 2211
            ++ ++++E+ T+D  S  +   K  D E             +   V+     ++    + + I + D NDN P+F    +   ++E     G   E P     A D D       V Y +   S +F +      T  +   K +    +  + L + A + G    ++   I I +ID +   P F +  +E+   E+   G  I  + A      SK+ Y + S     N   F++ E TG++ + + LD +   T  + + AT   GE ++ +++ IF+ D N++PP ++ +   +++ E+   +     +   D D    NG++R       P   S+++  +F    +   L           LD E      + +   D G+  R +S   + + VLDVNDN P F   +Y  ++ EN+     V +VVA DKD  EN QI Y I  G + +F I+   G +   R +DRE   +  ++I+A +K +    ++T +  I V D NDN P       + +         IG I++ D D G NG  ++      ++  F +K NG ++ +   +   +    L++ V+D GVP
Sbjct:  577 YSLQNQDEHLTVDTMSGTVCIQKTFDFE---------KQKSYQTTVIATNANSETSTSL-ISIRLKDVNDNWPIFYPNEYHLTVRE-----GPKPEEPLLVVSASDMDSGTFG-EVSYHILSESSSFSI---NPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-----SKVKYSIYSGDQDHN---FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE-SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKK-NGEVRYSIISSHP--GSSIEIDQFTGQLSTGSL-----------LDYEATRNYKLRVKATDLGIPPR-SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG-SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPR-SSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRA--QLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 4 Score: 101.293 bits (251), Expect = 3.521e-21
Identity = 176/816 (21.57%), Postives = 334/816 (40.93%), Query Frame = 1
Query:  238 LKH*SKRNMKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEIN-SRVLYKLNKASDTFELQISKDN---TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNL----NPASLTLEENQPPNILVGQINV----KDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTI-YLICHDGGL---HERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNI---GDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI---SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            +K  +K N+ I+ +++++  +     ++F      T+ E+   G ++G+IS    +      PK+      F     +++  +D +S  + T   +D E             F  + V V +  +    I++ + + D+NDN P F  +    +I E    +G +  LP   D D  + +  R +      ++ F+L   K N      L +   +D E ++ YEL + A + G       L   IEIID ND  PVF +  +   +  N  IG  +I ++ATD D  ++S++ Y  +  T++ +   FA+ ++G  ++  T  +    T+++ V A+D      +S++ + I V       P  ++       S  L EN     +V ++++    +D     +     C +   ++++                 Y +     LDRE A    + +L+  DG +   H +L       L + D+NDN P     ++ +QI  + N    G + L   A D D  +N  I+YS+L+  T   SI+  +G I     +D       +  + A +    AL +    V  ++ D     P+      ++EI E+      +  +++ +   GN+ +  +SL N  E    D   +G++  + TFD E +  Y   +   +     S +ST  I + + D NDN P+      H T++E  +                      P   +    A D D G   +V++ +   + S  I P+       G +   + ++R   G + + + A D G  S
Sbjct:    1 MKSKNKWNILIFSLIFLIFPTFCQCLTKF------TVPESAQIGTRIGWISGKREESA---APKYF---VVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSK---------FDIVAVKVEESGE---TIDILVEVDDENDNAPSFADQVVKLEISEFAQ-LGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYD-IKKTSAPSNSNFAISQSG--VITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHV-----------------YLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL-------LTIGDINDNAP----QWHSSQIHISLNRTQGGSRTL--TAKDPDLGQNGWIRYSVLD--TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPAL-STDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVD-TMSGTVCIQKTFDFEKQKSYQTTVIATNAN---SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPK----------------------PEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPV------TGEVFAQKPLAR---GRFHLVVSAKDGGGQS 720          

HSP 5 Score: 100.908 bits (250), Expect = 5.509e-21
Identity = 146/624 (23.40%), Postives = 269/624 (43.11%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDN-TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENT-KIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVN-NHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF----VPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSG------WITAIRRLDREEKINYQLAILAINKSLKALFN-ATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHS 2292
            F++D +  V++T  ++D EIL        G G            Q+   ++V++  ++ NDNVP FPM S  +++ E L  VG  +    A  KDV  +     + ++ +S       + D  T  + LT  +D+E    + LT+ A +   D   ++  + I + D+ND  P F K L++  +   T   G+   K+EA D D    L Y +   ++SI    F V      + MK L     + Y + V ATD     F+++  + + + +      P +        + EN    + +G  N+   ++ + +   R Q+P         KF    V  P +      ++   +V++D E   ++ +   CH               + VLD NDN PVF+   Y   +K++   G K+ Q++A D+D  EN ++ Y IL G   N  ++NP++G      W  A  +LD      +Q+ + A +    A        V+++++  + + P   LP  ++ ++E+      +  I + ++    N   ++SL   +     D+K  G L  K   D E +    + + V+D      RS+  P+ + +   ++ APV +  S
Sbjct: 1874 FSVDSEG-VIRTNLELDREILERYSLKVIGTG---------SGQQIGTRVDVRV--NNLNDNVPSFPM-SKPRRVPENLR-VGSYVATVGA--KDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFD---TFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSI----FRVAPESGALFMKVLP-PAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIG--NLSGEESREFH--YRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEF--QVEIDNEMMTSQKVQCKCH---------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDA--QLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVK-TGELTLKTHLDWESEPIISMYLSVSDGN---GRSAVVPLKIVVEPVDEFAPVFTKSS 2446          

HSP 6 Score: 62.3882 bits (150), Expect = 2.621e-9
Identity = 95/456 (20.83%), Postives = 181/456 (39.69%), Query Frame = 1
Query: 1255 SKIRIFVRDVNNHPPSYNLNPASL-TLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVF--SIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIM---------ENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACD 2586
            S ++I V  V   PP  +     + T+EEN      VG  + K + A+ +  + R             +F  +  ++ +       S + LDRE +    + +I  DGG       +  + + V D NDN P    S P  + +I E++ +GD + +  A D D  +N +  + +LE  +    + P +G +  +RRL   +  ++++ +  ++  +  L+      N+E+++ N   P+      LE +         E L   QFI  +  E           +S++       F +   G + + +  DRE+ + Y L +    +G    +     + V + + NDN P   +    +  + L                      G  +AT  A D D     +  F + D   S Q    F ID+  G+I ++  +  +V+ ++ + I A D
Sbjct: 1615 STLKIHVEPVFTEPPKISSTSCGVVTIEEN------VGIEDFKRILATGMTEESR------------FRFQGNAPKFSINSTTGSISVLPLDREASQEHLLIIILTDGGSR---NDSCTVRVTVADQNDNKPQLDASTP-SELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDL-VLRRLSSLQ--SWKIKLRVVDHGVPGLY---VEKNLEISNRN---PQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGL------TYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKV----IGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRV--------------------GSYVATVGAKDVDNLAPLRY-FLVSD--SSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD 2006          

HSP 7 Score: 56.225 bits (134), Expect = 2.026e-7
Identity = 99/406 (24.38%), Postives = 178/406 (43.84%), Query Frame = 1
Query:  832 SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQ----TYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQ-----PPNIL-VGQINV-KDVDASDVNGDIRCQEPLGKSN---LQDLKFVPDPAEYPLTVKY-DMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVL--DVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRL-DREEKINYQLAILAINKSLKALFNATTTVNIEVT--DENDNVPEIYLPKK 1983
            S D   RL +   ID E +  +E  +   N      K   +  + ++D ND  PVF    + L L ++   G+ I ++ A+D+D  ++ ++ Y ++S  N +N  T    +TG + L +  D +  +    T++I V A D                + HP    +    ++L+ +      P  +L V +++V +D     V   IR    LG  N   L  LK      +  + VK  ++  +  LD E  P  ++YL   DG        ++V+ L+++   V++  PVF+   Y  QI  +   G+ V Q+ A D+D   +  +KYSI +  +    I  ++G I   + L  R      Q+ ++A +   K    + TTV +E+   D   ++P++ L  K
Sbjct: 2175 SIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSG-NDLNIVTLN-PDTGSIQLNEWNDAQLDEFPNATWQILVEARD----------------HGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLK--EHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGN-----GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQST-VKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTK---QSKTTVYLEIGPFDVQPSLPKLLLHSK 2551          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 145.591 bits (366), Expect = 1.341e-34
Identity = 170/664 (25.60%), Postives = 289/664 (43.52%), Query Frame = 1
Query:  589 VNVWKENQLRGVINVKIVIH--DQNDNVPMFPMKSFVK-KIKEILYGVGKTIELPKAIDKDVTE-INSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASD--------------VNGDIRCQEPL--------------GKSNLQDLKFVPDP-AEYPL--------------------------TVKYDMFSRVQ-----------------LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVL-QVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLG 2346
            +  ++ N   G    +++IH  D+ND  P F     V  K+ E L  V   + +  +I +D+ E  N  V Y +  + +T    ++      L L   +D E  + +EL + A + G   L +  +I I + D+ND  P F+   + + + EN+KIG  II++ ATDKDKD++L Y +  S + I         TG + +   ++ E  + +   V  TDGE +S   + I V D N++ P  N   + + + +      ++  INV D+D SD               NG+I  + PL              G     +  F P     +P+                          +++Y + SR                   LD EE     +++I      ++ L++ +  T++++D+NDN P F    Y+  + EN+  G K++  V+A D D   ++++ Y I+ G  N   +   SG I ++R LDRE K  Y L + AI+   K      TTV + V DE+DN P       +E+ E+++  + +  + + D D  +N +  F L    E   F +  N G +F   + D E K  Y + +++ D    I  S    + VN+ D NDNAP+       K +    S+ NS  +G
Sbjct: 1618 IKTYRFNITAGKSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSI-LSGNTSLFAVNSTTGDILSLIP-LDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSL-ESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENS--GPKLIGHVIARDID--RSSRVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDG-KPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRIGEPVIQLSASDADEHSNHR--FELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETS----LFVNVKDVNDNAPIFE-----KPEYLFISEENSAEIG 2262          

HSP 2 Score: 92.0485 bits (227), Expect = 2.449e-18
Identity = 86/331 (25.98%), Postives = 159/331 (48.04%), Query Frame = 1
Query:  436 DSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEIL--CPKFCNDDGVGFLNLVVNVWKENQ-LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIR 1416
            DS  Y      +++  +++ + +LKT   +D E    C  F          ++   + +N+ L  +    I I D NDN P F  + +   + E     G  + +   I +D+   +SRV Y++       E  +++  + ++   +D+D ETK+ Y L + A ++G    +    + + ++D +D  P F + +F + + E+ +IG+ +I+L A+D D+ S   + +      I    F V E TG V +  +LD E +Q+Y I V  TDG +   + + + V+DVN++ P +   P  L + E     I  GQ +  D+D+ + NG IR
Sbjct: 1973 DSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVF----------IIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTE---NSGPKL-IGHVIARDIDR-SSRVFYEIVGGDANHEFMVTE--SGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGI---PFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVKDVNDNAPIFE-KPEYLFISEENSAEI--GQFHASDMDSEN-NGKIR 2278          

HSP 3 Score: 86.2705 bits (212), Expect = 1.356e-16
Identity = 100/361 (27.70%), Postives = 162/361 (44.88%), Query Frame = 1
Query:  934 ELKSYLEIKIEIIDMNDCE-PVFKKGLFELVLDEN----TKIGKLIIKLEATDKDKDSKLVYGMVSSTNSI--NRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSY----NLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAIN--KSLKALFNATTTVNIEVTDENDNVPEI 1968
            E   + ++KI I      E  V   G FE  + E     T++GK++I            L  G+  S   I  N   F +    G +     LD E  +TY   + A      S S++ I V D N+  P +     +N   L   +     +++G    +D+D    NG +      G ++L  +           +   D+ S + LDREE+    + +   D G+   L++TS I + V D+NDN P F +  Y  +I EN+ IG K+++++A DKD  ++A+++YS+      T  F IN  +GWIT   +++REE   ++  +   +  KS K +      V I V D NDN P I
Sbjct: 1533 ERVGFCDVKIHIDKAAFVENVVLSNGTFEFNISETADRFTEVGKIVI------------LGAGLEGSVFRIQDNDYNFTISPFDGTIFTNSPLDFENIKTYRFNITAGK----STSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQ-NGLVTYSILSGNTSLFAVN----------STTGDILSLIPLDREESSLHELLIEAKDAGI-PSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKD--KDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSKVI------VEIHVEDFNDNHPMI 1857          

HSP 4 Score: 73.9442 bits (180), Expect = 7.284e-13
Identity = 82/308 (26.62%), Postives = 142/308 (46.10%), Query Frame = 1
Query:  937 LKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD-----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRR 1836
            L +  +  I+I+D+ND  P F + L+   + EN+   KLI  + A D D+ S++ Y +V      N E F V E+G++  ++ LD E +  Y + V A D        N+ + + V D +++ P +     S       P ++ +G+  V  + ASD +               + +F  D     +  + D     +F    LD E+  +  I +   DG     L  TS+  + V DVNDN P+F  P Y    +EN+    ++ Q  A D D + N +I+YS+    + +F I P++G ++  R+
Sbjct: 2025 LSTITKATIKIVDINDNSPRFDQQLYRFNVTENSG-PKLIGHVIARDIDRSSRVFYEIVGG--DANHE-FMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF-----SRIFHVEVPEDVRIGE-PVIQLSASDAD------------EHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAW---LIETSLF-VNVKDVNDNAPIFEKPEYLFISEENSA---EIGQFHASDMDSENNGKIRYSV---TSPYFKIEPSTGVLSRFRQ 2300          

HSP 5 Score: 60.4622 bits (145), Expect = 1.061e-8
Identity = 67/240 (27.92%), Postives = 112/240 (46.67%), Query Frame = 1
Query:  622 VINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQ-----ISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNL 1311
            +I++ I + D NDN P+FP+     +I E    +G  +++  A D D  +  +   Y+L  +  T +       +  D    L +T  +D ET++ Y + L A + G  EL S   + I I+D+ND  P F  G+  L L+ N      +  L ATD D  ++S L Y ++ S  +   E F++ +  E IL+   + E  Q  E  V A D      ++   I + +   N H P+ N+
Sbjct:  100 IIHILIDVLDVNDNSPIFPIDVQRVEIPETA-PIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF--GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPT--SEMFSISD--ENILVTQNNTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINI 332          

HSP 6 Score: 59.6918 bits (143), Expect = 1.866e-8
Identity = 64/236 (27.12%), Postives = 116/236 (49.15%), Query Frame = 1
Query: 1609 ITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQI-KYSILEGPTNFFSINP-----NSG--WITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET-DYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVH 2289
            I + VLDVNDN P+F I   + +I E   IG +V    A D D+ +N  I KY +++      +++P     + G  ++    +LDRE +  Y + + AI++ +  L +++  +NI + D NDN P   + + L +  N  P   + ++ + D D   N    + ++ S  T + F +     L ++   +   + E+ +  R  D GVP   S+T  I VN+   N++ P I++ 
Sbjct:  103 ILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPEL-SSSCHLNILILDINDNPPNFGI-RSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNTECLQRCEFVVEAR--DSGVP-PLSTTLNIVVNMEYGNEHEPNINIR 333          

HSP 7 Score: 58.9214 bits (141), Expect = 3.145e-8
Identity = 51/213 (23.94%), Postives = 105/213 (49.30%), Query Frame = 1
Query:  790 YKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYG---MVSSTNSINRET-FAVKETGEVILMKT---LDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASD 1398
            Y+L++ +   +     + T  L ++  +D E++N  ++ +I          S + I I+++D+ND  P+F   +  + + E   IG  +    ATD D+      G   +V S  +++  + F + ++   + ++    LD E R  Y + + A D    E +S+  + I + D+N++PP++ +   SLTL  N  PN  +  +N  D+D+++
Sbjct:   57 YRLSRGNSKIKFD---EQTLELSVSSPLDRESENAIDMLIIT------SPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIR--SLTLNWNGLPNTKLFSLNATDLDSNE 258          

HSP 8 Score: 56.6102 bits (135), Expect = 1.339e-7
Identity = 74/292 (25.34%), Postives = 134/292 (45.89%), Query Frame = 1
Query: 1162 GEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKD-DKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDRE-EKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNI 2031
            G V + KT+  +F     +PV   +   T  S I + V+ +N H P   +    + + EN P   + G+I  +D D S ++G +   + L KS+  D  F  D     L       S    D E+  + T      D G   + T+    T+ + DVNDN P F   +Y A I   +N  + V  V A+D D D +N +++Y +L    +FF ++  +G +T I+ +    +++N  ++I A+N   +    + T + + VT  +    ++     + I +N K  + +G++
Sbjct:  589 GSVFVGKTITSDF---VTLPVTLVNRNTTQTSIITLIVKPLNQHSPICQI--TEIHVLENAPIGTIFGRIQARDED-SGLSG-VVSYKILTKSDDYDGIFHLDSTSGSLR------SLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPA-TIFIEDVNDNVPKFGSRYYTATISGKSN--ETVAIVQANDNDVDVKNQKLQYHLL-NYHDFFQLDKETGKVTTIQDVPMTWQRLN--ISISAVNMDSERFLQSKTFLLVTVTSSSKLAVQLNSGNLIRIFKNDKIGEKVGHL 861          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 135.191 bits (339), Expect = 2.087e-31
Identity = 175/689 (25.40%), Postives = 291/689 (42.24%), Query Frame = 1
Query:  682 KSFVKKIKEILYGVGKTIELP-------KAIDKDVTEINSRVLYKLNKASDT-----FELQISKD-----NTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD-------KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTL---DVEFRQTYEI-PVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRT-------------IYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI----YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV-FSLI-NSKETDYF---DLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            K   K   EI+   G T   P        A   + T I  R+L      SD      + L  SKD      T  + +T  +DYE    Y+L L+A ++G  ++ S  E  + I D+ND  P F +      + ++   G+ I  + ATD D       +  KL+Y +V    ++   + A   TGE+ L + +   D+    T ++  V  TDG FT+ +K+ + +    +  P               PP           ++ + VN        + K  +  L+F   P     +        V +DR+                   I L+  D          S +TL V+D+ND PP F +PFY   I E+   GD V+ V A   DD EN  I+YS+L+G  + FFS++P  G IT  ++L+ +  +   L I A + S     +ATTTV + +  E+  VP      YL     +ME+      +GN+I   +        + F+++  S+E+D F    ++R+ G +  K + DRE K+++ + IR +  G      +   + V+I D NDNAP              E    S++       A+V    G  +    A D D   + ++ F++    + N   P F ++E++G + ++  + R+ I  YK+   A D+G
Sbjct: 2164 KMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYSLSGSKDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPA---TGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQP---------------PPRFEQSHYVANALENTIVNKSALLTVAV-KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAF---STLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSA--TDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATD-SANPPHHATTTVEVNIASESVKVPRFSNSHYL---FSVMEDAD----VGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG---GVHAITTVTVDIGDVNDNAPAF--------HGDYERFTISED-------AAV----GTSVTIFSAMDRDDSPSGRIRFSL---VEEN---PYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG 2791          

HSP 2 Score: 106.301 bits (264), Expect = 1.173e-22
Identity = 112/472 (23.73%), Postives = 214/472 (45.34%), Query Frame = 1
Query:  844 TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEEN-QPPNILVGQIN--------VKDVDASDVNGDIRCQEPLGKSNLQDLKF--VPDPAE----YPLTVKYD---MFSRVQLDREEAPTRTIYLIC-HDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVND 2199
            T R+ +++ ++Y     Y++ L+  +      +++  + + +ID+ND  P F    +   + E+ K G  ++ + ATD D++  + Y ++  + S   + F+V    G + + K L+ +   T  + + ATD                + +PP +    A+ T+E N    ++ V + +        ++D D  +V G ++  E    + + +++F  VP   E     P +V+     +  +  LDRE      + +     GG+H    + + +T+ + DVNDN P F   + +  I E+  +G  V    A D+DD  + +I++S++E    +F +N NSGW+T   +LDRE+  +Y+L   A +   +  FN      I V+D ND+ P+ +  ++  I  +L     I +   +D D   N  + F +    E   F +  N  L  K     E K +Y L +   D
Sbjct: 2456 TGRIHVSRVLNYHRDKRYQIPLVVEDATG--RRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSES---QFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATD----------------SANPPHH----ATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQME----TEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVH----AITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVE-ENPYFDLNENSGWLTVASQLDREKIDHYKLIARATD---EGGFNTDLPFTIVVSDVNDSPPQ-FEKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFD 2889          

HSP 3 Score: 99.3673 bits (246), Expect = 1.788e-20
Identity = 143/593 (24.11%), Postives = 259/593 (43.68%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKA------SDTFELQI----SKDNT-PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCE----PVFKKGLFELVLDENTKIGKLIIKLEATDKDKD-SKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEI-----PVYATDGEFTSNSKIRIF---VRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ-LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWI---TAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY---LPKKLEIMENLKPYQFIGN--IISEDKDFGNNGKTV-----FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPI----SRSSTKPICVNILDDNDNAPV 2277
            +V I I D ND+ P+F  K ++++   ++   G  +    A D+D  E N +++YK          ++T E+ +     K N+ P      D+         L L+ + NG     + +  K + I + + E    PVF      + + E+  IG ++ KL+A D+D   +  +  ++      + E   V E +GE+ +   L    ++  E+      V A D      S ++     ++DVNNH P ++     L + EN+ P   + ++   D D  + NG I+    LG  N Q+   V       +  K  +   ++ LDRE+    T  +I  D G   R++ T+ +T+ V DVNDNPP   +   +A+I E+   G  V  + A D+D  +N+++K+ +L      F I+ +SG I        LD  +   + L+I   +     + + +  +++E+ D   N   I    + K+  + EN +    IG   I+ E K+ G+  K       + +I      +F + + G++ +    DRE K  Y + +   D    +     R     + + ILD ND+ PV
Sbjct:  477 DVSIEILDSNDHAPVFSAK-WMRQTPIVIGKPGDVLVKVDATDQDEGE-NGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNG-----TKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGN-NGKIKFS--LG--NNQEKSSV-----ISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTN-LTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF-LLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHG-DPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSE----IGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPV 1045          

HSP 4 Score: 97.8265 bits (242), Expect = 5.218e-20
Identity = 86/316 (27.22%), Postives = 151/316 (47.78%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRET--------FAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDA 1392
            F +D  + V+   K +D EIL          GF NL V V  + +      + + + DQNDN P F   ++  K+ E    +G  +   +A   D    N  + Y L K SD          T  L L K +D+ET +  +LT++A ++G   L++  +++I ++D ND  P F+K  +   + EN+K G+ ++ ++A D D +    +G VS    I  ET        FA+   G+V++ +++D E  + Y + V A DG      S + + I V D N+H P+++    +  ++E +     + + +V D+D 
Sbjct: 3059 FQIDDINGVVTVVKPLDSEIL----------GFFNLTV-VASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVME-SESIGYELAHFRASGGDQ---NETIEYYL-KPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEH---FGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDG 3355          

HSP 5 Score: 95.1301 bits (235), Expect = 2.678e-19
Identity = 161/697 (23.10%), Postives = 298/697 (42.75%), Query Frame = 1
Query:  592 NVWK-------ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLF--ELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVR---DVNNHPPSYNLNPASLTLEEN-QPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKEN----NNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGN--NGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPL--FIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            N WK          +  +  V + I D NDN P F        I E    VG ++ +  A+D+D +  + R+ + L + +  F+L    +N+  L +   +D E  + Y+L   A + G     + L   I + D+ND  P F+K  F  +L L   + I    IK +    +  S+     +   N      F +    +++L +   VE +  Y++ V A DG F +++K++I ++   D +   P  N    ++ L EN +   +++G+       +S +  ++  +      N+  + F     +   + + D     QL+      +    +C +           +IT+ + ++NDN P       K  I EN     +    + ++VA D D  E   IK+ +++     F I+  +G +T ++ LD E    + L ++A +      F    T+ + V D+NDN P        +++ME+    + IG  ++  +  G   N    + L  S  T + +L  + G L      D E      L +   D GVP   +  + + ++++D+NDNAP        KE+   + K NS++              G K+ T  A D D      V++ +E ++++    P+  F I+  NG + IS+ +  + I  Y +K+IA D G+  LR+E
Sbjct: 2678 NQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDA-AVGTSVTIFSAMDRDDSP-SGRIRFSLVEENPYFDLN---ENSGWLTVASQLDREKIDHYKLIARATDEGG--FNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQF---FIPKGN--EEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEAN---KTVILAENSKKGTVVLGE-------SSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKE-----------LITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDE---IKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGE----FEDKATILVTVIDQNDNAPTFEKSTYSMKVMES----ESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQ-VEISVMDENDNAPKFE-----KEKYVGKVKENSKS--------------GEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINS-NGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSE 3309          

HSP 6 Score: 88.5817 bits (218), Expect = 3.108e-17
Identity = 167/692 (24.13%), Postives = 285/692 (41.18%), Query Frame = 1
Query:  637 IVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNK-ASDTFELQISKDNTPRLRLTKDIDYETKNFYE-----LTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV----KETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRC-----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPF----YKAQIKENNNIGDKVLQVVAHDKDDKENAQ---IKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALF-----NATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKT----VFSLINSKETDYF--DLKRNGSLFSKIT-FDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGD--YKMKIIACDKG 2592
            I+   +N + P+F     + ++ E    +G  +   +A D+D T  N  + Y ++  A  + E+    + +  + +  D+    K   E     L + A + G     S   +K+ I D+N+  P F +  + L + EN K GK I K+ A D D  +    G +  +   N+E  +V     +TG V L+K+LD E +  +   + A+D  F    S + + I V DVN++PP   +  +   + E+ P    V  +   D D    N  ++      + P    +     F+  P EYPL      F  + ++  +     +   CH   LH          ++++D+  N    +I F     +A + EN+ IG +V+ + A +  D++  +   ++Y I+ G     FSI+   G +     LDRE K  Y + + A   S   L+          V I + D ND+ P    P  +  +    P   +   +        +       +F +       +F  DL       S I   DRE + E+ L + + D G P    S   + VN+LD+NDN+P  +                       I   SV      K+    A DAD+GENA++T+   +IT+ +     F ID +NG+I    I S  + GD  Y + + A D G
Sbjct:  596 IIQESENKHSPVFSSFPEIVEVTEDA-PIGTVVAKLQANDED-TGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNN---GKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQ-NSKLKFLLNSEKVPFRIDHHSGCIFIHAP-EYPLDYHKTPFFNLSIEVADHGDPILSTSCH---LH----------VELVDIAHNH--LAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSID-QKGTVRTTHLLDRETKSAYWITVEA-RDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEP-QLCSNVIVIVNVLDENDNSPTFT---------------------QAIHHYSVRSKFAGKLCRIFAVDADEGENARLTY---NITEGDA---RFSID-NNGNI----IASEAIHGDESYALTVQATDHG 1230          

HSP 7 Score: 78.5666 bits (192), Expect = 3.357e-14
Identity = 150/670 (22.39%), Postives = 272/670 (40.60%), Query Frame = 1
Query:  322 FEGNL-NYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEA------TDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPN----ILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFGNNGKTVFSL--INSKETDY----FDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            F G+   +TI E+   G  V   S+       +D          F+  ++N YF L+  S  L  A ++D E           +    L+     E      +   IV+ D ND+ P F  + F   I   L      +    +I  D    N+   + + K ++     I  +N   L L +    E K  Y+L + A++      ++  ++KI +    D +    +    ++L EN+K G +++   +      T K  D+     +V+  N I +    VKE+ ++   K   +EF +     +   D        I + + ++N++ P        ++++EN P +      + +I  +D D  ++    R  +  G      L  + D       VK        LD E      + ++  DG   ++ T    I + V+D NDN P F    Y  ++ E+ +IG ++    A   D  +N  I+Y +     T+F ++N  +G +T  + LD E     +L ++A +  +  L      V I V DENDN P+    K + ++ EN K  + +  + + D D  + G   + L  ++   TD     F +  NG +    + D E   +Y L +   D G P  RS    + +++ D+ND+AP
Sbjct: 2712 FHGDYERFTISEDAAVGTSVTIFSA-------MDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDRE----------KIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEF--NIDLHLPSTSPILHF--SIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNND--LLLKRPEIVENKMQYQLKVTAFDG---VFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVK----VKESDQIDYEKNQQLEFHR-----LTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIK--FRMVDDFG-----GLFQIDDINGVVTVVK-------PLDSEILGFFNLTVVASDGEFEDKAT----ILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPL-ETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEAL-LEIHVEDENDHAP 3324          

HSP 8 Score: 63.1586 bits (152), Expect = 1.396e-9
Identity = 118/609 (19.38%), Postives = 250/609 (41.05%), Query Frame = 1
Query:  475 YFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSR-VLYKLNKA--SDTFELQISKD--NTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD----GEFTSNSKIRIFVRDVNNHPPSYNLNPASLT---------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSIN-----------PNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQ-FIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKD-EYCLNIRVND 2199
            +F++D++ +V +T   +D E     +     V   +   +++K+ + R V++V I I D+ND+ P+     ++  + E        +++      DV    +  +++K+ +      F + ++     T  +R    +D E ++ +EL +   + G  +L S + + + ++D ND  P F + +    +   +K    + ++ A D D+  +++L Y +           F++   G +I  + +  +  ++Y + V ATD    G+  + +++ +        P     +P  ++         + +     + VG++   D D  ++   I   +P    ++ D++   D  +  L  K ++  R +L         + +   DG   +     S + +QV       P FS   Y+  + E   +G ++  +    K   E+   K  +     N FS++           P+SG +  +  LD E     +  +     ++K+   AT +VNI   DENDN P          ++        +  + + DKD G NG   +S+++  E   F +  ++G +      D EL+  E  L IR  D
Sbjct:  984 HFSIDQKGTV-RTTHLLDRETKSAYWIT---VEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRR---LDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV--RSKFAGKLCRIFAVDADEGENARLTYNITEGD-----ARFSIDNNGNIIASEAIHGD--ESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDP---DSVFDVR--QDTGQLLLAKKVELLKRGEL--------RLNISVTDGQAWDH----STVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTL----KASGESLGTKPLVF----NLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSF--ATFSVNI--NDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAID 1547          

HSP 9 Score: 58.5362 bits (140), Expect = 3.981e-8
Identity = 103/467 (22.06%), Postives = 188/467 (40.26%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDC------------EPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQ------------------INVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDRE-EKINYQLAILAINKSLKAL 1905
            E QL   + V + + D+NDN P F        ++      GK   +  A+D D  E N+R+ Y + +    F +    DN   +  ++ I  +    Y LT+ A ++G    + +   ++ ++  N              E   KK  + + + +  ++G  + KLEA+D D D   ++  +SS +      F V++ TG+++L K +++  R    + +  TDG+   +S + I V    +  P ++ +     + E     + VG                    N+  VD   +   IR +   G         V +P +Y    +     +VQ                       + S +  ++ + D NDN P F      A + E++ + D +  V A DKD  EN  + YSI+ G   + F I+  SG +   + LD E + +   L I AI+ +  +L
Sbjct: 1133 EPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKF--AGKLCRI-FAVDADEGE-NARLTYNITEGDARFSI----DNNGNIIASEAIHGDES--YALTVQATDHGTPG-QQFAATRV-VLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDE--LWWSISSGDP--DSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSER----VAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNV------IVMEPLDYEAARRIRAVVQVQ--------------------QANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSL 1553          

HSP 10 Score: 56.225 bits (134), Expect = 1.781e-7
Identity = 82/361 (22.71%), Postives = 160/361 (44.32%), Query Frame = 1
Query:  895 YELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLD-ENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVK-ETGEVIL--MKTLDVEFRQTYEIPVY-ATDGEFTSNSKIRIFVRD-VNNHPPSYNLNPASLTLEENQPPNILVGQ--INVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKD-----DKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEV 1938
            +   LIA +NG    +    +KI ++D     PVF + ++  V+  E+TK   +++K+ A  K        G++       +  F+V   TGEV L  +K L  E   T+E+     T  +  + +++ I V+  +  H P +      L    + P +  +GQ  + +K    SD N  I        S  +D++  P+  +  +T         QLD E+     + L+    G  ++++S +   + + DVND  P F      A+I ++   G  +  + A D D     D+E+ ++ Y I++G    F+I+P +G ++  R +++++ +N     +        +F A   + +E+
Sbjct: 2050 FNFKLIAKDNGSVH-RVEEPVKIRVVD--KARPVFSQNVYTAVISKESTKKSTVLVKVMA--KSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLNNLKML-AETNYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFE----KLKYTASTPESTSIGQRLLTIK-ATTSDENDTIE----YSLSGSKDIEIHPETGDVTITG--------QLDYEKTQKYDLKLVATSSG--KQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEI 2385          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 192.971 bits (489), Expect = 4.526e-49
Identity = 188/662 (28.40%), Postives = 303/662 (45.77%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPK--AIDKDVTEINSRVLYKLNKASDTFELQISKD---NTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +V I + D+NDN P F    +   + E      K I L K  A D D T  N  + Y L   SDT  +Q   D    +  + L   +D E ++ Y   +IA +NGH +  + + + I+I+D ND  PVFK  +  L + EN   G ++I L   D D + + +   + S +   +  F + ++GE+ + K LD E    Y + + ATDG+FT+ + + I V+D+N++ P Y L P    +  N+  +I    + VK +D  D    +R    L      D     +     +           LDRE  P   +     DG    +   + +I + V D+NDN P+FS+  Y+  + E+  +   + +V A DKD   N QIKYS++    ++F I+ ++G I   + LDRE    + L + A +  +  L ++  TV + + D NDN PE  + +   +I+EN      +  + +   D G N    + +++  E   F +    G L    T D E+   Y L I+  D G P   S+   + ++ILD NDN+P                    QNL    +   ++   G KI    A D D   N  VT+ +E   +  Q    F ID  NG+I +SR + R+ I  Y ++I ACD+G
Sbjct: 2845 DVLIDVRDENDNYPKFDNTFYSASVAE---NSEKVISLVKVSATDAD-TGPNGDIRYYLE--SDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDK--QAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP-YCLKP-RYHISTNESISIGTTLVEVKAIDF-DFQSKLRFY--LSGKGADDFSIGKESGILKVASA--------LDRETTPKYKLVAHVQDGKDFTQECFSEII-ITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKL-HSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTP-PLSNNAYVNISILDINDNSPTF-----------------LQNLYRINVNEDIF--VGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ----FSIDPKNGTISVSRPLDRETISHYTLEIQACDQG 3459          

HSP 2 Score: 165.236 bits (417), Expect = 1.787e-40
Identity = 171/624 (27.40%), Postives = 290/624 (46.47%), Query Frame = 1
Query:  445 FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLN-KASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIM--EN-LKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVIS 2283
            F+    DK   F + + S  L  AK +D E L           F NL + +  + +     NV+I + D NDN P      +     E +  +G T+   KAID D     S++ + L+ K +D F   I K+ +  L++   +D ET   Y+L     +      + + EI I + D+ND  P+F    + + + E+ ++  LI K+ A DKD   + ++ Y ++      N + F + K TG + L K+LD E    + + V A D    +  S + + + + D+N++PP +++   S  + EN      V ++    +D   VN DI        S  +  KF  D      +   D+     LD E +    + +   DGG    L++ + + + +LD+NDN P F    Y+  + E+  +G K+L V A D+D   N  + Y+I  G     FSI+P +G I+  R LDRE   +Y L I A ++      N+   +NI + D NDN P I+      ++  EN L  Y F+   IS+  +  N     F + +  E   F L+++GSL +   F+  L+DE+ + +RV D G P    S   + V I++++   P+++
Sbjct: 3003 FFIVSGDKQAQFQIGK-SGELFIAKPLDREQLM----------FYNLSI-IATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESI-SIGTTLVEVKAIDFD---FQSKLRFYLSGKGADDF--SIGKE-SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE----NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIG-VNADIHY---FIMSGNEQGKFKMD------STTGDLVLNATLDYEMSKFYFLTIQAIDGGT-PPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVP-ININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIEESQYPPIVT 3589          

HSP 3 Score: 157.918 bits (398), Expect = 2.990e-38
Identity = 174/643 (27.06%), Postives = 301/643 (46.81%), Query Frame = 1
Query:  721 VGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ--LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDN--PPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKE-NAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP----EIYLPKKLEI-MENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLF--SKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +G+T+   +A D+D+   N ++++ ++        +I  D    L++   +D E +N Y L +  ++ G+    +   + I I+D+ND  PV +K L    L E+ +IG ++  L ATD D   ++++ Y +     S+    F V   TG + L K LD E +  Y + + A DG     +S + + + V DVN++ P + +      + E+ P   ++  I   D    D+  +   Q  L +    +  F  D        K+    R Q  LD E      + +   DGG    LTS   I + ++DVN+N   P F    Y+ ++KEN   G  V+ V A D D  + N++I YSI  G     F++N + G IT++ +LD E K  Y L + A + ++  L N    V I+V +ENDN+P     +Y     E  +EN++    I  + + D D        +++++     YF++     +   ++   DRE + E+ L + ++D G P+  SST  I V++LD NDN+P         E DQ   K   Q   S  +  S+++          A D+D GEN ++T++++     N+    F ID   G I I++ +  D   ++++ I A D G
Sbjct:  787 LGETVAWIEAKDRDLG-YNGKLVFAISDGDYDSVFRIDPDRG-ELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL-----SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVD---EDIGPNAEIQFSLKEETQDEELFRID--------KHTGAIRTQGYLDYENKQVHNLIVSAIDGG-DPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNC-VEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE----IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPV-LSSTSRIVVSVLDINDNSP---------EFDQRVYK--VQVPSSATVNQSIFQ--------VHAIDSDSGENGRITYSIKSGKGKNK----FRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNG 1378          

HSP 4 Score: 142.895 bits (359), Expect = 1.119e-33
Identity = 173/728 (23.76%), Postives = 322/728 (44.23%), Query Frame = 1
Query:  475 YFTLDRQSSVLKTA-KKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNG---HDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLD--ENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPL----TVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK---KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            YF +D ++ V+KT  +K+D E        +     L + ++      L     + + + D NDN P F  + +  ++      V ++I    AID D  E N R+ Y +       + +I       + + K +D  + N +E+ + A +NG     +      + + +   +   P+  +   E V+D  EN K G L+ ++ A D D D +L Y +   +N  +  TF + ++ G ++L K LD E +Q+Y + +  TDG FT+ + + + V D+N++PP +  +   + + EN     ++ Q++  D D               K     L    DP+   L    ++  ++    +LD E+     + +   D G   +     +I + V D ND+ P F+    ++++ E+  IG K+ +V A D+D   NA+I+YSI+ G   + F I+P  G IT    L+  +   Y L + A++     L ++   V+I VT   ++ P+   P     +EI ENL    F+  + +      ++    F++I+    + F +    G +      D E    + L ++  ++    + SS + I ++ILD NDN P         + + + +   S  +GS ++K  V+++    +   V  DAD G N  V + + D    N     F ID   G+I++ R +  +    Y   +   D GK  L +
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRE--------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA-TVNQSIFQVHAIDSDSGE-NGRITYSIKSGKGKNKFRIDSQRG-HIHIAKPLD--SDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDND-QLWYNI---SNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDED-------------KKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII-VNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPL-SSQIPVHIIVTMSENDPPK--FPTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPY------FVQNEYVGALPESAAIGSYVLK--VHDSSKDHLTLQVK-DADVGVNGMVEYHIVDDLAKN----FFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHS 1912          

HSP 5 Score: 139.813 bits (351), Expect = 9.837e-33
Identity = 164/682 (24.05%), Postives = 296/682 (43.40%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVR--DVNNHPPSYNLNPASLTLEENQ-PPNILVG------QINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            E Q    + V I I + + N+P F   S + KI E           P         +     +K + A+D     IS  ++  L L + +D E +  + L ++A  +      +Y ++ I++ D ND  P F    +   + EN++    ++K+ ATD D   +  + Y + S T +I +  F +   +G + L+ +LD E +  Y   V A D G    ++K+ + ++  D N++ P + L    L++ EN  P  +L+        I  +++D   V+GD + Q  +GKS                    ++F    LDRE+     + +I  DG    + T+ + + + V D+NDN P    P Y     E+ +IG  +++V A D D +  +++++ +     + FSI   SG +     LDRE    Y+L +  +           + + I V D NDN+P   + + ++ + E+ +    I  + + DKDFG N +  +SL+     DYF + K  G +    + DRE    + L ++  D GVP    S   + VNILD NDN P  S+                +    +I++ + +   G ++    A   D G NA + + +    +  +    F +D   G + ++  +  ++   Y + I A D G   L
Sbjct: 2740 EPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIE---------STPPGTVLTKLHMIGNYTFKFSIAADQDHFMIS--DSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENI-QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG-------------------ELFIAKPLDREQLMFYNLSIIATDG----KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ--SKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKL-VAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENH-DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEFSM----------------RQYSCKILENATH---GTEVCKVYATSIDIGVNADIHYFIMSGNEQGK----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL 3358          

HSP 6 Score: 132.88 bits (333), Expect = 1.177e-30
Identity = 172/661 (26.02%), Postives = 290/661 (43.87%), Query Frame = 1
Query:  667 PMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETK------NFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYA---TDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDK--DFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            P F +K + K +        +TI   KA D D+ +  S     + K++D    +  KD       T DI +++K      N Y+  + A + G  +  S + + IEII+ +   P F+K    L + E+T  G ++ KL            Y    S  + +++ F + ++GE+IL +TLD E ++++ + V A   T   F + + + I VRD N++ P ++    S ++ EN    I + +++  D D    NGDIR        N+Q++ F  D     +T+         LDRE        +I  D G H +  +   +T++++D NDN PVF +P     + EN   G  ++ ++  D  D E  ++ + I+ G     F I   SG +   + LDRE+ + Y L+I+A +      F A   V I+V D NDN P    P+  +   E++     IG  + E K  DF    K  F L      D+   K +G L      DRE   +Y L   V D G   ++     I + + D NDN P+ S+      Q ++    ++Q L + I K               A D D G N Q+ +++       +    F I +  G I++ + + R+ I  + + + A D G   L +
Sbjct: 2652 PYFLLKEY-KMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSND----KAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGN-------YTFKFSI-AADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGP-NGDIRYYLESDTENIQNI-FDIDIYSGWITL------LTSLDREVQSEYNFKVIAADNG-HPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDP-DIEKQEMDFFIVSGDKQAQFQIG-KSGELFIAKPLDREQLMFYNLSIIATDGK----FTAKANVEIDVKDINDNTPYCLKPRYHISTNESIS----IGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQD-GKDFTQECFSEIIITVNDINDNMPIFSM-----AQYRVSVPEDAQ-LNTLITKVH-------------AMDKDFGVNRQIKYSL-----MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHS 3255          

HSP 7 Score: 130.568 bits (327), Expect = 5.762e-30
Identity = 161/677 (23.78%), Postives = 294/677 (43.43%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMND--CEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK---DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNS---KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVD---ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSL--KALFNATTTVNIEVTDENDNVPEIYLPKK---LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            V +++ D NDN P+F ++ ++ K++E L   G  + + +A+D+D+   N+ + + L + +   EL     +T  +R    +DYE K  + L + A + G   L S + I I IID+N+    P F   ++E  + EN   G  ++ + A D D    +SK+ Y +   T       FAV + G +  +  LD E +  Y + + A D      S   ++ I V + N++ P  +     + + E    N+ +  +   D D      +  +I     +G   +     V    E             +LDRE      + +   D G    L+STS I + VLD+NDN P F    YK Q+  +  +   + QV A D D  EN +I YSI  G   N F I+   G I   + LD + +  +++ I A +  +  K+       V + V   + N P I        +++ EN KP   +  I++ D D   N +  +++ N  + + F + + NG++      D E +  Y L I V D     + ++   + V ++D NDN P  +          +   N S+N+  E +   ++               D+ E+ ++ + +    D + +A LF ID  +G++ +++ +  +    + + +   D+G    R
Sbjct:  966 VYVLVDDVNDNAPVFGVQEYIFKVREDL-PRGTVLAVIEAVDEDIGP-NAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSI---TGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTER------------KLDRENQAEHILEVAISDNG-SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFA--------KDVYHVNISENIEEESVIMQLHA-------------TDRDEDKKLFYHLHATQDPSSLA-LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKR 1593          

HSP 8 Score: 119.013 bits (297), Expect = 2.322e-26
Identity = 126/460 (27.39%), Postives = 220/460 (47.83%), Query Frame = 1
Query:  955 IKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEF-------TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKS-LKALFNATTTVNIEVTDENDNVPEIY--LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSK----ETDYFDLKRNGSLFSKITFDRE-LKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            I I+++D ND  P+F    + +V+ E+T   + I+K+ A D D   + ++ Y ++     ++ E FA+   TGE+ L++ L       +E+ V A D G +        S +K+ I V+ VN + P       S     + P  ++ G + V D D + +NG+I   E +  +   D  F+   AE       ++     L+++      + L+  D G   R    SV  +Q+   + N P+F+   Y+  I E   I   V+++   D D  +NA +   I+ G   + F INP+SG +   ++LD E+K +Y L + AI+++ + +   ++  V I V D NDN P I+  + K + I EN     F+  + ++D+D G N    +S+ N      E D+F    +G + +    D E +K  Y L IR +D G+P  R +   + + + D NDN P
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL-----MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNP--LIYGIVRVNDKD-TGINGNIGRLEIVDGN--PDGTFLLKAAETKDEYYIELNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSV-PIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDP-IFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHF----SGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRP 611          

HSP 9 Score: 116.316 bits (290), Expect = 1.474e-25
Identity = 163/681 (23.94%), Postives = 290/681 (42.58%), Query Frame = 1
Query:  607 NQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKI-GKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG--EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP------KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            N  R V ++ I + D NDN P+F    +   +  I    G  I   KAID D  E N  V Y+L K +   EL      +  L + + ++   +N YELT+ A++       S   +++++ID +   PVF+K  + + + E+ ++   L + +EA +      L+Y + S + S   +      TG + ++  LD E   ++++ + ATD      +   + + + DVN+  P    +  +LT+ EN      + +IN  D D S  N  +    E +   N  +L ++            +++ +  LD E+     I +   D G    L+S S + + V D+NDN P F  P Y  ++      G  V    A+DKD  +   ++Y I+ G     +SI+  +G I+    L+  +K +    +L I+ S   +  A   + I +  EN     +Y P       + ++ ENL     I  + + D DFG      + +++ +    F + +  G + SK+TFDRE KDEY + ++V+D G     +S K           +      +  LKE                ++  +V  N    I T  A D D  +N  V F +   ++   +  +  I+E  G I          +  Y+  + A D+G+    +E
Sbjct: 2118 NVRRAVTSIDISVLDVNDNCPLFVNMPYYATVS-IDDPKGTIIMQVKAIDLDSAE-NGEVRYELKKGNG--ELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVIDRS--MPVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTISSESQSFEID----YNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDND-SGANAKLSYYIESINGQNNSELFYID-------VTDGNLYLKTPLDYEQIKYHHIVVNVKDHG-SPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSS---TVLNISVS-DGVHTAYARLKISLLPEN-----VYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLK-------VIVVDVNDNVPYFLLKEYKM-------------VVSTTVEANQ--TILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSE 2746          

HSP 10 Score: 113.235 bits (282), Expect = 1.345e-24
Identity = 169/741 (22.81%), Postives = 319/741 (43.05%), Query Frame = 1
Query:  469 NEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVV---NVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEI---------LYGVGKTIELPKAIDKDVTEINSRVLYKL--NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY--LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDV---EFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYL----ICHDGGLHERLTSTSVITLQVLDVNDNPPVF-SIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGF--KIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            NE F ++  + V+     ID E           +   NL V   N+  E+  + +I   I I D NDN+P F    +V  + E          ++   K     +  D DV  +N  V Y +  + A + F++      T  + L + +DYET   Y   +   + G  +L S     + I +I++NDC PVF +    + L   T     + ++ A D D D+ L + +V    +   E F +++   +I  +  ++   E  + Y + V A+DG F++   ++I V    +   ++       +  EN      +G +NV   +  D N + R   P   + L D+       +          + V  DRE      +++    + +DG       + + I + VLDVNDN P+F ++P+Y A +  ++  G  ++QV A D D  EN +++Y + +G    F ++  SG ++  + ++   + NY+L + A + ++    ++   + ++V D +  V E      + + E+++ Y  +   I  +   G +   ++++  S E+  F++  N GS+F     D E    + ++IR  D    +       + V+I+D ND  P I                      S+I   ++ EN  F  +I    A D D G NA++++ +E I   N  + LF ID  +G++ +   +  + I  + + +   D G  SL +
Sbjct: 1757 NESFRINPSTGVIVINGNIDYE----------SIKVFNLTVKGTNMAAESSCQNII---IHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVG-VNGMVEYHIVDDLAKNFFKID---STTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDT-LRFDIVDGNTN---ECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIG-NTLDENVEYRILNP---TQLFDIGISSGALKT---------TGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYY-ATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHNR-NYELTVAAYDGAITPC-SSEAPLQVKVIDRSMPVFEKQF-YTVSVKEDVEMYSALSVSIEAESPLGRS--LIYTI--SSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV--LSVSIMDVNDCYPEIE---------------------SDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNN-SELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSS 2431          

HSP 11 Score: 92.4337 bits (228), Expect = 2.283e-18
Identity = 111/486 (22.84%), Postives = 215/486 (44.24%), Query Frame = 1
Query:  448 YFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKEN--QLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKE-ILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINR----ETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVD----ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP------TNFFSINPNSGWITAIRRLD 1842
            Y    + ++YF + + + +++  K +D E           +   NL V        +L  +  V + I D NDN P F M+ +  KI E   +G         +ID  V   N+ + Y +   ++  + ++    T  L L   +DYE   FY LT+ A + G   L +   + I I+D+ND  P F + L+ + ++E+  +G  I+ ++ATD+D D   V G+V  T +I R      F++  + G + + + LD E    Y + + A D    +  ++  I I + D N++ P ++ +  S+ L+EN+    +     + D D     +    DIR     G   L+    +   + +   ++ +   +V++     P                L S + + +++++ +  PP+ +         E++  G  + +V A D+D  +  ++ +S++ GP      +  F+I+ N+G I AI  LD
Sbjct: 3206 YSLMGENHDYFKISKSTGIIRLHKSLDRET----------ISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGV---NADIHYFIMSGNEQGKFKMDS-TTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSD---VNGLV--TYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPP---------------LYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYD--ELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD 3655          

HSP 12 Score: 90.5077 bits (223), Expect = 1.023e-17
Identity = 131/572 (22.90%), Postives = 238/572 (41.61%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKI-RIFVRDVNNHPPSYNL-------NPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN--FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISE----DKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELK----DEYCLNIRVNDLGVPISRSSTKPICVNILDDND 2265
            L   + V I + ++NDN+P+     +   + E      + I L KA D D+    + + Y +   +     +I           + +D E +  + L +   +NG   L S   I + ++D+ND  P F + ++++ +  +  + + I ++ A D D  ++ ++ Y + S      +  F +  + G + + K LD +    +EI + A D      S+  R+ +  V  +P S N        +   + L EN  P  LV QI   D D   +  +I         N  +  ++       L  KY       LD E   +  + +   DG      T+ + + +QV+D+NDNPP F+   Y   I EN      ++Q+ A D+D+ +         + P++   F I+  SG +   +RLD E+   + L +   ++      N    + + V D ND+ PE     K+ I   +     IG+ ++E    D+D G+N +  +S+I       F++      F  IT    L      EY L ++  DLG P   S      +  + +ND
Sbjct: 1173 LSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITL-KAFDPDIDPTQT-ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGK---GKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNI------SNGNDDNTFYIGQDNGNILLSKY-------LDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII-VNVHDHNDHHPE--FTAKI-IQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEID---PTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSEND 1713          

HSP 13 Score: 83.9593 bits (206), Expect = 1.071e-15
Identity = 115/469 (24.52%), Postives = 193/469 (41.15%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIA-----WNNGHDELKSYLEIKIEIIDMNDCEP-VFKKGLFEL-------------VLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNS--INRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHD-GGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREE-KINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPE 1965
            N+ I + D+ND  P+F    +   I E        +++  A D D+  IN  + Y L   S+ F +  +   T  + L + + Y   + +ELT++A     W N  +   S  ++ I +  +N   P +F K    +             V D++T I   I +LE  D + D   +     + +   I    FA       I   TL  E   T     Y +         + I ++  + + P +      +++ E  P N+ V ++ V D D       +   E +G +   + +  PD           +++  QLD E+  + T+ +   D   +  R  S++ + + V D+NDN P+F        I ENN  G  V+++ A D+D  EN+ I YSI       F I+  SG +     LD E  K NY+L I A +  L         ++I V D NDN P+
Sbjct:  168 NIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKV-TADDADLG-INGEIYYSLLMDSEYFAIHPT---TGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKS---------VPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLG--KNALVYLEIVGGNEGDEFRINPDSGM--------LYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ 612          

HSP 14 Score: 81.6481 bits (200), Expect = 4.300e-15
Identity = 70/230 (30.43%), Postives = 114/230 (49.57%), Query Frame = 1
Query: 1945 ENDNVPE-IYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITF-DRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV----ADDADKGENAQVTFTME-DITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +N + PE +  P++L I E+++  + +  I ++D+D G NGK VF++ +      F +  +      I + DRE ++EY LNI V DLG P ++S++K + + ILD NDN PVI    TL      ES                      +I T V    A DAD G NAQVT+ +  + +D       F ++   G +++++ + R+   +Y + I A D G   L +E
Sbjct:  765 QNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNP-TKSTSKMLPITILDVNDNRPVI--QKTLATFRLTESA---------------------RIGTVVHCLHATDADSGINAQVTYALSVECSD-------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE 963          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 192.971 bits (489), Expect = 4.601e-49
Identity = 188/662 (28.40%), Postives = 303/662 (45.77%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPK--AIDKDVTEINSRVLYKLNKASDTFELQISKD---NTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +V I + D+NDN P F    +   + E      K I L K  A D D T  N  + Y L   SDT  +Q   D    +  + L   +D E ++ Y   +IA +NGH +  + + + I+I+D ND  PVFK  +  L + EN   G ++I L   D D + + +   + S +   +  F + ++GE+ + K LD E    Y + + ATDG+FT+ + + I V+D+N++ P Y L P    +  N+  +I    + VK +D  D    +R    L      D     +     +           LDRE  P   +     DG    +   + +I + V D+NDN P+FS+  Y+  + E+  +   + +V A DKD   N QIKYS++    ++F I+ ++G I   + LDRE    + L + A +  +  L ++  TV + + D NDN PE  + +   +I+EN      +  + +   D G N    + +++  E   F +    G L    T D E+   Y L I+  D G P   S+   + ++ILD NDN+P                    QNL    +   ++   G KI    A D D   N  VT+ +E   +  Q    F ID  NG+I +SR + R+ I  Y ++I ACD+G
Sbjct: 2845 DVLIDVRDENDNYPKFDNTFYSASVAE---NSEKVISLVKVSATDAD-TGPNGDIRYYLE--SDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDK--QAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP-YCLKP-RYHISTNESISIGTTLVEVKAIDF-DFQSKLRFY--LSGKGADDFSIGKESGILKVASA--------LDRETTPKYKLVAHVQDGKDFTQECFSEII-ITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKL-HSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTP-PLSNNAYVNISILDINDNSPTF-----------------LQNLYRINVNEDIF--VGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ----FSIDPKNGTISVSRPLDRETISHYTLEIQACDQG 3459          

HSP 2 Score: 165.236 bits (417), Expect = 1.726e-40
Identity = 171/624 (27.40%), Postives = 290/624 (46.47%), Query Frame = 1
Query:  445 FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLN-KASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIM--EN-LKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVIS 2283
            F+    DK   F + + S  L  AK +D E L           F NL + +  + +     NV+I + D NDN P      +     E +  +G T+   KAID D     S++ + L+ K +D F   I K+ +  L++   +D ET   Y+L     +      + + EI I + D+ND  P+F    + + + E+ ++  LI K+ A DKD   + ++ Y ++      N + F + K TG + L K+LD E    + + V A D    +  S + + + + D+N++PP +++   S  + EN      V ++    +D   VN DI        S  +  KF  D      +   D+     LD E +    + +   DGG    L++ + + + +LD+NDN P F    Y+  + E+  +G K+L V A D+D   N  + Y+I  G     FSI+P +G I+  R LDRE   +Y L I A ++      N+   +NI + D NDN P I+      ++  EN L  Y F+   IS+  +  N     F + +  E   F L+++GSL +   F+  L+DE+ + +RV D G P    S   + V I++++   P+++
Sbjct: 3003 FFIVSGDKQAQFQIGK-SGELFIAKPLDREQLM----------FYNLSI-IATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESI-SIGTTLVEVKAIDFD---FQSKLRFYLSGKGADDF--SIGKE-SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE----NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIG-VNADIHY---FIMSGNEQGKFKMD------STTGDLVLNATLDYEMSKFYFLTIQAIDGGT-PPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVP-ININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIEESQYPPIVT 3589          

HSP 3 Score: 157.918 bits (398), Expect = 2.988e-38
Identity = 174/643 (27.06%), Postives = 301/643 (46.81%), Query Frame = 1
Query:  721 VGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ--LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDN--PPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKE-NAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP----EIYLPKKLEI-MENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLF--SKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +G+T+   +A D+D+   N ++++ ++        +I  D    L++   +D E +N Y L +  ++ G+    +   + I I+D+ND  PV +K L    L E+ +IG ++  L ATD D   ++++ Y +     S+    F V   TG + L K LD E +  Y + + A DG     +S + + + V DVN++ P + +      + E+ P   ++  I   D    D+  +   Q  L +    +  F  D        K+    R Q  LD E      + +   DGG    LTS   I + ++DVN+N   P F    Y+ ++KEN   G  V+ V A D D  + N++I YSI  G     F++N + G IT++ +LD E K  Y L + A + ++  L N    V I+V +ENDN+P     +Y     E  +EN++    I  + + D D        +++++     YF++     +   ++   DRE + E+ L + ++D G P+  SST  I V++LD NDN+P         E DQ   K   Q   S  +  S+++          A D+D GEN ++T++++     N+    F ID   G I I++ +  D   ++++ I A D G
Sbjct:  787 LGETVAWIEAKDRDLG-YNGKLVFAISDGDYDSVFRIDPDRG-ELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL-----SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVD---EDIGPNAEIQFSLKEETQDEELFRID--------KHTGAIRTQGYLDYENKQVHNLIVSAIDGG-DPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNC-VEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE----IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPV-LSSTSRIVVSVLDINDNSP---------EFDQRVYK--VQVPSSATVNQSIFQ--------VHAIDSDSGENGRITYSIKSGKGKNK----FRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNG 1378          

HSP 4 Score: 142.895 bits (359), Expect = 1.082e-33
Identity = 173/728 (23.76%), Postives = 322/728 (44.23%), Query Frame = 1
Query:  475 YFTLDRQSSVLKTA-KKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNG---HDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLD--ENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPL----TVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK---KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            YF +D ++ V+KT  +K+D E        +     L + ++      L     + + + D NDN P F  + +  ++      V ++I    AID D  E N R+ Y +       + +I       + + K +D  + N +E+ + A +NG     +      + + +   +   P+  +   E V+D  EN K G L+ ++ A D D D +L Y +   +N  +  TF + ++ G ++L K LD E +Q+Y + +  TDG FT+ + + + V D+N++PP +  +   + + EN     ++ Q++  D D               K     L    DP+   L    ++  ++    +LD E+     + +   D G   +     +I + V D ND+ P F+    ++++ E+  IG K+ +V A D+D   NA+I+YSI+ G   + F I+P  G IT    L+  +   Y L + A++     L ++   V+I VT   ++ P+   P     +EI ENL    F+  + +      ++    F++I+    + F +    G +      D E    + L ++  ++    + SS + I ++ILD NDN P         + + + +   S  +GS ++K  V+++    +   V  DAD G N  V + + D    N     F ID   G+I++ R +  +    Y   +   D GK  L +
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRE--------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA-TVNQSIFQVHAIDSDSGE-NGRITYSIKSGKGKNKFRIDSQRG-HIHIAKPLD--SDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDND-QLWYNI---SNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDED-------------KKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII-VNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPL-SSQIPVHIIVTMSENDPPK--FPTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPY------FVQNEYVGALPESAAIGSYVLK--VHDSSKDHLTLQVK-DADVGVNGMVEYHIVDDLAKN----FFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHS 1912          

HSP 5 Score: 139.813 bits (351), Expect = 9.348e-33
Identity = 164/682 (24.05%), Postives = 296/682 (43.40%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVR--DVNNHPPSYNLNPASLTLEENQ-PPNILVG------QINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            E Q    + V I I + + N+P F   S + KI E           P         +     +K + A+D     IS  ++  L L + +D E +  + L ++A  +      +Y ++ I++ D ND  P F    +   + EN++    ++K+ ATD D   +  + Y + S T +I +  F +   +G + L+ +LD E +  Y   V A D G    ++K+ + ++  D N++ P + L    L++ EN  P  +L+        I  +++D   V+GD + Q  +GKS                    ++F    LDRE+     + +I  DG    + T+ + + + V D+NDN P    P Y     E+ +IG  +++V A D D +  +++++ +     + FSI   SG +     LDRE    Y+L +  +           + + I V D NDN+P   + + ++ + E+ +    I  + + DKDFG N +  +SL+     DYF + K  G +    + DRE    + L ++  D GVP    S   + VNILD NDN P  S+                +    +I++ + +   G ++    A   D G NA + + +    +  +    F +D   G + ++  +  ++   Y + I A D G   L
Sbjct: 2740 EPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIE---------STPPGTVLTKLHMIGNYTFKFSIAADQDHFMIS--DSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENI-QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG-------------------ELFIAKPLDREQLMFYNLSIIATDG----KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ--SKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKL-VAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENH-DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEFSM----------------RQYSCKILENATH---GTEVCKVYATSIDIGVNADIHYFIMSGNEQGK----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL 3358          

HSP 6 Score: 132.88 bits (333), Expect = 1.128e-30
Identity = 172/661 (26.02%), Postives = 290/661 (43.87%), Query Frame = 1
Query:  667 PMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETK------NFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYA---TDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDK--DFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            P F +K + K +        +TI   KA D D+ +  S     + K++D    +  KD       T DI +++K      N Y+  + A + G  +  S + + IEII+ +   P F+K    L + E+T  G ++ KL            Y    S  + +++ F + ++GE+IL +TLD E ++++ + V A   T   F + + + I VRD N++ P ++    S ++ EN    I + +++  D D    NGDIR        N+Q++ F  D     +T+         LDRE        +I  D G H +  +   +T++++D NDN PVF +P     + EN   G  ++ ++  D  D E  ++ + I+ G     F I   SG +   + LDRE+ + Y L+I+A +      F A   V I+V D NDN P    P+  +   E++     IG  + E K  DF    K  F L      D+   K +G L      DRE   +Y L   V D G   ++     I + + D NDN P+ S+      Q ++    ++Q L + I K               A D D G N Q+ +++       +    F I +  G I++ + + R+ I  + + + A D G   L +
Sbjct: 2652 PYFLLKEY-KMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSND----KAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGN-------YTFKFSI-AADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGP-NGDIRYYLESDTENIQNI-FDIDIYSGWITL------LTSLDREVQSEYNFKVIAADNG-HPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDP-DIEKQEMDFFIVSGDKQAQFQIG-KSGELFIAKPLDREQLMFYNLSIIATDGK----FTAKANVEIDVKDINDNTPYCLKPRYHISTNESIS----IGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQD-GKDFTQECFSEIIITVNDINDNMPIFSM-----AQYRVSVPEDAQ-LNTLITKVH-------------AMDKDFGVNRQIKYSL-----MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHS 3255          

HSP 7 Score: 130.568 bits (327), Expect = 5.859e-30
Identity = 161/677 (23.78%), Postives = 294/677 (43.43%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMND--CEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK---DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNS---KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVD---ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSL--KALFNATTTVNIEVTDENDNVPEIYLPKK---LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            V +++ D NDN P+F ++ ++ K++E L   G  + + +A+D+D+   N+ + + L + +   EL     +T  +R    +DYE K  + L + A + G   L S + I I IID+N+    P F   ++E  + EN   G  ++ + A D D    +SK+ Y +   T       FAV + G +  +  LD E +  Y + + A D      S   ++ I V + N++ P  +     + + E    N+ +  +   D D      +  +I     +G   +     V    E             +LDRE      + +   D G    L+STS I + VLD+NDN P F    YK Q+  +  +   + QV A D D  EN +I YSI  G   N F I+   G I   + LD + +  +++ I A +  +  K+       V + V   + N P I        +++ EN KP   +  I++ D D   N +  +++ N  + + F + + NG++      D E +  Y L I V D     + ++   + V ++D NDN P  +          +   N S+N+  E +   ++               D+ E+ ++ + +    D + +A LF ID  +G++ +++ +  +    + + +   D+G    R
Sbjct:  966 VYVLVDDVNDNAPVFGVQEYIFKVREDL-PRGTVLAVIEAVDEDIGP-NAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSI---TGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTER------------KLDRENQAEHILEVAISDNG-SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFA--------KDVYHVNISENIEEESVIMQLHA-------------TDRDEDKKLFYHLHATQDPSSLA-LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKR 1593          

HSP 8 Score: 119.013 bits (297), Expect = 2.263e-26
Identity = 126/460 (27.39%), Postives = 220/460 (47.83%), Query Frame = 1
Query:  955 IKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEF-------TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKS-LKALFNATTTVNIEVTDENDNVPEIY--LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSK----ETDYFDLKRNGSLFSKITFDRE-LKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            I I+++D ND  P+F    + +V+ E+T   + I+K+ A D D   + ++ Y ++     ++ E FA+   TGE+ L++ L       +E+ V A D G +        S +K+ I V+ VN + P       S     + P  ++ G + V D D + +NG+I   E +  +   D  F+   AE       ++     L+++      + L+  D G   R    SV  +Q+   + N P+F+   Y+  I E   I   V+++   D D  +NA +   I+ G   + F INP+SG +   ++LD E+K +Y L + AI+++ + +   ++  V I V D NDN P I+  + K + I EN     F+  + ++D+D G N    +S+ N      E D+F    +G + +    D E +K  Y L IR +D G+P  R +   + + + D NDN P
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL-----MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNP--LIYGIVRVNDKD-TGINGNIGRLEIVDGN--PDGTFLLKAAETKDEYYIELNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSV-PIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDP-IFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHF----SGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRP 611          

HSP 9 Score: 116.316 bits (290), Expect = 1.332e-25
Identity = 163/681 (23.94%), Postives = 290/681 (42.58%), Query Frame = 1
Query:  607 NQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKI-GKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG--EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP------KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            N  R V ++ I + D NDN P+F    +   +  I    G  I   KAID D  E N  V Y+L K +   EL      +  L + + ++   +N YELT+ A++       S   +++++ID +   PVF+K  + + + E+ ++   L + +EA +      L+Y + S + S   +      TG + ++  LD E   ++++ + ATD      +   + + + DVN+  P    +  +LT+ EN      + +IN  D D S  N  +    E +   N  +L ++            +++ +  LD E+     I +   D G    L+S S + + V D+NDN P F  P Y  ++      G  V    A+DKD  +   ++Y I+ G     +SI+  +G I+    L+  +K +    +L I+ S   +  A   + I +  EN     +Y P       + ++ ENL     I  + + D DFG      + +++ +    F + +  G + SK+TFDRE KDEY + ++V+D G     +S K           +      +  LKE                ++  +V  N    I T  A D D  +N  V F +   ++   +  +  I+E  G I          +  Y+  + A D+G+    +E
Sbjct: 2118 NVRRAVTSIDISVLDVNDNCPLFVNMPYYATVS-IDDPKGTIIMQVKAIDLDSAE-NGEVRYELKKGNG--ELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVIDRS--MPVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTISSESQSFEID----YNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDND-SGANAKLSYYIESINGQNNSELFYID-------VTDGNLYLKTPLDYEQIKYHHIVVNVKDHG-SPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSS---TVLNISVS-DGVHTAYARLKISLLPEN-----VYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLK-------VIVVDVNDNVPYFLLKEYKM-------------VVSTTVEANQ--TILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSE 2746          

HSP 10 Score: 112.849 bits (281), Expect = 1.415e-24
Identity = 180/792 (22.73%), Postives = 339/792 (42.80%), Query Frame = 1
Query:  343 TIQENHPSGIQVGFISSDITQIPNIDLPKFL-------DSSFYFTF--RDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVV---NVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEI---------LYGVGKTIELPKAIDKDVTEINSRVLYKL--NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY--LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDV---EFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYL----ICHDGGLHERLTSTSVITLQVLDVNDNPPVF-SIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGF--KIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            T+ EN P       I+ +I +  N+ +  F+        SS +F     + NE F ++  + V+     ID E           +   NL V   N+  E+  + +I   I I D NDN+P F    +V  + E          ++   K     +  D DV  +N  V Y +  + A + F++      T  + L + +DYET   Y   +   + G  +L S     + I +I++NDC PVF +    + L   T     + ++ A D D D+ L + +V    +   E F +++   +I  +  ++   E  + Y + V A+DG F++   ++I V    +   ++       +  EN      +G +NV   +  D N + R   P   + L D+       +          + V  DRE      +++    + +DG       + + I + VLDVNDN P+F ++P+Y A +  ++  G  ++QV A D D  EN +++Y + +G    F ++  SG ++  + ++   + NY+L + A + ++    ++   + ++V D +  V E      + + E+++ Y  +   I  +   G +   ++++  S E+  F++  N GS+F     D E    + ++IR  D    +       + V+I+D ND  P I                      S+I   ++ EN  F  +I    A D D G NA++++ +E I   N  + LF ID  +G++ +   +  + I  + + +   D G  SL +
Sbjct: 1708 TMSENDPPKFPTNNIAIEIFE--NLPIGTFVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYE----------SIKVFNLTVKGTNMAAESSCQNII---IHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVG-VNGMVEYHIVDDLAKNFFKID---STTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDT-LRFDIVDGNTN---ECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIG-NTLDENVEYRILNP---TQLFDIGISSGALKT---------TGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYY-ATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHNR-NYELTVAAYDGAITPC-SSEAPLQVKVIDRSMPVFEKQF-YTVSVKEDVEMYSALSVSIEAESPLGRS--LIYTI--SSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV--LSVSIMDVNDCYPEIE---------------------SDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNN-SELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSS 2431          

HSP 11 Score: 92.8189 bits (229), Expect = 2.244e-18
Identity = 111/486 (22.84%), Postives = 215/486 (44.24%), Query Frame = 1
Query:  448 YFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKEN--QLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKE-ILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINR----ETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVD----ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP------TNFFSINPNSGWITAIRRLD 1842
            Y    + ++YF + + + +++  K +D E           +   NL V        +L  +  V + I D NDN P F M+ +  KI E   +G         +ID  V   N+ + Y +   ++  + ++    T  L L   +DYE   FY LT+ A + G   L +   + I I+D+ND  P F + L+ + ++E+  +G  I+ ++ATD+D D   V G+V  T +I R      F++  + G + + + LD E    Y + + A D    +  ++  I I + D N++ P ++ +  S+ L+EN+    +     + D D     +    DIR     G   L+    +   + +   ++ +   +V++     P                L S + + +++++ +  PP+ +         E++  G  + +V A D+D  +  ++ +S++ GP      +  F+I+ N+G I AI  LD
Sbjct: 3206 YSLMGENHDYFKISKSTGIIRLHKSLDRET----------ISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGV---NADIHYFIMSGNEQGKFKMDS-TTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSD---VNGLV--TYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPP---------------LYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYD--ELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD 3655          

HSP 12 Score: 90.5077 bits (223), Expect = 1.023e-17
Identity = 131/572 (22.90%), Postives = 238/572 (41.61%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKI-RIFVRDVNNHPPSYNL-------NPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN--FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISE----DKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELK----DEYCLNIRVNDLGVPISRSSTKPICVNILDDND 2265
            L   + V I + ++NDN+P+     +   + E      + I L KA D D+    + + Y +   +     +I           + +D E +  + L +   +NG   L S   I + ++D+ND  P F + ++++ +  +  + + I ++ A D D  ++ ++ Y + S      +  F +  + G + + K LD +    +EI + A D      S+  R+ +  V  +P S N        +   + L EN  P  LV QI   D D   +  +I         N  +  ++       L  KY       LD E   +  + +   DG      T+ + + +QV+D+NDNPP F+   Y   I EN      ++Q+ A D+D+ +         + P++   F I+  SG +   +RLD E+   + L +   ++      N    + + V D ND+ PE     K+ I   +     IG+ ++E    D+D G+N +  +S+I       F++      F  IT    L      EY L ++  DLG P   S      +  + +ND
Sbjct: 1173 LSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITL-KAFDPDIDPTQT-ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGK---GKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNI------SNGNDDNTFYIGQDNGNILLSKY-------LDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII-VNVHDHNDHHPE--FTAKI-IQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEID---PTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSEND 1713          

HSP 13 Score: 83.9593 bits (206), Expect = 1.098e-15
Identity = 115/469 (24.52%), Postives = 193/469 (41.15%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIA-----WNNGHDELKSYLEIKIEIIDMNDCEP-VFKKGLFEL-------------VLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNS--INRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHD-GGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREE-KINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPE 1965
            N+ I + D+ND  P+F    +   I E        +++  A D D+  IN  + Y L   S+ F +  +   T  + L + + Y   + +ELT++A     W N  +   S  ++ I +  +N   P +F K    +             V D++T I   I +LE  D + D   +     + +   I    FA       I   TL  E   T     Y +         + I ++  + + P +      +++ E  P N+ V ++ V D D       +   E +G +   + +  PD           +++  QLD E+  + T+ +   D   +  R  S++ + + V D+NDN P+F        I ENN  G  V+++ A D+D  EN+ I YSI       F I+  SG +     LD E  K NY+L I A +  L         ++I V D NDN P+
Sbjct:  168 NIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKV-TADDADLG-INGEIYYSLLMDSEYFAIHPT---TGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKS---------VPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLG--KNALVYLEIVGGNEGDEFRINPDSGM--------LYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ 612          

HSP 14 Score: 81.6481 bits (200), Expect = 4.300e-15
Identity = 70/230 (30.43%), Postives = 114/230 (49.57%), Query Frame = 1
Query: 1945 ENDNVPE-IYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITF-DRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV----ADDADKGENAQVTFTME-DITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +N + PE +  P++L I E+++  + +  I ++D+D G NGK VF++ +      F +  +      I + DRE ++EY LNI V DLG P ++S++K + + ILD NDN PVI    TL      ES                      +I T V    A DAD G NAQVT+ +  + +D       F ++   G +++++ + R+   +Y + I A D G   L +E
Sbjct:  765 QNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNP-TKSTSKMLPITILDVNDNRPVI--QKTLATFRLTESA---------------------RIGTVVHCLHATDADSGINAQVTYALSVECSD-------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE 963          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 192.971 bits (489), Expect = 4.601e-49
Identity = 188/662 (28.40%), Postives = 303/662 (45.77%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPK--AIDKDVTEINSRVLYKLNKASDTFELQISKD---NTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +V I + D+NDN P F    +   + E      K I L K  A D D T  N  + Y L   SDT  +Q   D    +  + L   +D E ++ Y   +IA +NGH +  + + + I+I+D ND  PVFK  +  L + EN   G ++I L   D D + + +   + S +   +  F + ++GE+ + K LD E    Y + + ATDG+FT+ + + I V+D+N++ P Y L P    +  N+  +I    + VK +D  D    +R    L      D     +     +           LDRE  P   +     DG    +   + +I + V D+NDN P+FS+  Y+  + E+  +   + +V A DKD   N QIKYS++    ++F I+ ++G I   + LDRE    + L + A +  +  L ++  TV + + D NDN PE  + +   +I+EN      +  + +   D G N    + +++  E   F +    G L    T D E+   Y L I+  D G P   S+   + ++ILD NDN+P                    QNL    +   ++   G KI    A D D   N  VT+ +E   +  Q    F ID  NG+I +SR + R+ I  Y ++I ACD+G
Sbjct: 2845 DVLIDVRDENDNYPKFDNTFYSASVAE---NSEKVISLVKVSATDAD-TGPNGDIRYYLE--SDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDK--QAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP-YCLKP-RYHISTNESISIGTTLVEVKAIDF-DFQSKLRFY--LSGKGADDFSIGKESGILKVASA--------LDRETTPKYKLVAHVQDGKDFTQECFSEII-ITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKL-HSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTP-PLSNNAYVNISILDINDNSPTF-----------------LQNLYRINVNEDIF--VGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ----FSIDPKNGTISVSRPLDRETISHYTLEIQACDQG 3459          

HSP 2 Score: 165.236 bits (417), Expect = 1.726e-40
Identity = 171/624 (27.40%), Postives = 290/624 (46.47%), Query Frame = 1
Query:  445 FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLN-KASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIM--EN-LKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVIS 2283
            F+    DK   F + + S  L  AK +D E L           F NL + +  + +     NV+I + D NDN P      +     E +  +G T+   KAID D     S++ + L+ K +D F   I K+ +  L++   +D ET   Y+L     +      + + EI I + D+ND  P+F    + + + E+ ++  LI K+ A DKD   + ++ Y ++      N + F + K TG + L K+LD E    + + V A D    +  S + + + + D+N++PP +++   S  + EN      V ++    +D   VN DI        S  +  KF  D      +   D+     LD E +    + +   DGG    L++ + + + +LD+NDN P F    Y+  + E+  +G K+L V A D+D   N  + Y+I  G     FSI+P +G I+  R LDRE   +Y L I A ++      N+   +NI + D NDN P I+      ++  EN L  Y F+   IS+  +  N     F + +  E   F L+++GSL +   F+  L+DE+ + +RV D G P    S   + V I++++   P+++
Sbjct: 3003 FFIVSGDKQAQFQIGK-SGELFIAKPLDREQLM----------FYNLSI-IATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESI-SIGTTLVEVKAIDFD---FQSKLRFYLSGKGADDF--SIGKE-SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE----NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIG-VNADIHY---FIMSGNEQGKFKMD------STTGDLVLNATLDYEMSKFYFLTIQAIDGGT-PPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVP-ININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTP-PLYSDAWVVVKIIEESQYPPIVT 3589          

HSP 3 Score: 157.918 bits (398), Expect = 2.988e-38
Identity = 174/643 (27.06%), Postives = 301/643 (46.81%), Query Frame = 1
Query:  721 VGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ--LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDN--PPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKE-NAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP----EIYLPKKLEI-MENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLF--SKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +G+T+   +A D+D+   N ++++ ++        +I  D    L++   +D E +N Y L +  ++ G+    +   + I I+D+ND  PV +K L    L E+ +IG ++  L ATD D   ++++ Y +     S+    F V   TG + L K LD E +  Y + + A DG     +S + + + V DVN++ P + +      + E+ P   ++  I   D    D+  +   Q  L +    +  F  D        K+    R Q  LD E      + +   DGG    LTS   I + ++DVN+N   P F    Y+ ++KEN   G  V+ V A D D  + N++I YSI  G     F++N + G IT++ +LD E K  Y L + A + ++  L N    V I+V +ENDN+P     +Y     E  +EN++    I  + + D D        +++++     YF++     +   ++   DRE + E+ L + ++D G P+  SST  I V++LD NDN+P         E DQ   K   Q   S  +  S+++          A D+D GEN ++T++++     N+    F ID   G I I++ +  D   ++++ I A D G
Sbjct:  787 LGETVAWIEAKDRDLG-YNGKLVFAISDGDYDSVFRIDPDRG-ELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL-----SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVD---EDIGPNAEIQFSLKEETQDEELFRID--------KHTGAIRTQGYLDYENKQVHNLIVSAIDGG-DPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNC-VEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE----IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPV-LSSTSRIVVSVLDINDNSP---------EFDQRVYK--VQVPSSATVNQSIFQ--------VHAIDSDSGENGRITYSIKSGKGKNK----FRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNG 1378          

HSP 4 Score: 142.895 bits (359), Expect = 1.082e-33
Identity = 173/728 (23.76%), Postives = 322/728 (44.23%), Query Frame = 1
Query:  475 YFTLDRQSSVLKTA-KKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNG---HDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLD--ENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPL----TVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK---KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            YF +D ++ V+KT  +K+D E        +     L + ++      L     + + + D NDN P F  + +  ++      V ++I    AID D  E N R+ Y +       + +I       + + K +D  + N +E+ + A +NG     +      + + +   +   P+  +   E V+D  EN K G L+ ++ A D D D +L Y +   +N  +  TF + ++ G ++L K LD E +Q+Y + +  TDG FT+ + + + V D+N++PP +  +   + + EN     ++ Q++  D D               K     L    DP+   L    ++  ++    +LD E+     + +   D G   +     +I + V D ND+ P F+    ++++ E+  IG K+ +V A D+D   NA+I+YSI+ G   + F I+P  G IT    L+  +   Y L + A++     L ++   V+I VT   ++ P+   P     +EI ENL    F+  + +      ++    F++I+    + F +    G +      D E    + L ++  ++    + SS + I ++ILD NDN P         + + + +   S  +GS ++K  V+++    +   V  DAD G N  V + + D    N     F ID   G+I++ R +  +    Y   +   D GK  L +
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRE--------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA-TVNQSIFQVHAIDSDSGE-NGRITYSIKSGKGKNKFRIDSQRG-HIHIAKPLD--SDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDND-QLWYNI---SNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDED-------------KKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII-VNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPL-SSQIPVHIIVTMSENDPPK--FPTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPY------FVQNEYVGALPESAAIGSYVLK--VHDSSKDHLTLQVK-DADVGVNGMVEYHIVDDLAKN----FFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHS 1912          

HSP 5 Score: 139.813 bits (351), Expect = 9.348e-33
Identity = 164/682 (24.05%), Postives = 296/682 (43.40%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVR--DVNNHPPSYNLNPASLTLEENQ-PPNILVG------QINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            E Q    + V I I + + N+P F   S + KI E           P         +     +K + A+D     IS  ++  L L + +D E +  + L ++A  +      +Y ++ I++ D ND  P F    +   + EN++    ++K+ ATD D   +  + Y + S T +I +  F +   +G + L+ +LD E +  Y   V A D G    ++K+ + ++  D N++ P + L    L++ EN  P  +L+        I  +++D   V+GD + Q  +GKS                    ++F    LDRE+     + +I  DG    + T+ + + + V D+NDN P    P Y     E+ +IG  +++V A D D +  +++++ +     + FSI   SG +     LDRE    Y+L +  +           + + I V D NDN+P   + + ++ + E+ +    I  + + DKDFG N +  +SL+     DYF + K  G +    + DRE    + L ++  D GVP    S   + VNILD NDN P  S+                +    +I++ + +   G ++    A   D G NA + + +    +  +    F +D   G + ++  +  ++   Y + I A D G   L
Sbjct: 2740 EPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIE---------STPPGTVLTKLHMIGNYTFKFSIAADQDHFMIS--DSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENI-QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG-------------------ELFIAKPLDREQLMFYNLSIIATDG----KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ--SKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKL-VAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENH-DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEFSM----------------RQYSCKILENATH---GTEVCKVYATSIDIGVNADIHYFIMSGNEQGK----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL 3358          

HSP 6 Score: 132.88 bits (333), Expect = 1.128e-30
Identity = 172/661 (26.02%), Postives = 290/661 (43.87%), Query Frame = 1
Query:  667 PMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETK------NFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYA---TDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDK--DFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            P F +K + K +        +TI   KA D D+ +  S     + K++D    +  KD       T DI +++K      N Y+  + A + G  +  S + + IEII+ +   P F+K    L + E+T  G ++ KL            Y    S  + +++ F + ++GE+IL +TLD E ++++ + V A   T   F + + + I VRD N++ P ++    S ++ EN    I + +++  D D    NGDIR        N+Q++ F  D     +T+         LDRE        +I  D G H +  +   +T++++D NDN PVF +P     + EN   G  ++ ++  D  D E  ++ + I+ G     F I   SG +   + LDRE+ + Y L+I+A +      F A   V I+V D NDN P    P+  +   E++     IG  + E K  DF    K  F L      D+   K +G L      DRE   +Y L   V D G   ++     I + + D NDN P+ S+      Q ++    ++Q L + I K               A D D G N Q+ +++       +    F I +  G I++ + + R+ I  + + + A D G   L +
Sbjct: 2652 PYFLLKEY-KMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSND----KAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGN-------YTFKFSI-AADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGP-NGDIRYYLESDTENIQNI-FDIDIYSGWITL------LTSLDREVQSEYNFKVIAADNG-HPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDP-DIEKQEMDFFIVSGDKQAQFQIG-KSGELFIAKPLDREQLMFYNLSIIATDGK----FTAKANVEIDVKDINDNTPYCLKPRYHISTNESIS----IGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQD-GKDFTQECFSEIIITVNDINDNMPIFSM-----AQYRVSVPEDAQ-LNTLITKVH-------------AMDKDFGVNRQIKYSL-----MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHS 3255          

HSP 7 Score: 130.568 bits (327), Expect = 5.859e-30
Identity = 161/677 (23.78%), Postives = 294/677 (43.43%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMND--CEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK---DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNS---KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVD---ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSL--KALFNATTTVNIEVTDENDNVPEIYLPKK---LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            V +++ D NDN P+F ++ ++ K++E L   G  + + +A+D+D+   N+ + + L + +   EL     +T  +R    +DYE K  + L + A + G   L S + I I IID+N+    P F   ++E  + EN   G  ++ + A D D    +SK+ Y +   T       FAV + G +  +  LD E +  Y + + A D      S   ++ I V + N++ P  +     + + E    N+ +  +   D D      +  +I     +G   +     V    E             +LDRE      + +   D G    L+STS I + VLD+NDN P F    YK Q+  +  +   + QV A D D  EN +I YSI  G   N F I+   G I   + LD + +  +++ I A +  +  K+       V + V   + N P I        +++ EN KP   +  I++ D D   N +  +++ N  + + F + + NG++      D E +  Y L I V D     + ++   + V ++D NDN P  +          +   N S+N+  E +   ++               D+ E+ ++ + +    D + +A LF ID  +G++ +++ +  +    + + +   D+G    R
Sbjct:  966 VYVLVDDVNDNAPVFGVQEYIFKVREDL-PRGTVLAVIEAVDEDIGP-NAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSI---TGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTER------------KLDRENQAEHILEVAISDNG-SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFA--------KDVYHVNISENIEEESVIMQLHA-------------TDRDEDKKLFYHLHATQDPSSLA-LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKR 1593          

HSP 8 Score: 119.013 bits (297), Expect = 2.263e-26
Identity = 126/460 (27.39%), Postives = 220/460 (47.83%), Query Frame = 1
Query:  955 IKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEF-------TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKS-LKALFNATTTVNIEVTDENDNVPEIY--LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSK----ETDYFDLKRNGSLFSKITFDRE-LKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            I I+++D ND  P+F    + +V+ E+T   + I+K+ A D D   + ++ Y ++     ++ E FA+   TGE+ L++ L       +E+ V A D G +        S +K+ I V+ VN + P       S     + P  ++ G + V D D + +NG+I   E +  +   D  F+   AE       ++     L+++      + L+  D G   R    SV  +Q+   + N P+F+   Y+  I E   I   V+++   D D  +NA +   I+ G   + F INP+SG +   ++LD E+K +Y L + AI+++ + +   ++  V I V D NDN P I+  + K + I EN     F+  + ++D+D G N    +S+ N      E D+F    +G + +    D E +K  Y L IR +D G+P  R +   + + + D NDN P
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL-----MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNP--LIYGIVRVNDKD-TGINGNIGRLEIVDGN--PDGTFLLKAAETKDEYYIELNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSV-PIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDP-IFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHF----SGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRP 611          

HSP 9 Score: 116.316 bits (290), Expect = 1.332e-25
Identity = 163/681 (23.94%), Postives = 290/681 (42.58%), Query Frame = 1
Query:  607 NQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKI-GKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG--EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP------KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            N  R V ++ I + D NDN P+F    +   +  I    G  I   KAID D  E N  V Y+L K +   EL      +  L + + ++   +N YELT+ A++       S   +++++ID +   PVF+K  + + + E+ ++   L + +EA +      L+Y + S + S   +      TG + ++  LD E   ++++ + ATD      +   + + + DVN+  P    +  +LT+ EN      + +IN  D D S  N  +    E +   N  +L ++            +++ +  LD E+     I +   D G    L+S S + + V D+NDN P F  P Y  ++      G  V    A+DKD  +   ++Y I+ G     +SI+  +G I+    L+  +K +    +L I+ S   +  A   + I +  EN     +Y P       + ++ ENL     I  + + D DFG      + +++ +    F + +  G + SK+TFDRE KDEY + ++V+D G     +S K           +      +  LKE                ++  +V  N    I T  A D D  +N  V F +   ++   +  +  I+E  G I          +  Y+  + A D+G+    +E
Sbjct: 2118 NVRRAVTSIDISVLDVNDNCPLFVNMPYYATVS-IDDPKGTIIMQVKAIDLDSAE-NGEVRYELKKGNG--ELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVIDRS--MPVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTISSESQSFEID----YNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDND-SGANAKLSYYIESINGQNNSELFYID-------VTDGNLYLKTPLDYEQIKYHHIVVNVKDHG-SPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSS---TVLNISVS-DGVHTAYARLKISLLPEN-----VYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLK-------VIVVDVNDNVPYFLLKEYKM-------------VVSTTVEANQ--TILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSE 2746          

HSP 10 Score: 112.849 bits (281), Expect = 1.415e-24
Identity = 180/792 (22.73%), Postives = 339/792 (42.80%), Query Frame = 1
Query:  343 TIQENHPSGIQVGFISSDITQIPNIDLPKFL-------DSSFYFTF--RDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVV---NVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEI---------LYGVGKTIELPKAIDKDVTEINSRVLYKL--NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY--LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDV---EFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYL----ICHDGGLHERLTSTSVITLQVLDVNDNPPVF-SIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGF--KIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            T+ EN P       I+ +I +  N+ +  F+        SS +F     + NE F ++  + V+     ID E           +   NL V   N+  E+  + +I   I I D NDN+P F    +V  + E          ++   K     +  D DV  +N  V Y +  + A + F++      T  + L + +DYET   Y   +   + G  +L S     + I +I++NDC PVF +    + L   T     + ++ A D D D+ L + +V    +   E F +++   +I  +  ++   E  + Y + V A+DG F++   ++I V    +   ++       +  EN      +G +NV   +  D N + R   P   + L D+       +          + V  DRE      +++    + +DG       + + I + VLDVNDN P+F ++P+Y A +  ++  G  ++QV A D D  EN +++Y + +G    F ++  SG ++  + ++   + NY+L + A + ++    ++   + ++V D +  V E      + + E+++ Y  +   I  +   G +   ++++  S E+  F++  N GS+F     D E    + ++IR  D    +       + V+I+D ND  P I                      S+I   ++ EN  F  +I    A D D G NA++++ +E I   N  + LF ID  +G++ +   +  + I  + + +   D G  SL +
Sbjct: 1708 TMSENDPPKFPTNNIAIEIFE--NLPIGTFVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYE----------SIKVFNLTVKGTNMAAESSCQNII---IHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVG-VNGMVEYHIVDDLAKNFFKID---STTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDT-LRFDIVDGNTN---ECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIG-NTLDENVEYRILNP---TQLFDIGISSGALKT---------TGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYY-ATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHNR-NYELTVAAYDGAITPC-SSEAPLQVKVIDRSMPVFEKQF-YTVSVKEDVEMYSALSVSIEAESPLGRS--LIYTI--SSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV--LSVSIMDVNDCYPEIE---------------------SDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNN-SELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSS 2431          

HSP 11 Score: 92.8189 bits (229), Expect = 2.244e-18
Identity = 111/486 (22.84%), Postives = 215/486 (44.24%), Query Frame = 1
Query:  448 YFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKEN--QLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKE-ILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINR----ETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVD----ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP------TNFFSINPNSGWITAIRRLD 1842
            Y    + ++YF + + + +++  K +D E           +   NL V        +L  +  V + I D NDN P F M+ +  KI E   +G         +ID  V   N+ + Y +   ++  + ++    T  L L   +DYE   FY LT+ A + G   L +   + I I+D+ND  P F + L+ + ++E+  +G  I+ ++ATD+D D   V G+V  T +I R      F++  + G + + + LD E    Y + + A D    +  ++  I I + D N++ P ++ +  S+ L+EN+    +     + D D     +    DIR     G   L+    +   + +   ++ +   +V++     P                L S + + +++++ +  PP+ +         E++  G  + +V A D+D  +  ++ +S++ GP      +  F+I+ N+G I AI  LD
Sbjct: 3206 YSLMGENHDYFKISKSTGIIRLHKSLDRET----------ISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGV---NADIHYFIMSGNEQGKFKMDS-TTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSD---VNGLV--TYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPP---------------LYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYD--ELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD 3655          

HSP 12 Score: 90.5077 bits (223), Expect = 1.023e-17
Identity = 131/572 (22.90%), Postives = 238/572 (41.61%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKI-RIFVRDVNNHPPSYNL-------NPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN--FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISE----DKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELK----DEYCLNIRVNDLGVPISRSSTKPICVNILDDND 2265
            L   + V I + ++NDN+P+     +   + E      + I L KA D D+    + + Y +   +     +I           + +D E +  + L +   +NG   L S   I + ++D+ND  P F + ++++ +  +  + + I ++ A D D  ++ ++ Y + S      +  F +  + G + + K LD +    +EI + A D      S+  R+ +  V  +P S N        +   + L EN  P  LV QI   D D   +  +I         N  +  ++       L  KY       LD E   +  + +   DG      T+ + + +QV+D+NDNPP F+   Y   I EN      ++Q+ A D+D+ +         + P++   F I+  SG +   +RLD E+   + L +   ++      N    + + V D ND+ PE     K+ I   +     IG+ ++E    D+D G+N +  +S+I       F++      F  IT    L      EY L ++  DLG P   S      +  + +ND
Sbjct: 1173 LSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITL-KAFDPDIDPTQT-ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGK---GKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNI------SNGNDDNTFYIGQDNGNILLSKY-------LDYETQQSYNLTISVTDG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII-VNVHDHNDHHPE--FTAKI-IQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEID---PTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSEND 1713          

HSP 13 Score: 83.9593 bits (206), Expect = 1.098e-15
Identity = 115/469 (24.52%), Postives = 193/469 (41.15%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIA-----WNNGHDELKSYLEIKIEIIDMNDCEP-VFKKGLFEL-------------VLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNS--INRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHD-GGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREE-KINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPE 1965
            N+ I + D+ND  P+F    +   I E        +++  A D D+  IN  + Y L   S+ F +  +   T  + L + + Y   + +ELT++A     W N  +   S  ++ I +  +N   P +F K    +             V D++T I   I +LE  D + D   +     + +   I    FA       I   TL  E   T     Y +         + I ++  + + P +      +++ E  P N+ V ++ V D D       +   E +G +   + +  PD           +++  QLD E+  + T+ +   D   +  R  S++ + + V D+NDN P+F        I ENN  G  V+++ A D+D  EN+ I YSI       F I+  SG +     LD E  K NY+L I A +  L         ++I V D NDN P+
Sbjct:  168 NIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKV-TADDADLG-INGEIYYSLLMDSEYFAIHPT---TGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKS---------VPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLG--KNALVYLEIVGGNEGDEFRINPDSGM--------LYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ 612          

HSP 14 Score: 81.6481 bits (200), Expect = 4.300e-15
Identity = 70/230 (30.43%), Postives = 114/230 (49.57%), Query Frame = 1
Query: 1945 ENDNVPE-IYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITF-DRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV----ADDADKGENAQVTFTME-DITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +N + PE +  P++L I E+++  + +  I ++D+D G NGK VF++ +      F +  +      I + DRE ++EY LNI V DLG P ++S++K + + ILD NDN PVI    TL      ES                      +I T V    A DAD G NAQVT+ +  + +D       F ++   G +++++ + R+   +Y + I A D G   L +E
Sbjct:  765 QNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNP-TKSTSKMLPITILDVNDNRPVI--QKTLATFRLTESA---------------------RIGTVVHCLHATDADSGINAQVTYALSVECSD-------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE 963          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 187.963 bits (476), Expect = 1.740e-47
Identity = 212/792 (26.77%), Postives = 341/792 (43.06%), Query Frame = 1
Query:  337 NYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTP-------RLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTN--SINRETFAVKETGEVILMKTLDVEFRQTYE---IPVYATD-GEFTSNSKIRIFVR--DVNNHPP--SYNLNPAS---LTLEENQPPNILVGQINVKDVDASDVNG----DIRCQEPLGKSNLQ---DLKFVPDPAEYPLTVKYDMFSRVQ--LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK-LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDY---FDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKIS--RIMSRDVIGDYKMKIIACDKGK 2595
            ++ + E  P G  VGFI +          PKF      + F +    FTLD  +  +KT   +D E +   +         +LVV     +Q    I V+I + D NDN P FP  S      E     G  + L  A D DV E      Y++   +   + ++     P        L  T ++D E++  Y+L + A + G      YL++ + I+D+ND  P+F    + + L+E    G  ++ + A+D D   +SK+ Y +  + +  ++N ET  +  T  V   +  +V+   + +     V+A D G    + +  + V   D N+H P  S+   P      T++EN     +V  + VKD D S +NG     I     LG   L+   DL  V                RV   LDREE     + ++  D G   R T+T+ + + V DVND+ PVF    Y A + E    G  V  + A D+D   NAQ+ Y IL G    +FS++P +G I     LDRE +   +L+I A +      F A T + + + DEND  P+    ++ + + E+  P   +  + + D D G NG   F+L  S E  Y   F L    G L ++   DRE   +Y +++   D G P  +S+T  + +N+ D NDN P       +     L   ++   L  E+ K  +       +    A D D G+NA + + +E   +      LF +D  +G+I +      S      YK+ + A D G+
Sbjct:   70 DFEVLEGQPRGTTVGFIPTK---------PKF-----SYRFNEPPREFTLDPVTGEVKTNVVLDREGMRDHY---------DLVV---LSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATS-GTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSD-SGLNGRTSVRIVSGNELGHFRLEEAADLHIV----------------RVNGVLDREEIGKYNLTVVAMDQGTPAR-TTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKF-AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIY---SLADDDDDIKLKKEVEKERI-------LLHVTASDKDDGDNALIEYRLESGGEG-----LFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ 800          

HSP 2 Score: 167.162 bits (422), Expect = 4.834e-41
Identity = 151/558 (27.06%), Postives = 261/558 (46.77%), Query Frame = 1
Query:  601 KENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTP--------RLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFTS----NSKIRIFVRDVNNHPPSYNLNPASLTLEENQ-PPNI-LVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDE----YCLNIRVNDLG 2205
            K+ +L   + V I+I D ND VP+F   +    ++ +   +   +   KA+D D    N  + Y + +A D  E     D  P        +LR+   +D E ++ Y L + A + G     +  ++ I I+D ND  PVF    +   + EN  IG +++++ ATD D+  + ++ Y +V    +     F++ E TG V + K L+ E    Y + V A D    +     +++ I + D+N++ P++  +P    + EN  PPN   V  +N  D D   +N  +R     G S+L  +               D+     LDRE+    T+ L+  D G    LT T ++ ++V D+NDN PVF +  Y A ++EN   G  VL   A DKD+  NA++++++L    + F I+  +G I+    LDREE   Y L ++A + S+     ++  + I V+D NDN+P+       + + E +   +F+    + D D G N   V   I+ ++  YFD+  + G + +K+    + K      Y + I   D G
Sbjct: 2143 KQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENV--AINTVVIAVKAVDNDEGR-NGYIDYLMKEARD--EDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQN---HDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRIN----------ASSGDIALLKPLDREQQSEYTLTLVAMDTG-SPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENA-VVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQG 2680          

HSP 3 Score: 166.007 bits (419), Expect = 1.064e-40
Identity = 211/840 (25.12%), Postives = 375/840 (44.64%), Query Frame = 1
Query:  253 KRNMKIYL-IVWILSNSLSIVFSRFE--GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDK-NEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLR-GVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSKIRIF--VRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDAS--------------------DVNGDIRCQEPLGKSN-------------LQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILE------GPTNF--FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK--LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGE-NAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            +R+ ++Y+ I+   S        +FE    L+ ++ EN P G  +  +++    + + ++  F+ +      R + +  F +D +  +L TA ++D E    ++  +        V  +    Q R     V++ + D+ND+ P F    FV  + E L  +G TI   +A D D   + S     ++     F L+ S   T +L L   +D ETK+ YEL  I  ++G    ++Y  I++   D ND  P+F+  ++   + EN + G  + ++ A D D  ++++L YG+VS   +   + F++  +TG + L   LD E  Q Y + V A D G+ + ++ I ++  V D+N++ P ++    S  + EN P    V  ++ KD+D+                     D NG IR +  L + +               +     +  E  L +KY    + Q  R+E        + H     +RL+ST  +T+ + DVND  PVF I   +  I EN  I   V+ V A D D+  N  I Y + E      G ++   FS+NP  G +  +  LDRE + +Y L I A ++  +   +  + + I + DENDN P ++ PK+    + EN      +  + + D D G NG+  +S++   +   F +  + G +      + E    Y L +R  D  +      T  + +NILD NDN P       L                + +++ +V  N G+ + T  A DAD    N+QV + +++  DS+    LF I+  +G I + + + R+   +Y + ++A D G   L
Sbjct: 1689 RRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA---HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVE--------VYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQ-IGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLEPS---TGKLILNDTLDRETKSKYELR-IRVSDGVQYTEAYATIQVS--DTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAN---DVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQE-------FLAHQK--QQRLSSTVKVTILIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRG-EPPQSTESQLLIRILDENDNSP-VFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYL----------------ARVMENTVPPNGGY-VLTVNAYDADTPPLNSQVRYFLKE-GDSD----LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPL 2471          

HSP 4 Score: 164.081 bits (414), Expect = 4.028e-40
Identity = 197/757 (26.02%), Postives = 331/757 (43.73%), Query Frame = 1
Query:  412 NIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLE-----ILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSF---VKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFEL-----QISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDK------DKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNS---KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL-EGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAIN--KSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDAD-KGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            ++DL    ++S+ F+  +  E F ++ QS  +  A  +D E     IL  K    DG          W     R    + I I DQNDN P F    +     ++++ +  VG+ I    A D+D    NS + Y L + S  F +     ++      R + ++ +    +N Y LT++A +NG   L S   + I I+D ++  P F++  +   L ++   G+ I+++ A DK      + D  L+   +SS  S+ R        G + L+K + V     YE+ V ATD      S   ++ I V   N   P +++N   + + EN+P    +  +   D D +  NG +R     G +  QD  F  D     + ++       QLD +      + +   D G H  L+S +++T+ + DVNDNPPVF+   Y   I EN  +G  V Q  A DKD  +NA I Y+ L  GP  +FF +N ++G I++    D EE+  Y L I A N   S+++  N    + + V   N+  P+   P    ++ E       +G + + DKD G +G+  + L+ S     F +  N G ++     DRE ++   L +   + G +  + +    + ++I D ND    I  + T                 S I +A+     G K+ T  A D D + +N Q +++   I + N +   F ID   G I  +  + R+    Y + I A D G
Sbjct: 2938 DLDLGANANASYSFS-ENPGEKFRIEPQSGNITVAGHLDREQQDEYIL--KVVASDGA---------W-----RAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQII----ATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYV-RSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHD------GWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATD-DDTGPNGMLRYSIS-GGNERQD--FSVDERTGGIVIQQ------QLDYDLIQEYHLNITVQDLGYHP-LSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYAN----LYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYT-----------------STISEAAPV---GTKVTTVKAIDKDVRTQNNQFSYS---IINGN-LKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTG 3627          

HSP 5 Score: 150.984 bits (380), Expect = 3.692e-36
Identity = 182/731 (24.90%), Postives = 309/731 (42.27%), Query Frame = 1
Query:  475 YFTLDRQSSVLK-TAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATD-KDKDSKLVYGMVSSTNS----INRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD-GE--FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADK-GENAQVTFTMEDITDSNQIAPLFIIDEDNGSI---KISRIMSRDVIGD----YKMKIIACDKGKSSLRTE 2613
            YF  +  S + +  A   D+ +L P          L LV        L G   V++ + D NDN P+F ++S+   ++E L   G  +  P+A DKD   +N+++ + L          I  + T  +     +D E  + Y LTL+A ++   E + S + + I + D+ND  P F    + + + E    G+ +    A D  D ++ +V+  +S  +     IN +T  V    E  L          TY I + A D GE   +S +++ + +R     P    +  +   + E+  P  ++ +++        V G IR     G   +       DP    L+V  D      LD E      I++   DG     L S ++ITL V D NDN PV     Y A++ E  +    +  V A D+D  +N  + Y +       F I   SG I    RLDREE  +Y   + A+++ +  +   T +V + + D+NDN P+      L + EN +   F+  + S D D G N    +S   +    +    ++G++      DRE +DEY L +  +D      R+ T PI + I D NDNAP              E +++  +     ++ S+       +   +A D DK G N+ ++++++      Q +P+F ID   G +   K  R      +      Y + ++A D GK  L +E
Sbjct: 2424 YFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPS-GTHVLTPRATDKD-EGLNAKLRFNL-LGEHMHRFHIDSE-TGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLE--LKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLV-GKIRYAIAGG---IMGDSLRVDPNSGLLSVGQD-----GLDYELTHLYEIWIEAADGDT-PSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEIT-ESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHM-TGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAW---RAET-PITITIQDQNDNAP--------------EFEHSFYSFSFPELQQSIA-----LVGQIIATDRDKQGPNSVISYSLQ------QPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSE 3107          

HSP 6 Score: 149.828 bits (377), Expect = 7.842e-36
Identity = 179/676 (26.48%), Postives = 294/676 (43.49%), Query Frame = 1
Query:  343 TIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEY-FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGV-INVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKN------FYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFK-KGLFELVLDENTKIGKLIIKLEATDKDKD--SKLVYGMVSSTNSINRETFAVKETGEVILMKT--LDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPS-----YNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDI--RCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKD-FGNNGKTVFSLINSKETDYFDLKRNGSLFSKIT-------FDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            T++EN PSG  V  ++   T     D  + L++   F    ++ + F +D ++  + TA  +D E        +  V  L L+       + R   +N+ I + D NDN+P F   ++   + E +   G+ +   +A+D D  E N+ V Y ++   D     I   NT    ++  ++ +TK        Y + + A + G   L S  E+ + I+   +  P F         + E+ + GK+I K+ AT   K    K+ Y +      I  ++  V     ++ +    LD E    YEI + A DG+     S + I + V D N++ P      YN       LEE  PP  L+  +   D D+ D NG++  R Q     +             + +T   ++++R++LDREE       +   D G+   +T T+ + L +LD NDNPP F+   +   + EN  IG  V++V + D D   NA   YS  E P   F I P SG IT    LDRE++  Y L ++A + + +    A T + I + D+NDN PE  +        E  +    +G II+ D+D  G N    +SL         D    G +FSK         + R  ++ Y L +   D G P   S    + +NI+D ++N P
Sbjct: 2499 TVRENLPSGTHV--LTPRAT-----DKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDRE--------ETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERI-SKGEFVFGARALDLDDGE-NAVVHYTIS-GRDQHYFDI---NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIA---GGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAE----VLEEESPPQ-LIAVVKASDRDSGD-NGNVIYRLQNDFDGT-------------FEITESGEIYTRMRLDREEIGDYAFVVEAVDQGV-PHMTGTASVLLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWR----AETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSID-PATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECL-VNINIVDAHNNPP 3122          

HSP 7 Score: 149.828 bits (377), Expect = 9.527e-36
Identity = 161/560 (28.75%), Postives = 250/560 (44.64%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKET-GEVILMKTLDVEFRQTYEIPVYAT--DGEFTSNSKIRIFVRDVNNHPPSYNLNPA-SLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPL-GKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHD-GGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDK-ENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLE--IMENLKPYQFIGNIISEDKDFGNNGKT-VFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDN 2268
            V IV+  +N + P F + S+   + E    VG TI    A D D T  N  + Y ++  ++  +  +  + T  + + + +DY+    Y L +   + G+  L S   + I + D+ND  PVF    +   + EN  +G  + +  A DKD  K++ + Y  + S    +R  F + ++ G +    + D E R+ Y + + A   D    S + + + V  VN   P + L P     + E       VG +   D D+ +   D R    L G SN  D  F  D      T    ++    LDRE      + ++  + G +    T  + + + + D ND PP F   +Y + I E   +G KV  V A DKD + +N Q  YSI+ G     F I+  +G I+   RLDREE   Y L I AI+  L      + TV+IE+ D NDN P  + P+ L   I EN      I  +I+ D D   NG    + LI  K   +  + RN G + S  +FDRE+       I V D G P  + S   + + +LD NDN
Sbjct: 3215 VVIVVTGENMDTPRFSVNSYQVIVPEN-EPVGSTILTVGATDDD-TGPNGMLRYSISGGNERQDFSV-DERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPS--GPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQF-LQPVFHFDVSETSAVGTRVGAVQATDKDSGE---DGRVYYLLVGSSN--DKGFRID------TNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQ-TGSATVHIELEDVNDNGP-TFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKP-KQKSQHLLTITVLDQNDN 3753          

HSP 8 Score: 144.05 bits (362), Expect = 5.482e-34
Identity = 194/784 (24.74%), Postives = 320/784 (40.82%), Query Frame = 1
Query:  466 KNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWK----ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDV-TEINSRVLYKL-NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEII-----DMNDCEPVF-KKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNS---INRETFAVKETGEVILMKTLDVEFR-QTYEIPVYAT--DGE-FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNL-----QDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN-FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISR-----------------------------------SSTKPICVNILDDNDNAPV-ISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGF-KIATAV-ADDADKGENAQVTFTMEDITDSN--QIAPL-FIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +  +F ++ ++ V+ T ++ID E +           F   VV   +    E QL     V +++ D NDN P+F   +      +     G +  + +   KD  +  N  V Y++ +   + F+LQ    NT  +  T    ++ +  Y+LTL + +      +   E+ I II           P F ++      + EN  IG  I+ + A     + +     V++T S   ++R      + G +     LD E   + YE+ VYA    G+  TS +K+R+ V D N+ PP +   P    + E+      +  +   D D             LG          D KF+ +P+   L +         LDRE      + +   DG  +    + +  T+QV D NDNPP+F    Y   I EN   G +V Q+VA D D  +NAQ+ Y ++    N  FS+NP +G +T   RLD EE  +Y L + A +    +L + T TV   V D NDN P I+ P     E+ EN+     +  + ++D D GNNG   +S+        F +  NG++ ++   DRE +  Y L +   D     +                                    SST  + + I D ND  PV IS + T                       ++ EN     +  AV A D D+G N  + + M++  D +  Q  PL F ++  +G +++   + R++   Y + I A D+G+    TE
Sbjct: 1537 QGRHFGINTETGVIHTLREIDRESIDT---------FRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQ---RNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT------------LGSVTFLLMDGHDGKFLLEPSTGKLILND------TLDRETKSKYELRIRVSDGVQY----TEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSL-STTITVYCNVLDLNDNAP-IFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANET-----------------------AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTE 2261          

HSP 9 Score: 143.28 bits (360), Expect = 9.660e-34
Identity = 184/802 (22.94%), Postives = 337/802 (42.02%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVG--------------FLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTE-INSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNG-HDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIF---VRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGD----IRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRV-QLDREEAPTRTIYLICHDGGL--HERLTSTSVITLQVLDVNDNPPVF---SIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYF--DLKRNGS----------------LFSKITFDRELK-DEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACD 2586
              ++I EN P+   VG +++       +D     ++   FT   + + FT+D ++  +KT +  D E L     N +  G               L   V+     +L+  + VK+++ D NDN P F    +   I E   G  +   +     +D  E +N  V Y L K ++  +  +    T +L L + +D E++  + L ++A +      L S   I I ++D ND  P F +   E+ + E +  G  +++  A+D D+  +S++V+  +S+ N   R+TF +   TG + L K LD E   +Y + + A+D    S S   ++   V D N++PP +        ++E  P    +  +   D D S +NG     I  QEP           +P    + +  +  +   + ++DRE   T  + ++  D       +L++  ++T+ V D+NDN PVF   +      +   +      V+QV A D D   N  + Y I+ GP   F +  N+G IT       ++++ YQL + + ++++++    ++ V I +        E  +P+        +    +   + E++  G +  TV + + S E +YF  ++   GS                L +    DRE   +EY + +    LG     S TK + V +LD ND+ P        +  D     N S++L             G  I+T  A D D      VTF + D  D       F+++   G + ++  + R+    Y+++I   D
Sbjct: 1158 FTFSIPENAPADTFVGKLTA-------VDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISE---GASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDS-ATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFS-ISAGN--RRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPD-SGLNGKVSYAISKQEPQ----------LPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSE-RRSSEVYITIITPGSGGSESSVPQ-------FEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTK-VRVTVLDKNDSPP--------QFLDTPFVYNVSEDL-----------QIGHTISTLRAHDPDT--LGSVTFLLMDGHDGK-----FLLEPSTGKLILNDTLDRETKSKYELRIRVSD 1899          

HSP 10 Score: 142.124 bits (357), Expect = 2.033e-33
Identity = 178/774 (23.00%), Postives = 328/774 (42.38%), Query Frame = 1
Query:  436 DSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCN-DDGVGFLNLVVNVWKENQLR----GVINVKIVIHDQNDNVPM-----FPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT--FELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDG----EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPP-------VFSIPFYKAQIKENNNIGDK--VLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIME---------------------NLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKP-----ICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +S   +   +    FT++ ++ V+ T ++++    CP+  N        + V  V+  +       G   V + + D ND+ P+     FP    V  + E    V  T+    A+    + +N R   ++   ++   F L+ + D    +R+   +D E    Y LT++A + G     +   + I++ D+ND EPVF+K  +  VL E    G  +  + ATD+D   ++++ Y ++S       + F++   TG ++    LD E R T E+ + A DG    +F + +++++ + D N+  P ++    ++TL E+ PP  +V  +   D D    NG +          L  L+F  D     LT      +R  LDRE+     I +I  D G     ++T+ + L V DVNDN P       ++S+      IK    +  +  +L V A DKDD +NA I+Y +  G    F ++  SG I+   R D    ++++          K L +A      +   + D + EI L  KLE++E                     N +P + +G +  +  +   N    + +I       F +  R+G + +    DRE +  Y L I  +      + +S+       + + I+D NDNAPV ++    +E +   S   +  +G EI  + V              D D G N+++++++     +N     F I    G + + R +  +      ++++A D G
Sbjct:  302 NSKITYYLAETEHQFTVNPETGVISTTERVN----CPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDE--NAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAAD-LHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGN---ELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKF-AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQG-TNGSVTFALAPSVERLYPLQFALDALTGQLT------TRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISL--RGDAPASMHWK-------PHYKLLVSARDAG--QRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALD---RESEPTISLPENAAVGQEIYLSRVR-------------DRDAGVNSRISYSL-----TNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAG 1025          

HSP 11 Score: 139.813 bits (351), Expect = 1.005e-32
Identity = 157/640 (24.53%), Postives = 272/640 (42.50%), Query Frame = 1
Query:  643 IHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVE--FRQTYEIPVYATDGEFTSNS-----------------------KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSK----ETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISR--SSTKPICVNILDDNDNAPV-ISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTF 2448
            I D ND+ P+F   S+   + E      +   L  A D D+ + N R+ Y++ + +      +  D    L +   +D E +++Y LT+   + G     S + + I +ID ND  P F    F   + EN      + KL A D+D  ++++L + + S T     +T      G +  ++  D E   + +        DG    +                        K+++ V DVN++ P +   P  +T+ E       +  +  +D D   +NGD+     L K N +  +F  D A   L++        +LDRE      + ++  D  L   L+S + IT+ VLD NDN P F+    +  + E +  G ++++  A D D   N+Q+ +SI  G   + F I+  +G +   + LD E+  +Y L I A +    +L + T   N+ V D+NDN P I+    +  +I E +     I  + ++D D G NGK  +++   +    +  +F +    G + +    DRE  D + L +   D   P  R  S+ K + V + D NDNAPV +S+++ +       SK +S                   +    A DAD   N  VT+
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFAL-AATDIDLGD-NGRISYEIIEGNTERMFGVFPDG--YLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDT----RNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEG-LNGDVYYS--LAKGN-EAGQFNLDSATGQLSLGR------RLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSL-STTVLYNVLVVDDNDN-PPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSST-----------------AVMQVHAKDADSSSNGLVTY 1641          

HSP 12 Score: 126.331 bits (316), Expect = 1.150e-28
Identity = 160/704 (22.73%), Postives = 300/704 (42.61%), Query Frame = 1
Query:  631 VKIVIH--DQNDNVPMFPMKSFVKKIKEILYG---VGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK---------DNTPRLRLTKDIDYETK----------NFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKD-SKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGE----FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-----FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTT--VNIEVTDENDNVP------EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDE--YCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFTMEDITDS---NQIAPLFIIDEDNGSIKISRIMSRDV-IGDYKMKIIACDKG 2592
            V +VIH  D+NDN P F   +F   I E       VGK      A+D+D+   N+ + + L+  +  F +             D    ++++++ +   +          N+  L     +NG   L+  +++K+ + D+ND  P F +  + + + E    G  I  +   D D+  +  VY  ++  N   +       TG++ L + LD E ++ + + V A D       +SN+ I I V D N++ P +  + + +++ E  P    + +    D D   VN  +     +   N +D   +        ++   ++    LD E+  + T+ +   D G    L++T +  + V+D NDNPP+F       QIKE   +   ++ V A D D   N ++ Y+I +          F IN  +G I  +R +DRE    ++L ++A +++  +    +T   V + V D NDN P         LP K    +       +  + ++D D  +NG   + +++  + + F L+RN  + +  T   + K E  Y L ++  D  V   R S++ + + I+         SV        Q E ++         +  SVYEN   G  I T  A  A    +A++ + + ++T +    Q+  LF ID   G +  +  + R+    +Y++++ A   G
Sbjct: 1137 VPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLT----AVDRDIGR-NAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLD-SATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQG-VNSQVVFS--ISAGNRRDTFHID-------SITGSLYLHKPLDYEDITSYTLNITASDCGT-PSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSS--TAVMQVHAKDADSSSNGLVTYEIVSGPQ-ELFKLQRNTGIIT-FTPGPQFKQEVRYQLTLKSTDEAVQSERRSSE-VYITIITPGSGGSESSV-------PQFEQRSK--------LSGSVYENEPIGTSILTVTAHLA----SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALG 1799          

HSP 13 Score: 111.694 bits (278), Expect = 3.935e-24
Identity = 122/504 (24.21%), Postives = 222/504 (44.05%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATD-----GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRV-QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQ-IKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDN 1956
            F++D ++  +   +++D +++            LN+ V     + L  V  + I++ D NDN P+F  K +   I E    VG  +    A DKD  + N+ + Y    +       I   +   +      DYE +  Y L + A  N    ++SY  + + ++ +N+  P F + +F   + E + +G  +  ++ATDKD  +D ++ Y +V S+N    + F +   TG + + + LD E +    + V A +     G  T  +++ I ++D  N PP +  +  + T+ E  P    V  +   D D    N        +   NL+          + + V+    S   +LDREE  T  + +   D GL  + T ++ + +++ DVNDN P F+       I EN   G  ++ ++A D D   N     Y ++ G   ++ S++ NSG + +    DRE     + AI+ +  S K    +   + I V D+NDN
Sbjct: 3277 FSVDERTGGIVIQQQLDYDLIQEYH--------LNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPEN-KPVGTFVFQAHAADKDSPK-NAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKA-KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSND---KGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQD-GNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYS--IINGNLKQ--------SFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQ-TGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILE-AIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 14 Score: 108.227 bits (269), Expect = 3.773e-23
Identity = 166/717 (23.15%), Postives = 295/717 (41.14%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPK--------AIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEII-----DMNDCEPVFKKGL-FELVLDE--------NTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSK---------IRIFVRDVNNHPPSYNLNPAS---LTLEENQPPNILVGQ-INVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRE---------------------LKDEY-CLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI---SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            V + + D NDN P F  + ++  + +    +    E+ K        A DKD  + N+ + Y+L    +      ++     LR         K  Y+L + A + G  + +S  +  +EI+     +M +C      G  F++V D         N ++G  I+++++T+   +S + Y ++    + N   F +   +G +   + LD E +  Y + + A+    +S +          + I + D+N++ P + L+  S   ++L    P N  VGQ I +  V   D   + R    L  +  Q  +  P        V   ++ +  +  E      + L+  D G    L+S   +++ + DVND+ PVF    Y+  + E   +  +   + A D D  +N +I Y I+EG T   F + P+ G++     LDREE+  Y L + +   + +   ++   V I V DENDN P+         I EN     F+G + + D+D G N +  F+L +S+  D+    RNG + +   FDRE                     +   Y  L   V+D G+P  +   K + V + D NDNAP       H T+ E              SE          G  I      DAD+G N  V +++    ++ Q    F +D   G + + R + R+    + + ++A D  
Sbjct:  694 VWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGD-NALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAG--QRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVG--IVQVKSTNGKANSHIEYDIIQGDRAQN---FRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISL----PENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGP--------VTGVLYLQRPIRAEPGSLIHVELMATDAGS-PPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTV-SCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL-SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVK-VKVIVTDVNDNAPEFLRAPYHVTISEG------------ASE----------GTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ----FNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAA 1359          

HSP 15 Score: 74.7146 bits (182), Expect = 6.661e-13
Identity = 92/363 (25.34%), Postives = 156/363 (42.98%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGH------DELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD---KDSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD---MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNP 1644
            ++ +    N+ + +   N+  P F    F   + E    VG  +   +A DKD  E + RV Y L  +S+    +I   NT  + + + +D ET+N   LT++A N G       DE     ++ I I D ND  P F K  +   + E   +G  +  ++A DKD   ++++  Y ++   N   +++F +  +TGE+     LD E   TY + + A D      T ++ + I + DVN++ P++     +  + EN+P    +  +   D D     G    Q   GK                L+V  +   + S    DRE  P     +   D G   +  S  ++T+ VLD NDNP
Sbjct: 3416 DSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSET-SAVGTRVGAVQATDKDSGE-DGRVYYLLVGSSNDKGFRIDT-NTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEA----QVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSII---NGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSW------------LSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSG-KPKQKSQHLLTITVLDQNDNP 3754          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 181.415 bits (459), Expect = 1.609e-45
Identity = 198/737 (26.87%), Postives = 323/737 (43.83%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINS-RVLYKLNKASDTFELQISKDNTPRLRLTKDI----DYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKD-SKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATD-GE--FTSNSKIRIFVRDVNNHPPSYNL----NPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVK----YDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP---TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP----EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINS-KETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI---SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISR--IMSRDVIGDYKMKIIACDKG 2592
              +DR +  ++T  K+D E               +LV        +R ++ VK    D+NDN P FP  S   +  E      K   LP A D D+   N+ R        +D F L   ++    L L   I    D ET   Y L + A + G   L+ ++ + I I D+ND +P+F +  +   + EN  +G  ++++ A+D D D + LV   ++   S   + F +   TG + + K LD E ++ +E+ V A D GE    + + + I V DVN++ P+ N+    + AS  + E+  P   V +I+V D D+     ++      G  +            + LT +    Y +   + LDRE     T+ ++  D G    L ++  I L++ DVNDNPP F    Y A + E  + G  VLQV+AHD+D+  N+ + YS+ E P     +F I+P +G IT    +D E +   QL ++A +  +  L ++T TV + + D NDN P      Y    + + EN    + I  + + D D G N    +++    K    F+++  +G +      D E +  Y   +   D G     S+T  I + + D NDN PV        +L+E  +  S+ +S                   I   VA D D G   QV++    I   N+ A +F ID   G I + R  ++S      + + I A D G
Sbjct:  123 LAIDRATGEIRTKVKLDRETRAS----------YSLVAIPLSGRNIRVLVTVK----DENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH------------FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGT-PPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPL-SSTATVLVTIHDVNDNEPIFDQSFY---NVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASST-----------------PIVAVVATDPDYGNFGQVSYR---IVAGNE-AGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 2 Score: 180.259 bits (456), Expect = 4.208e-45
Identity = 179/681 (26.28%), Postives = 306/681 (44.93%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELP----KAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKD-IDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGE--FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-------------TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSL--INSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +K+ + D NDN P+F  + +   ++E      +    P     A D D      +V Y++   ++    +I +       +  D +   T+  + L + A + G+    +   + + IID     P+F+K  +   + E+   G ++  + A   D    S + Y + S         F+++  +G + + K LD E +    + + AT GE     ++++ I V DVN++ P +  +   +++ E+      +   +  D D S  +G +     L K + + L F  D     L +         LD E +   T+ +   DGG+   L++   I + V DVNDNPPVF    Y   + E+ +I  +++QV A D D   NA+I Y I++               +  F I PNSGWI     LDRE +  YQL +LA +    A  +A T V + V D NDN P+    K +  I ENL+    +G + + D D G N    +SL  INS     F +    G + ++   DREL++ Y L +   D G P+ RS+  P+ +++ D NDNAP I+       Q+ + S    Q  G+E+++               A D D G+NA +T+++    DS+    LF ID  +G I+   ++  +    Y++ + A D G
Sbjct:  701 IKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFG-QVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD---GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKD-SGSSGQVTYS--LVKESGKGL-FAIDARSGHLILSQ------HLDYESSQRHTLIVTATDGGV-PSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAA-HAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPV-RSARVPVRIHVSDVNDNAPEIA-----DPQEDVVSVREEQPPGTEVVRVR-------------AVDRDHGQNASITYSIVKGRDSDGHG-LFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGG 1341          

HSP 3 Score: 166.777 bits (421), Expect = 5.301e-41
Identity = 196/759 (25.82%), Postives = 333/759 (43.87%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL-------NKASDTFELQISKDN-TPRLRLTKDIDYETKNFYELTLIAWN---NGHDELKSYLEIKIEIIDMNDCEPVF------KKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTL-----DVEFRQTYEIPVYATD-GE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSV----------------------ITLQVLDVNDNPPVFSI-PFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPY-QFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            F +DR S  L  A+ +D E+   +F  +     +  +      N     I VKI + D NDN P +P      ++ E    VG  I    A D D T  N  + Y+L       N++ +        D+ T  L L   +D+E    Y L + A +   N  + L++ + +++ I+D ND  P F            L + + T+IG+++  + A D+D   + +L Y  ++  N   R  F +  +TG + L+K+L     DVE    + + + A D G+     S+  + + V+  +N+PP +       T+ EN P    V Q+  K +  ++ N ++  + P G +N  DL  V    ++   +   + +R Q DRE   +  + +   D      L+S++V                      I + V DVNDN P F     Y   + EN+  G  +  VVA D D+  NA + YSI  G   N FSI+ +SG ++A R LDRE+   Y L I A ++           + I V D+NDN P   L K    ++   P    +  I + D D G N + V+SL N  +  +    ++G + +    DREL+  Y   +   D G    RS+T P+ +N+LD NDN P+   +  + +   L                     PG  +    A DAD G NA++ +++    +++ ++  F I+   G++  S+ ++ +      ++++A DKG
Sbjct: 1426 FDIDRHSGNLVVARLLDREVQS-EFRLE-----IRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY-EITGGNGEGR--FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAE-NANLSYEIPAGVAN--DLFHV----DWQRGI---ITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL-------------------IQPGQTLLKVQALDADLGANAEIVYSLN--AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG 2140          

HSP 4 Score: 158.688 bits (400), Expect = 1.711e-38
Identity = 188/783 (24.01%), Postives = 336/783 (42.91%), Query Frame = 1
Query:  358 HPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNE----YFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKL-----IIKLEATDKDKDSKLVYGMVSSTNSINRET--FAV-KETGEVILMK--TLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVR--DVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ--LDREEAPTRTIYLICHDGGLHE-RLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL-EGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNII----SEDKDFGNNGKTVFSLIN------------SKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            H + ++V    + + Q+   D  + L+S+  ++  +  E    +F +D Q+ ++ T   ID        C  + V  L +V        L     V + IHD NDN P+F    +   + E    VG+ I    A D D   +N+ V Y + +          +  +  + +  ++D+E ++ YE  ++A + G   L +   IK+++ D+ND  PVF    +++ L E+ K         I+ + ATD D  +   +G VS       E   F + + TGE+ +++   L V  +  + + + ATD G   SN+   +F+   D    PP +     +  ++E+ P   +VG +    + AS   GD+  + P+  S      +  DP  Y          R+   LD E    ++  L+     L E  +   + + ++V DVNDN P F     +  + E+  +G  +    AHDKD   + Q+ YS++ E     F+I+  SG +   + LD E    + L + A +  + +L +   T+ ++V D NDN P     +K E   N+   + I   I    + D D GNN +  + +++            S  + +F +  N G ++ +   DRE +D Y L +   D G P + + T+ + V +LD NDN P        K + +   + N +               G  +    A D D GENA + +++  I  S Q+ P+       G I     + R++   Y + + A D+G
Sbjct:  510 HANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHID--------CETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAEN-EPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGN---FGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSV----IAAS---GDVAHRSPVRYS-----IYSGDPDGYFSIETNSGNIRIAKPLDHE---AKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSL-STNLTILVDVQDVNDNPPVF---EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTR-VIVRVLDANDNDPKFQ-----KSKYEFRIEENLRR--------------GSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPV------TGEISTREPLDRELRELYDLVVEARDQG 1232          

HSP 5 Score: 135.576 bits (340), Expect = 2.052e-31
Identity = 183/814 (22.48%), Postives = 348/814 (42.75%), Query Frame = 1
Query:  340 YTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQ-LRGV-INVKIVIHDQNDNVPMF--PMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKA--SDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD------------KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSK-----IRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGD-----IRCQEPLGKSNLQDLK-FVPDPAEYPLTVKYDM-FSRVQLDREEAPTRTIYLIC-----HDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQ------IKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRL-----DREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPE-IYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSST---KPICVNILDDNDNAP---VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            + I+EN   G  VG +++      ++DL +  +++  ++    N  F +   +  + T + +D E+              +LVV    +   +R   + V+I + D NDN P    P +  V   +E     G  +   +A+D+D  + N+ + Y + K   SD   L      +  +R    +D+E ++ Y L + A + G+   ++   +++E++D+ND  P F        + E+  +G ++  +   ++             +D ++ Y +   T  +    F + + +G +++ + LD E +  + + + A D   ++N +     ++I V DVN++ P +  +P  L + E  P   ++      D D +  NGD     IR    L +S  Q +  F  D     L+++  + F  VQ           YL+          + ERL ++  + L++LD ND+ P F  P           I +   IG+ V  +VA D+D  +N Q+ Y I  G     F IN  +G I  ++ L     D E+   + L I A +        ++  +++ V   ++N P  +    +  I+EN+    F+  + ++      N    + +      D F +  + G + ++  FDRE +  Y L + V D     + SS+   K    + + D  N     V +++ T+ + +     N+ +         SV EN  PG  I T VA D D+G NA + ++   IT  N +   F ID  +G +  +R + R+    Y ++I A D+G+   R
Sbjct: 1160 FRIEENLRRGSVVGVVTAS-----DLDLGE--NAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRE----------LYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREE--QPPGTEVVRVRAVDRDHGQ-NASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQE----------YLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVND----NSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYS---ITGGN-LGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSR 1932          

HSP 6 Score: 129.028 bits (323), Expect = 2.023e-29
Identity = 165/683 (24.16%), Postives = 291/683 (42.61%), Query Frame = 1
Query:  637 IVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVY--GMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNN--------HPPSY-NLNPASLTLEENQPPNILVGQINVKDVDASDVNGD-IRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKE------NAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAIN-----KSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEI-MENLKPYQF-IGNIISEDKDFGN--NGKTVFSLINSKETDYFDLKR-NGSLF--SKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            I + D+NDN P F  K FV  + E     G  +    A D D    N+R+ Y +   +      I    +  +R    +D E ++ Y+L +IA + G  ++     I+++I+D+ND +P F      + + E T++G +I  + A D D    L Y  G  S+ +  N   FA+ + +G+++L + LD E +Q YE+ V A+D    + + + + V D N+         PP+Y  + PA   + E+   +  +  +N  D D+   N   I   EP  +       F   P+   ++V     SR+Q     +    + +I  D G    L S++++ +Q  D       F    Y+AQI E   +G  VLQ +  D  D+       N +  + +L+           S  I  ++ LDRE    Y+L ++  +            ++  +V I + D NDN P      K E  +  L P ++ I  + + D D  N  N + V+ + +  +   F +    G LF  +++ +D   K  Y L IR  D        S +P  + + D+NDN P       L E     ++N  + +GS + +A              A D DKG   Q+ +++           +F +D ++G +  + +   +    Y M+++A D G
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSE-GNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG------FSVHPSNGVVSVN---MSRLQPAVSSSGDYFVRIIAKDAG-KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQ-LGQDALDQSLAIIAGNEESAFELLQ-----------SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFP----LTEYVHFLAEN--EPVGSSVFRAH-------------ASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 7 Score: 103.99 bits (258), Expect = 6.794e-22
Identity = 186/842 (22.09%), Postives = 339/842 (40.26%), Query Frame = 1
Query:  343 TIQENHPSG---IQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLE----ILCPKFCNDDGVGFLNLVVNVWKE-----------NQLRGVINVKIVIHDQNDNVPMF-PMKSFVKKIKE-ILYGVGKTIELPKAIDKDVTE-INSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEF----TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQ--INVKDVDASDVNGDIRCQEPLGKSNLQ-DLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPV--FSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWIT---------------AIRRLDREEKINY-----------------------------------QLAILAINKSLKALFNAT-TTVNIEVTDENDNVPEIYLPKKLE-IMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR--NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            TI EN PSG   +QV   S    +  N+        S+       N+ F +D Q  ++ T  + D E     + P +  D           V K+            Q   V  + I + D NDN P F P   +   + E    GV  T+     +  D+ E  N+ ++Y +   +     + S D++      + +D E  + Y L + A + G  + +  +  I I + D ND  P FK   +   + E+  +G  ++++ A D D   +++LVY + + T    +  FA+  ++G +  +  LD E + +Y   V ATDG      ++   ++I V D+N++ P +   P    +    P  I  GQ  + V+ +DA D+  +      L   N     KF  +P+   L+    + S      E      + ++  D G +   +S  +I L + +     PV  F    Y+  +KEN+  G ++LQVVA  + D    ++++S   G      S++  SG I                ++  L R   ++Y                                   ++ ++ + ++  A F A+   + IE+ DENDN P+    + +  + E      F+  + + D D G+N +  + +++    + F ++   +G + + I  DRE++D Y L I   D GVP   + T  I V I+D NDN P           + L + + +  LG+ I   S             A+D D           E   D   ++ +F +D  +G + + R +  ++  +Y++ +IA D    +
Sbjct: 1727 TILENVPSGSFVLQVTAKSLHGAENANL--------SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-----VASDLDEGPNADLIYSITGGN--LGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET----QWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQV----PALIQPGQTLLKVQALDA-DLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLAS------ESGKLLHLEVVARDKG-NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVAL-RSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP-QMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSIS-------------ANDVDTYPALTYRLGAESTVDIENMS-IFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEA 2514          

HSP 8 Score: 100.523 bits (249), Expect = 9.448e-21
Identity = 104/355 (29.30%), Postives = 167/355 (47.04%), Query Frame = 1
Query: 1591 LTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPN-SGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKD--------FGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDAD-KGENAQVTFTMEDITDSNQIAPLFIIDEDNG--SIKISRIM-SRDVIGDYKMKIIACDKGKSSLRT 2610
            L S + + +++ D NDN P FS   + A + E NN G  V QV A D D   NA+++Y I++G   N F I P  SG +     LDRE +  Y+L I+A ++ +  +   T T+ +++ D NDN P       + + E  +    I +I + D D         G       S ++ +    F L R +G L  K   D EL+ EY L++  +D     +  +   + V + D+NDNAPV            L +        SEI ++   +   F + T  A DAD +G N++V + +E   +       F +   NG  S+ +SR+  +    GDY ++IIA D GK +L++
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQM-TGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAE-----STVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAI-------SEISESLSVD---FDLLTVNATDADSEGNNSKVIYIIEPAQEG------FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKS 2630          

HSP 9 Score: 55.8398 bits (133), Expect = 2.948e-7
Identity = 57/237 (24.05%), Postives = 110/237 (46.41%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINV---KIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKA-SDTFELQISKDNTPRLRLTKD--IDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKI--GKLIIKLEATDKDK--DSKLVYGMVS--STNSINRETFAV 1152
            FT+D  + VL    ++D          D G     L++     +  R + ++   ++ +HD+NDN P FP+  +V  + E    VG ++    A D D      ++ Y +  A SD    ++ + ++    +T     DYE +  Y++ L+A + G    K+ + +++EI   ++  P F +  +  VL     +  G ++ ++ ATD D   D ++VY + +  S   +NR + AV
Sbjct: 2803 FTIDLVTGVLFVNNRLDY---------DSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN-EPVGSSVFRAHASDLDKGPFG-QLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAV 3026          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 256.144 bits (653), Expect = 2.489e-69
Identity = 222/793 (27.99%), Postives = 367/793 (46.28%), Query Frame = 1
Query:  328 GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG-FLNLVVNVWK--ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT---FELQISKDNT---PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSK--IRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASD-------VNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            G + Y + E  P    +G +++D        LP   D+   +       Y  +D ++  +  T   ID E L  K C + G   FL   V+V    +NQ   +I  +I + D NDN P FP       + E  + +G    +P A DKD TE N    Y L    +    F LQ+++D     P+L +   +D E K+ Y+LT+ A + G+    S   +++ I D ND  P F+K  +E  + EN+ IG  +++++A D D   + ++ Y +  + + + +     + +G + +   LD E     +  V A D G    +SK  + I V D N++ P+  +    L         + E+ P    V  + V D D  +       V GD+  Q  P   S++ + +            KY + +   LD E      + ++  D G +  L+ST+ + +QV D NDN P+FS   ++ +  E N  G+KV++VVA D D   NA++ YSI+   +    F I+PNSG + A   LDRE K  Y+  + A +K + +    T TV I+V D NDN P+  L      ++EN+ P   +G +  +D D G N +   S+    +   F ++   G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPV++  S                  S  I+ S    P   +    A+D D G NA++ +++      +    LF I   NG I +++ ++R   G +++ I   D+GK S
Sbjct:   23 GGILYRVHEEQPPSTLIGSLAADQ------GLP---DTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--KDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTH-MGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKR------------KYFLQTTTPLDYERVRDYRVEIVAVDSG-NPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPS-HRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSV--EPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVVTKPSN-----------------SSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPS 764          

HSP 2 Score: 84.3445 bits (207), Expect = 7.956e-16
Identity = 82/352 (23.30%), Postives = 152/352 (43.18%), Query Frame = 1
Query: 1615 LQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF----FSINPNSG----WITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET--DYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVT--------FTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            ++V D+NDN P F  P     + EN ++G      +A DKD + N    Y++  GP         +  + G     +  +  LDRE K +Y L I A++      + ++  + + + D NDN P+      + E+ EN      +  + + D D G NG+  ++L  + +       + R+ G ++ K   DRE  +     +   D G P  +SS   + +++ D NDNAP + +             N S+++             G  +A     D D+GENA VT        F +   +DS+      + ++    ++ +  +  + + DY+++I+A D G  +L +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRY-SSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKG-PSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPV-----------GTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSS------VDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSS 451          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 253.447 bits (646), Expect = 4.161e-69
Identity = 222/793 (27.99%), Postives = 367/793 (46.28%), Query Frame = 1
Query:  328 GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG-FLNLVVNVWK--ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT---FELQISKDNT---PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSK--IRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASD-------VNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            G + Y + E  P    +G +++D        LP   D+   +       Y  +D ++  +  T   ID E L  K C + G   FL   V+V    +NQ   +I  +I + D NDN P FP       + E  + +G    +P A DKD TE N    Y L    +    F LQ+++D     P+L +   +D E K+ Y+LT+ A + G+    S   +++ I D ND  P F+K  +E  + EN+ IG  +++++A D D   + ++ Y +  + + + +     + +G + +   LD E     +  V A D G    +SK  + I V D N++ P+  +    L         + E+ P    V  + V D D  +       V GD+  Q  P   S++ + +            KY + +   LD E      + ++  D G +  L+ST+ + +QV D NDN P+FS   ++ +  E N  G+KV++VVA D D   NA++ YSI+   +    F I+PNSG + A   LDRE K  Y+  + A +K + +    T TV I+V D NDN P+  L      ++EN+ P   +G +  +D D G N +   S+    +   F ++   G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPV++  S                  S  I+ S    P   +    A+D D G NA++ +++      +    LF I   NG I +++ ++R   G +++ I   D+GK S
Sbjct:   23 GGILYRVHEEQPPSTLIGSLAADQG------LP---DTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--KDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTH-MGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKR------------KYFLQTTTPLDYERVRDYRVEIVAVDSG-NPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPS-HRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSV--EPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVVTKPSN-----------------SSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPS 764          

HSP 2 Score: 83.5741 bits (205), Expect = 1.119e-15
Identity = 82/352 (23.30%), Postives = 152/352 (43.18%), Query Frame = 1
Query: 1615 LQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF----FSINPNSG----WITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET--DYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVT--------FTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            ++V D+NDN P F  P     + EN ++G      +A DKD + N    Y++  GP         +  + G     +  +  LDRE K +Y L I A++      + ++  + + + D NDN P+      + E+ EN      +  + + D D G NG+  ++L  + +       + R+ G ++ K   DRE  +     +   D G P  +SS   + +++ D NDNAP + +             N S+++             G  +A     D D+GENA VT        F +   +DS+      + ++    ++ +  +  + + DY+++I+A D G  +L +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRY-SSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKG-PSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPV-----------GTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSS------VDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSS 451          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 242.276 bits (617), Expect = 2.288e-65
Identity = 217/779 (27.86%), Postives = 360/779 (46.21%), Query Frame = 1
Query:  337 NYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLD--------RQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKT-LDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS------YNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            +YT++E  P  +++G +  D+    N+D    L S+  F    K  Y T D            +L TA +ID E LC    N+    +  + V V  +   R ++ ++ +I D NDN P+F        I E    +     +P A D D+  IN    Y+L K+   F L I      D  P+L + + +D ETK+ + + +   + G+    S   +++ + D+ND  PVFK    E+ + EN  +G  +  L ATD D   ++++ +   +  +   +  FA+  T  +I +K  LD E    +++ V A+DG  T S + + + V D+N++ PS       NL   ++ L EN P N  +  I V D D SD+NG + C          D+ F   P       ++ + +   LD E      I ++  D G    L +++++ +++ D NDN PVF  P  +  I ENN+ G +++++ A D D   NA I YS+     + F+I+  SG ++ ++RLDRE++  Y   ++A +     L  +  TV + V D+NDN P    P+    + ENL  Y  +G I   D D G+N     S+IN K+    D K  G +   ITFDRE +  Y   ++  D G+ +  +S   + +N++D NDN PV  + S+    D + S                  +PG  +    A D D G NA++ +++        +  LF ID+  G+I +              KI+A D+G   L
Sbjct:   27 DYTVKEEQPENVRIGNLRKDLNL--NLDPDIKLSSALQF----KPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRC-YYEIEVAVLPDEIFR-LVKIRFLIEDINDNAPLFQSTVINISIPENT-AINSRYPVPSAFDPDIG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRD-SDLNGKVTCYTD------HDVPFRLKPV---FNDQFLLETAAPLDYETTREYAIRIVASDSG-KPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPL-QSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPK-TGVIKPNITFDREQQSSYTFVVKAVDAGL-MQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNT----------------SPGSVVTRVFAIDNDTGMNAELQYSII----GGSLRGLFTIDKTTGNITLQE------------KIVAADQGLHRL 749          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 243.047 bits (619), Expect = 2.403e-65
Identity = 216/779 (27.73%), Postives = 360/779 (46.21%), Query Frame = 1
Query:  337 NYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLD--------RQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS------YNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            +YT++E  P  +++G +  D+    N+D    L S+  F    K  Y T D            +L TA +ID E LC    N+    +  + V V  +   R ++ ++ +I D NDN P+F        I E    +     +P A D D+  IN    Y+L K+   F L I      D  P+L + + +D ETK+ + + +   + G+    S   +++ + D+ND  PVFK    E+ + EN  +G  +  L ATD D   ++++ +   +  +   +  FA+   TG + + + LD E    +++ V A+DG  T S + + + V D+N++ PS       NL   ++ L EN P N  +  I V D D SD+NG + C          D+ F   P       ++ + +   LD E      I ++  D G    L +++++ +++ D NDN PVF  P  +  I ENN+ G +++++ A D D   NA I YS+     + F+I+  SG ++ ++RLDRE++  Y   ++A +     L  +  TV + V D+NDN P    P+    + ENL  Y  +G I   D D G+N     S+IN K+    D K  G +   ITFDRE +  Y   ++  D G+ +  +S   + +N++D NDN PV  + S+    D + S                  +PG  +    A D D G NA++ +++        +  LF ID+  G+I +              KI+A D+G   L
Sbjct:   27 DYTVKEEQPENVRIGNLRKDLNL--NLDPDIKLSSALQF----KPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRC-YYEIEVAVLPDEIFR-LVKIRFLIEDINDNAPLFQSTVINISIPENT-AINSRYPVPSAFDPDIG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRD-SDLNGKVTCYTD------HDVPFRLKPV---FNDQFLLETAAPLDYETTREYAIRIVASDSG-KPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPL-QSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPK-TGVIKPNITFDREQQSSYTFVVKAVDAGL-MQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNT----------------SPGSVVTRVFAIDNDTGMNAELQYSII----GGSLRGLFTIDKTTGNITLQE------------KIVAADQGLHRL 749          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 240.736 bits (613), Expect = 7.430e-65
Identity = 203/718 (28.27%), Postives = 343/718 (47.77%), Query Frame = 1
Query:  502 VLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVV-AHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +  T+ +ID E LCP    +D      + V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  NS   Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G+ +  S   +++ + D+ND  PVFK+   E+ + EN+ +G  +++L+ATD D   ++++ Y   +  +   R  FA+   TG + + + LD E    +++ V A+DG  + + + I I V DVN++ P+    Y ++P   ++ L E  P N  +  I V D D +DVNG + C             F+     + L   YD    + +   LD E        ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + E NN+ D  L  + A D+D   NA+I Y +  GP  +FF ++  +G +TA R  DREE+  +   + A +   +AL  +   V + + DENDN P+  +   +  + ENL  Y  +G I   D D G N     S++N  E    D   +G + S ++FDRE +  Y  ++R  D G P   S+ K + +N++D NDN P++    +              N   +++  S    PG  +A   A D D G NA++ +T+     S  +  LF ID   G+I +    +   IG +++ +   D G
Sbjct:   85 IFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKD-TDVNGKVIC-------------FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSG-KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVME-NNLRDMFLTTISATDEDSGRNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRAL-QSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILD-PDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAK-VTINVIDVNDNTPIVIYPPS--------------NTSFKLVPLSAI--PGSVVAEVFAVDGDTGMNAELKYTIV----SGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLG 758          

HSP 2 Score: 126.716 bits (317), Expect = 6.738e-29
Identity = 136/492 (27.64%), Postives = 213/492 (43.29%), Query Frame = 1
Query: 1207 TYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPL-GKSNLQ-DLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-----PKKLEIMENLK-PYQF-IGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            ++EI V     ++    KI+I V+D N++ P +     ++++ EN   N      +  D D       +   E L G+S    D+   P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN+ +G  V+Q+ A D D   NA+IKY     +       F++N  +G IT  R LDREE   ++L +LA + S      A  T+ I VTD NDN P I L     P    +M + K P    I  I   DKD   NGK +        F L    +  Y        L +    D E   EY   I  +D G P S + T  + V + D+NDN P+ +                       +I+ +V EN      + T  A D D G NA++ + +         A  F +D   G +  SR+  R+    +   + A D G  +L+++
Sbjct:  109 SFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGP--NSVHKYELLNGQSAFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKVKVEDGGNPQK-SSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP---ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYL-------LETSALLDYEGTKEYIFKIVASDSGKP-SLNQTALVRVRLEDENDNPPIFT---------------------QPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQL------GPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQ 554          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 256.529 bits (654), Expect = 6.723e-70
Identity = 225/778 (28.92%), Postives = 371/778 (47.69%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS----VLKTAKKIDLEILCPKFCN-DDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L YTI+E  P  + +G I  D+  I +I+      +S  +    K     L + SS    +  T+ +ID E LC    N D+   F  L V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A+D D T  N    Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND +PVFK+   E+ + EN  IG  +++L ATD D   ++++ Y   +   S  +  FA+   TG + + + LD E    +++ V ATDG  T + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +DVN  + C             F+     + L   YD    + +   LD E     +  ++  D G    L  T+++ +++ D NDNPP+FS P  +  + ENN  G  +  V A D+D  +N+ I Y +  GP  +FF ++  +G +TA R  DREE+  +   + A +     L  +   V + V DENDN P+  +   +  + ENL  Y  +G I + D D G N     S++N  E    D   +G + S ++FDRE +  Y  +++  D G P  RSST  + +NI+D NDN+PV+               +   N   +++  S    PG  +A   A D D G NA++ +T+  ++ +N+   LF ID   G+I +    S   +G +++ +   D G
Sbjct:   26 LIYTIREELPENVPIGNIPKDL-NISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNSDENECFFELEVVILPNDFFR-LIKIKIIVKDTNDNAPMFPSTVINISIPENTL-INSRFPIPSAVDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKD-TDVNSKVIC-------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTG-KPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPL-QSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLD-PYSGLIKSNVSFDREQQSSYTFDVKAVDGGQP-PRSSTAKVTINIMDANDNSPVV--------------ISPPSNTSFKLVPLSAI--PGSVVAEVFAVDTDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLG 759          

HSP 2 Score: 125.946 bits (315), Expect = 1.546e-28
Identity = 142/497 (28.57%), Postives = 213/497 (42.86%), Query Frame = 1
Query: 1210 YEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV--PDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +E+ V     +F    KI+I V+D N++ P +     ++++ EN   N      +  D D +  NG ++  E L   ++  L  V  P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN  IG  V+Q+ A D D   NA+IKY     +       F++N  +G IT  R LDREE   ++L +LA + S      A  TV I VTD NDN P I             YL +K  I  N K    I  I   DKD   N K +        F L    +  Y  L    SL      D E   E+   I   D G P S + T  + V + D+NDN P+ S                       +I+ SV EN   G  + T  A D D G+N+ + + +         A  F +D   G +  SR+  R+    +   + A D G   L+++
Sbjct:  111 FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPD-TGFNG-VQHYELLNGQSVFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTP---ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPI--NTK----IALITVSDKDTDVNSKVICFIEREVPFHLKAVYDNQY--LLETSSLL-----DYEGIKEFSFKIVAADTGKP-SLNQTALVRVELEDENDNPPIFS---------------------QPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQL------GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQ 555          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 256.529 bits (654), Expect = 8.718e-70
Identity = 225/780 (28.85%), Postives = 369/780 (47.31%), Query Frame = 1
Query:  340 YTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG---FLNLVVNVWK-ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKD--VTEINSRVLYKLNKASDTFELQISKDN---TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            Y + E  P  I +G ++SD           + DS   +     + Y  +D ++  +  T   ID E L  + C +   G   FL   V++    + +  +++ +I I D NDN P F        I E    +G    +P A D+D  V  ++S  L    +A D F LQ+++D     P+L +   +D E ++ Y+LT+   + G     S   ++I I+D ND  P F+K  +E  L EN+ +G  +++++A D D+  ++++ Y    +++++ R     + TG + +   +D E   T +  V A D      T+ +++ I +RD N++ P   +    L         + E+ P    V  + V D+D   VN  + C    G    Q LK V D        KY + +   LD E     TI ++  D G +  L+ST+ + +QV DVNDN PVFS    +    ENN+I D V++V A D D   N+Q+ YSIL  P+    FSINP+SG I     LDRE++ +Y   ++A++K + +L   T +V I V D NDN P+  L      +MEN+     +G +   D D G N     S +  +  ++      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPVI V S               N+  + +    +  PG  +    A+D D G NA++ +++     S     LF I  +NG + + + + R   G +++ +   DKGK S
Sbjct:   71 YRVPEEQPPNILIGSLASDY---------GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENT-NIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEG-VNAAVTCVV-AGDVPFQ-LKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSG-NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSL-KGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPS---------------NISYKYLTPQTH--PGTPVNWVRAEDMDTGINAELDYSIA----SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 118.627 bits (296), Expect = 3.212e-26
Identity = 132/468 (28.21%), Postives = 211/468 (45.09%), Query Frame = 1
Query: 1264 RIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP---TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI---------YLPKKLEIMENLKPYQFIGNIISEDKDFGNN--------GKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            +I + D+N++ P++N    +L++ EN    +L       D D S VNG +   E +     QDL F    AE     +  +     LDRE+  +  + +   DGG   R  S++++ + +LD NDN P F    Y+A++ EN+ +G  VLQV A+D D   NA+I YS  +          ++ ++G IT    +DRE+    + +++A +K       A T V I + D NDN P I         +      I E++     +  +   D D G N        G   F L    +T   D K+   L +    D E   EY + I   D G P   SST  + V + D NDNAPV S   +L E       N+  +L  E+                 A DAD G N+Q+ +++  + D +    +F I+ D+G I+++ ++ R+    Y   ++A DKG  SL+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNG-VSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPAR-ASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNP-PLSSTNSLKVQVTDVNDNAPVFS--QSLMEV-VFPENNDINDLVMEV----------------SATDADSGPNSQLHYSI--LPDPSARG-IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK 601          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 256.529 bits (654), Expect = 1.006e-69
Identity = 225/780 (28.85%), Postives = 369/780 (47.31%), Query Frame = 1
Query:  340 YTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG---FLNLVVNVWK-ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKD--VTEINSRVLYKLNKASDTFELQISKDN---TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            Y + E  P  I +G ++SD           + DS   +     + Y  +D ++  +  T   ID E L  + C +   G   FL   V++    + +  +++ +I I D NDN P F        I E    +G    +P A D+D  V  ++S  L    +A D F LQ+++D     P+L +   +D E ++ Y+LT+   + G     S   ++I I+D ND  P F+K  +E  L EN+ +G  +++++A D D+  ++++ Y    +++++ R     + TG + +   +D E   T +  V A D      T+ +++ I +RD N++ P   +    L         + E+ P    V  + V D+D   VN  + C    G    Q LK V D        KY + +   LD E     TI ++  D G +  L+ST+ + +QV DVNDN PVFS    +    ENN+I D V++V A D D   N+Q+ YSIL  P+    FSINP+SG I     LDRE++ +Y   ++A++K + +L   T +V I V D NDN P+  L      +MEN+     +G +   D D G N     S +  +  ++      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPVI V S               N+  + +    +  PG  +    A+D D G NA++ +++     S     LF I  +NG + + + + R   G +++ +   DKGK S
Sbjct:   71 YRVPEEQPPNILIGSLASDY---------GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENT-NIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEG-VNAAVTCVV-AGDVPFQ-LKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSG-NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSL-KGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPS---------------NISYKYLTPQTH--PGTPVNWVRAEDMDTGINAELDYSIA----SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 118.627 bits (296), Expect = 3.153e-26
Identity = 132/468 (28.21%), Postives = 211/468 (45.09%), Query Frame = 1
Query: 1264 RIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP---TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI---------YLPKKLEIMENLKPYQFIGNIISEDKDFGNN--------GKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            +I + D+N++ P++N    +L++ EN    +L       D D S VNG +   E +     QDL F    AE     +  +     LDRE+  +  + +   DGG   R  S++++ + +LD NDN P F    Y+A++ EN+ +G  VLQV A+D D   NA+I YS  +          ++ ++G IT    +DRE+    + +++A +K       A T V I + D NDN P I         +      I E++     +  +   D D G N        G   F L    +T   D K+   L +    D E   EY + I   D G P   SST  + V + D NDNAPV S   +L E       N+  +L  E+                 A DAD G N+Q+ +++  + D +    +F I+ D+G I+++ ++ R+    Y   ++A DKG  SL+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNG-VSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPAR-ASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNP-PLSSTNSLKVQVTDVNDNAPVFS--QSLMEV-VFPENNDINDLVMEV----------------SATDADSGPNSQLHYSI--LPDPSARG-IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK 601          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 257.299 bits (656), Expect = 1.823e-69
Identity = 225/780 (28.85%), Postives = 369/780 (47.31%), Query Frame = 1
Query:  340 YTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG---FLNLVVNVWK-ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKD--VTEINSRVLYKLNKASDTFELQISKDN---TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            Y + E  P  I +G ++SD           + DS   +     + Y  +D ++  +  T   ID E L  + C +   G   FL   V++    + +  +++ +I I D NDN P F        I E    +G    +P A D+D  V  ++S  L    +A D F LQ+++D     P+L +   +D E ++ Y+LT+   + G     S   ++I I+D ND  P F+K  +E  L EN+ +G  +++++A D D+  ++++ Y    +++++ R     + TG + +   +D E   T +  V A D      T+ +++ I +RD N++ P   +    L         + E+ P    V  + V D+D   VN  + C    G    Q LK V D        KY + +   LD E     TI ++  D G +  L+ST+ + +QV DVNDN PVFS    +    ENN+I D V++V A D D   N+Q+ YSIL  P+    FSINP+SG I     LDRE++ +Y   ++A++K + +L   T +V I V D NDN P+  L      +MEN+     +G +   D D G N     S +  +  ++      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPVI V S               N+  + +    +  PG  +    A+D D G NA++ +++     S     LF I  +NG + + + + R   G +++ +   DKGK S
Sbjct:   63 YRVPEEQPPNILIGSLASDY---------GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENT-NIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEG-VNAAVTCVV-AGDVPFQ-LKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSG-NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSL-KGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPS---------------NISYKYLTPQTH--PGTPVNWVRAEDMDTGINAELDYSIA----SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 801          

HSP 2 Score: 118.242 bits (295), Expect = 4.738e-26
Identity = 132/468 (28.21%), Postives = 211/468 (45.09%), Query Frame = 1
Query: 1264 RIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP---TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI---------YLPKKLEIMENLKPYQFIGNIISEDKDFGNN--------GKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            +I + D+N++ P++N    +L++ EN    +L       D D S VNG +   E +     QDL F    AE     +  +     LDRE+  +  + +   DGG   R  S++++ + +LD NDN P F    Y+A++ EN+ +G  VLQV A+D D   NA+I YS  +          ++ ++G IT    +DRE+    + +++A +K       A T V I + D NDN P I         +      I E++     +  +   D D G N        G   F L    +T   D K+   L +    D E   EY + I   D G P   SST  + V + D NDNAPV S   +L E       N+  +L  E+                 A DAD G N+Q+ +++  + D +    +F I+ D+G I+++ ++ R+    Y   ++A DKG  SL+
Sbjct:  155 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNG-VSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPAR-ASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNP-PLSSTNSLKVQVTDVNDNAPVFS--QSLMEV-VFPENNDINDLVMEV----------------SATDADSGPNSQLHYSI--LPDPSARG-IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK 593          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 257.299 bits (656), Expect = 1.843e-69
Identity = 225/780 (28.85%), Postives = 369/780 (47.31%), Query Frame = 1
Query:  340 YTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG---FLNLVVNVWK-ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKD--VTEINSRVLYKLNKASDTFELQISKDN---TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            Y + E  P  I +G ++SD           + DS   +     + Y  +D ++  +  T   ID E L  + C +   G   FL   V++    + +  +++ +I I D NDN P F        I E    +G    +P A D+D  V  ++S  L    +A D F LQ+++D     P+L +   +D E ++ Y+LT+   + G     S   ++I I+D ND  P F+K  +E  L EN+ +G  +++++A D D+  ++++ Y    +++++ R     + TG + +   +D E   T +  V A D      T+ +++ I +RD N++ P   +    L         + E+ P    V  + V D+D   VN  + C    G    Q LK V D        KY + +   LD E     TI ++  D G +  L+ST+ + +QV DVNDN PVFS    +    ENN+I D V++V A D D   N+Q+ YSIL  P+    FSINP+SG I     LDRE++ +Y   ++A++K + +L   T +V I V D NDN P+  L      +MEN+     +G +   D D G N     S +  +  ++      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPVI V S               N+  + +    +  PG  +    A+D D G NA++ +++     S     LF I  +NG + + + + R   G +++ +   DKGK S
Sbjct:   71 YRVPEEQPPNILIGSLASDY---------GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENT-NIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEG-VNAAVTCVV-AGDVPFQ-LKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSG-NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSL-KGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPS---------------NISYKYLTPQTH--PGTPVNWVRAEDMDTGINAELDYSIA----SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 117.857 bits (294), Expect = 5.362e-26
Identity = 132/468 (28.21%), Postives = 211/468 (45.09%), Query Frame = 1
Query: 1264 RIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP---TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI---------YLPKKLEIMENLKPYQFIGNIISEDKDFGNN--------GKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            +I + D+N++ P++N    +L++ EN    +L       D D S VNG +   E +     QDL F    AE     +  +     LDRE+  +  + +   DGG   R  S++++ + +LD NDN P F    Y+A++ EN+ +G  VLQV A+D D   NA+I YS  +          ++ ++G IT    +DRE+    + +++A +K       A T V I + D NDN P I         +      I E++     +  +   D D G N        G   F L    +T   D K+   L +    D E   EY + I   D G P   SST  + V + D NDNAPV S   +L E       N+  +L  E+                 A DAD G N+Q+ +++  + D +    +F I+ D+G I+++ ++ R+    Y   ++A DKG  SL+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNG-VSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPAR-ASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNP-PLSSTNSLKVQVTDVNDNAPVFS--QSLMEV-VFPENNDINDLVMEV----------------SATDADSGPNSQLHYSI--LPDPSARG-IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK 601          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 249.21 bits (635), Expect = 2.798e-68
Identity = 219/778 (28.15%), Postives = 370/778 (47.56%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS----VLKTAKKIDLEILCPKFC-NDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L YTI+E  P  + +G I  D+  I +I+      +S  +    K     L + SS    +  T+ +ID E LC      ++   F  L V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  N    Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND  PVFK+G  E+ + EN  +G  +I+L ATD D   ++++ Y   +      +  FA+   TG + + ++LD E    +++ V A+DG  T + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +DVNG + C             F+     + L   YD    + +   LD E     +  ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN  G  +  + A D+D  +NA I Y +  GP  +FF ++  +G +TA R  +REE+  +   + A +     L  +   V + V DENDN P+  +   +  + ENL  Y  +G I   D+D G N     S++N  E    D   +G + S ++FDRE +  Y  +++  D G P  RSST  + +N++D NDN+PV+               +   N   +++  S    PG  +A   A D D G NA++ +T+  ++ +N+   LF ID   G+I +    +   +G +++ +   D G
Sbjct:   26 LIYTIREELPENVPIGNIPKDL-NISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVIC-------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSG-KPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPL-QSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLD-PYSGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVV--------------ISPPSNTSFKLVPLSAI--PGSVVAEVFAVDIDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG 759          

HSP 2 Score: 124.02 bits (310), Expect = 3.695e-28
Identity = 139/497 (27.97%), Postives = 215/497 (43.26%), Query Frame = 1
Query: 1210 YEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV--PDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +E+ V     +F    KI+I V+D N++ P +     ++++ EN   N      +  D D +  NG ++  E L   ++  L  V  P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN  +G  V+Q+ A D D   NA+I+Y     +       F++N  +G IT  R LDREE   +++ +LA + S      A  TV I VTD NDN P I             YL +K  +  N K    I  I   DKD   NGK +        F L    +  Y  L    SL      D E   E+   I  +D G P S + T  + V + D+NDN P+                         +I+ SV EN   G  + T  A D D G+NA + + +         A  F +D   G +  SR+ +R+    +   + A D G   L+++
Sbjct:  111 FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNG-VQHYELLNGQSVFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPV--NTK----IALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQY--LLETSSLL-----DYEGTKEFSFKIVASDSGKP-SLNQTALVRVKLEDENDNPPI---------------------FNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL------GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ 555          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 251.136 bits (640), Expect = 1.168e-67
Identity = 219/778 (28.15%), Postives = 370/778 (47.56%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS----VLKTAKKIDLEILCPKFC-NDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L YTI+E  P  + +G I  D+  I +I+      +S  +    K     L + SS    +  T+ +ID E LC      ++   F  L V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  N    Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND  PVFK+G  E+ + EN  +G  +I+L ATD D   ++++ Y   +      +  FA+   TG + + ++LD E    +++ V A+DG  T + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +DVNG + C             F+     + L   YD    + +   LD E     +  ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN  G  +  + A D+D  +NA I Y +  GP  +FF ++  +G +TA R  +REE+  +   + A +     L  +   V + V DENDN P+  +   +  + ENL  Y  +G I   D+D G N     S++N  E    D   +G + S ++FDRE +  Y  +++  D G P  RSST  + +N++D NDN+PV+               +   N   +++  S    PG  +A   A D D G NA++ +T+  ++ +N+   LF ID   G+I +    +   +G +++ +   D G
Sbjct:   26 LIYTIREELPENVPIGNIPKDL-NISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVIC-------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSG-KPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPL-QSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLD-PYSGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVV--------------ISPPSNTSFKLVPLSAI--PGSVVAEVFAVDIDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG 759          

HSP 2 Score: 124.405 bits (311), Expect = 4.687e-28
Identity = 137/497 (27.57%), Postives = 215/497 (43.26%), Query Frame = 1
Query: 1210 YEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV--PDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +E+ V     +F    KI+I V+D N++ P +     ++++ EN   N      +  D D +  NG ++  E L   ++  L  V  P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN  +G  V+Q+ A D D   NA+I+Y     +       F++N  +G IT  R LDREE   +++ +LA + S      A  TV I VTD NDN P I             YL +K  +  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   E+   I  +D G P S + T  + V + D+NDN P+ +                       +I+ SV EN   G  + T  A D D G+NA + + +         A  F +D   G +  SR+ +R+    +   + A D G   L+++
Sbjct:  111 FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNG-VQHYELLNGQSVFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPV--NTK----IALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL-------LETSSLLDYEGTKEFSFKIVASDSGKP-SLNQTALVRVKLEDENDNPPIFN---------------------QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL------GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ 555          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 251.136 bits (640), Expect = 1.229e-67
Identity = 219/778 (28.15%), Postives = 370/778 (47.56%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS----VLKTAKKIDLEILCPKFC-NDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L YTI+E  P  + +G I  D+  I +I+      +S  +    K     L + SS    +  T+ +ID E LC      ++   F  L V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  N    Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND  PVFK+G  E+ + EN  +G  +I+L ATD D   ++++ Y   +      +  FA+   TG + + ++LD E    +++ V A+DG  T + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +DVNG + C             F+     + L   YD    + +   LD E     +  ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN  G  +  + A D+D  +NA I Y +  GP  +FF ++  +G +TA R  +REE+  +   + A +     L  +   V + V DENDN P+  +   +  + ENL  Y  +G I   D+D G N     S++N  E    D   +G + S ++FDRE +  Y  +++  D G P  RSST  + +N++D NDN+PV+               +   N   +++  S    PG  +A   A D D G NA++ +T+  ++ +N+   LF ID   G+I +    +   +G +++ +   D G
Sbjct:   26 LIYTIREELPENVPIGNIPKDL-NISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVIC-------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSG-KPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPL-QSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLD-PYSGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVV--------------ISPPSNTSFKLVPLSAI--PGSVVAEVFAVDIDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG 759          

HSP 2 Score: 124.405 bits (311), Expect = 4.634e-28
Identity = 137/497 (27.57%), Postives = 215/497 (43.26%), Query Frame = 1
Query: 1210 YEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV--PDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +E+ V     +F    KI+I V+D N++ P +     ++++ EN   N      +  D D +  NG ++  E L   ++  L  V  P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN  +G  V+Q+ A D D   NA+I+Y     +       F++N  +G IT  R LDREE   +++ +LA + S      A  TV I VTD NDN P I             YL +K  +  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   E+   I  +D G P S + T  + V + D+NDN P+ +                       +I+ SV EN   G  + T  A D D G+NA + + +         A  F +D   G +  SR+ +R+    +   + A D G   L+++
Sbjct:  111 FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNG-VQHYELLNGQSVFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPV--NTK----IALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL-------LETSSLLDYEGTKEFSFKIVASDSGKP-SLNQTALVRVKLEDENDNPPIFN---------------------QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL------GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ 555          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 251.136 bits (640), Expect = 1.229e-67
Identity = 219/778 (28.15%), Postives = 370/778 (47.56%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS----VLKTAKKIDLEILCPKFC-NDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L YTI+E  P  + +G I  D+  I +I+      +S  +    K     L + SS    +  T+ +ID E LC      ++   F  L V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  N    Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND  PVFK+G  E+ + EN  +G  +I+L ATD D   ++++ Y   +      +  FA+   TG + + ++LD E    +++ V A+DG  T + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +DVNG + C             F+     + L   YD    + +   LD E     +  ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN  G  +  + A D+D  +NA I Y +  GP  +FF ++  +G +TA R  +REE+  +   + A +     L  +   V + V DENDN P+  +   +  + ENL  Y  +G I   D+D G N     S++N  E    D   +G + S ++FDRE +  Y  +++  D G P  RSST  + +N++D NDN+PV+               +   N   +++  S    PG  +A   A D D G NA++ +T+  ++ +N+   LF ID   G+I +    +   +G +++ +   D G
Sbjct:   26 LIYTIREELPENVPIGNIPKDL-NISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVIC-------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSG-KPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPL-QSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLD-PYSGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVV--------------ISPPSNTSFKLVPLSAI--PGSVVAEVFAVDIDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG 759          

HSP 2 Score: 124.405 bits (311), Expect = 4.634e-28
Identity = 137/497 (27.57%), Postives = 215/497 (43.26%), Query Frame = 1
Query: 1210 YEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV--PDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +E+ V     +F    KI+I V+D N++ P +     ++++ EN   N      +  D D +  NG ++  E L   ++  L  V  P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN  +G  V+Q+ A D D   NA+I+Y     +       F++N  +G IT  R LDREE   +++ +LA + S      A  TV I VTD NDN P I             YL +K  +  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   E+   I  +D G P S + T  + V + D+NDN P+ +                       +I+ SV EN   G  + T  A D D G+NA + + +         A  F +D   G +  SR+ +R+    +   + A D G   L+++
Sbjct:  111 FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNG-VQHYELLNGQSVFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPV--NTK----IALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL-------LETSSLLDYEGTKEFSFKIVASDSGKP-SLNQTALVRVKLEDENDNPPIFN---------------------QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL------GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ 555          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 250.751 bits (639), Expect = 1.415e-67
Identity = 219/778 (28.15%), Postives = 370/778 (47.56%), Query Frame = 1
Query:  334 LNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS----VLKTAKKIDLEILCPKFC-NDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L YTI+E  P  + +G I  D+  I +I+      +S  +    K     L + SS    +  T+ +ID E LC      ++   F  L V +   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  N    Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND  PVFK+G  E+ + EN  +G  +I+L ATD D   ++++ Y   +      +  FA+   TG + + ++LD E    +++ V A+DG  T + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +DVNG + C             F+     + L   YD    + +   LD E     +  ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN  G  +  + A D+D  +NA I Y +  GP  +FF ++  +G +TA R  +REE+  +   + A +     L  +   V + V DENDN P+  +   +  + ENL  Y  +G I   D+D G N     S++N  E    D   +G + S ++FDRE +  Y  +++  D G P  RSST  + +N++D NDN+PV+               +   N   +++  S    PG  +A   A D D G NA++ +T+  ++ +N+   LF ID   G+I +    +   +G +++ +   D G
Sbjct:   26 LIYTIREELPENVPIGNIPKDL-NISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVIC-------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSG-KPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPL-QSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLD-PYSGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVVI--------------SPPSNTSFKLVPLSAI--PGSVVAEVFAVDIDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG 759          

HSP 2 Score: 124.405 bits (311), Expect = 4.583e-28
Identity = 137/497 (27.57%), Postives = 215/497 (43.26%), Query Frame = 1
Query: 1210 YEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV--PDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            +E+ V     +F    KI+I V+D N++ P +     ++++ EN   N      +  D D +  NG ++  E L   ++  L  V  P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN  +G  V+Q+ A D D   NA+I+Y     +       F++N  +G IT  R LDREE   +++ +LA + S      A  TV I VTD NDN P I             YL +K  +  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   E+   I  +D G P S + T  + V + D+NDN P+ +                       +I+ SV EN   G  + T  A D D G+NA + + +         A  F +D   G +  SR+ +R+    +   + A D G   L+++
Sbjct:  111 FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNG-VQHYELLNGQSVFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPV--NTK----IALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL-------LETSSLLDYEGTKEFSFKIVASDSGKP-SLNQTALVRVKLEDENDNPPIFN---------------------QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL------GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ 555          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.869e-71
Identity = 227/791 (28.70%), Postives = 376/791 (47.53%), Query Frame = 1
Query:  307 IVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSI-LEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP-------EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            IVF       NYTI+E  P  + +G +  D+  + IP+  L   +     +   D       +    +  T  +ID E LC     D    F  + V V  +   R ++ ++ +I D NDN P+FP       I E    +     LP  ID D T IN    Y L K    F L +      +  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  +++ ++ F +  T  +I +K  LD E    +++ V A+DG  T + + + + V D+N++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  +S++ ++V D NDN PVF+ PF    + ENN+ G ++ ++ A D D   NA+I Y +  + P+  F+++  +G +TA+++LDRE++  Y   +LA +  +  L     TV + V D+NDN P         Y+P      ENL  +  +G I   D D+G N   + S++++ + D+    + G +   I+FDRE ++ Y   ++  D G  ISRSST  + +N++D NDN PV  V S+              N   E++  S   NPG  + T VA D D G NA++ ++M           LFIID+ +G+I +        +G +++ + A D G+
Sbjct:   17 IVFQSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPDRSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVVDAHC-FYEVEVAVLPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSRYALPATIDPD-TGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDA-DHNGWVSCFTDHEVPFRLRPVFSNQFLLETAAY-------------LDYESTREYAIKLLAADAG-KPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSE-FNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLM-TNATVLVTVLDQNDNSPVFTHNEYNFYVP------ENLPRHGTVGLITVTDPDYGENSAVILSILDAND-DFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGR-ISRSSTAKVTINVVDVNDNKPVFVVPSS--------------NYSFELVPPST--NPGTVVFTVVAIDNDTGMNAELRYSMV----GGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQ 758          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 9.414e-69
Identity = 230/807 (28.50%), Postives = 380/807 (47.09%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP-------EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            Y+   +L+    +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++ +V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P         Y+P      ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V  +              N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:    8 YIFAVLLA---CVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPN----KSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVG-INGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYNFYVP------ENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR-VSRSSSAKVTINVVDVNDNKPVFIVPPS--------------NYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 758          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.081e-68
Identity = 227/791 (28.70%), Postives = 376/791 (47.53%), Query Frame = 1
Query:  301 LSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            + +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++++V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P   +   K  + ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V                 N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:   47 VCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPN----KSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR-VSRSSSAKVTINVVDVNDNKPVFIV--------------PPYNYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 790          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.520e-68
Identity = 230/807 (28.50%), Postives = 380/807 (47.09%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP-------EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            Y+   +L+    +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++ +V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P         Y+P      ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V  +              N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:    8 YIFAVLLA---CVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPN----KSLTTAMQFKLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYNFYVP------ENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR-VSRSSSAKVTINVVDVNDNKPVFIVPPS--------------NYSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 758          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 2.705e-68
Identity = 230/807 (28.50%), Postives = 380/807 (47.09%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDR----QSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMK-TLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRC----QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP-------EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            Y+   +L+    +VF       NYTI+E  P  + +G +  D+  + IPN    K L ++  F    K     L R       +  T  +ID E LC     D+   F  + V +  +   R ++ ++ +I D NDN P+FP       I E    +     LP A+D DV  IN    Y+L K+ + F L +      D  P+L + K++D E K+ Y + +   + G  +  S   +++ + D ND  PVFK+   E+ + EN  +G  + +L ATD D  +++K+ +   +  ++I R  F +  T  +I +K  LD E    +++ V A+DG    + + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D NG + C    + P     +   +F+ + A Y             LD E      I L+  D G    L  ++++ ++V D NDN PVF+  F    I ENN+ G ++ +V A D D   NA+I Y +       FS++  +G +T +++LDRE++  Y   ILA +  +  L  +  TV + + D+NDN P         Y+P      ENL  +  +G I   D D+G+N     S+++  E D F +  + G +   I+FDRE ++ Y   ++  D G  +SRSS+  + +N++D NDN PV  V  +              N   E++  S   NPG  +   +A D D G NA+V +++           LF ID++ G+I +        +G +++ + A D G+
Sbjct:    8 YIFAVLLA---CVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPN----KSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-FYEVEVAILPDEIFR-LVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDA-DHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAY-------------LDYESTKEYAIKLLAADAG-KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL-TSNVTVFVSIIDQNDNSPVFTHNEYNFYVP------ENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR-VSRSSSAKVTINVVDVNDNKPVFIVPPS--------------NCSYELVLPST--NPGTVVFQVIAVDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ 758          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A075A251 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00457 PE=4 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 2.140e-138
Identity = 322/962 (33.47%), Postives = 497/962 (51.66%), Query Frame = 1
Query:  268 IYLIVWILSNSLSI---VFSRFEGNLNYTIQENHPSGIQVGFISSDITQIP---NIDLPKFLDSS----FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDD-GVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFP---MKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL-------NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY-------------LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPA----------------------EYPLTVKYDMFSRVQLDREEAPTRTIYL-ICHDG------------GLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFN-------------ATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET---------------DYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP-VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTME---DITDSNQIA--PL--FIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXXXXXXXXXXXGPKIQVT---------GN-----VLIVIILSTISAFLTALLIGAILCMIRPCCQSS 2790
            +YL+V + S S +I   + S  +  + Y I+EN P  +++G +  D+ Q P   N +L   L S+      +  R+ + YF L   +S L T   IDLE LCP+FC +      LNL V VW E +   VI+V++ I D +DN P FP    + +V ++KE++Y  GK +ELPKAIDKD+   N+ + Y+L       + A DTF L I  D+   L L KD+DYE    Y   L+A +   DE + +             LEI+++++++ND EPVF +  + + + E+TKIG ++  L+ATD+D +S + Y + +S      E F V+  G+VI+   LD E R  Y     A+DGEF + +++ I V DVN+ PP +  NP  L +EENQP    VGQ+ + D D+ +VNG + C EP   +  Q L F P+ +                      E+ +  ++ +++RV+ DRE    +   L IC DG             +  R TST  I L V D NDN P F    Y+A+++EN   G KV+QV A+D D + +A+ +Y +L     T+ F + P +GWI     +DRE +  YQL +LAI+  L    N             ATT V I++ D+NDN PE   P++  + EN    ++IG++   D+D G N    FS+ N + T                   L  NGSL++    DRE++  YC  + V D       SST  ICV +LD NDN P  +++    ++          ++L    +  +  E PG+    A A+D+D+G NA + +T++   D      ++  PL  F++D  +G + ++R +S + IG Y + ++  D G  SL++EK I I I+D PP+ + + P+ + +         GN     +L+VI LS +SAFL A+LI AILCMI+PC QS+
Sbjct:    6 MYLLV-LGSASQAISGDLLSAVQHRIRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLLQSTKRSTLKYRLREPSNYFRLHESTSELSTKVSIDLEALCPRFCREGLSAAQLNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPPTLSRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVIRNDSRVMLVLQKDLDYERVQQYRFYLVASSPVSDERRPFGYVLDPQSAFHDQLEIQVDVLNINDIEPVFSQSTYNIEIPEDTKIGTIVHVLQATDRDANSTIEYSLENSN-----ELFKVQADGKVIITNKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSSALPMSPGISLDGAIIDSSANPEHHVYQRFGLYTRVEFDRESDSNKHRSLIICTDGQDIPNSHASTSVAIQPR-TSTLTILLTVTDQNDNAPFFEKTHYEAELQENCPFGTKVVQVHANDADSETHAKPQYHLLRNALFTSPFDVEPETGWIITSADIDRETQALYQLTVLAIDGHLPRTNNRNGRTNFRGQQHTATTHVQIKIIDDNDNAPEFRGPRQFAVEENQVSSKWIGDLQVLDRDEGINRDVEFSMANFQSTIASEEQNKTFRVRSIAPIKLTNNGSLYTTEMLDREIQAHYCFEVVVKDKSPSKPLSSTDTICVRVLDLNDNTPKFVNIRGMSQDLSNRTDVKAFEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDTMKPESVSHTPLDAFMMDAQSGRLMLTRTLSGNEIGAYPLTLVVEDGGSPSLKSEKNIYIIIEDGPPRGNWLFPENERSVASSMSAKDGNNEAHTILVVIGLSGVSAFLAAVLISAILCMIKPCRQST 960          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A3R7CGZ3 (Protocadherin Fat 4 OS=Clonorchis sinensis OX=79923 GN=Fat4 PE=4 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 5.933e-138
Identity = 314/973 (32.27%), Postives = 499/973 (51.28%), Query Frame = 1
Query:  265 KIYLIVWILSNSLSIV----FSRFEGNLNYTIQENHPSGIQVGFISSDITQIP---NIDLPKFLDSS----FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDD-GVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFP---MKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL-------NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY-------------LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPA----------------------EYPLTVKYDMFSRVQLDREEAPTRTIYL-ICHDG------------GLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKAL-------------FNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFD---------------LKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP-VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTME---DITDSNQIA--PL--FIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXXXXXXXXXXXGPKIQVT---------GN-----VLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQVD 2817
            ++ + + +L ++  ++     S  +  + Y I+EN P  +++G +  D+ Q P   N +L   + S+      +  R+ + YF L   +S L T   IDLE LCP+FC D      LNL V VW E +   VI+V++ I D +DN P FP    + +V ++KE++Y  GK +ELPKAIDKD+   N+ + Y+L       + A DTF L    D+   L L KD+DYE    Y   L+A +   +E + +             LEI+++++++ND EPVF + ++ + + E+ KIG  +  L+ATD+D +S + Y + +S      + F V+  G+VIL+  LD E R  Y     A+DGEF + +++ I V DVN+ PP +  NP  L +EENQP    VGQ+ + D D+ +VNG + C EP   +  Q L F P+ +                      E+ +  ++ +++RV+ DRE    +   L IC DG             +  R TST  I L V D NDN P F    Y+A+++EN  +G KV+QV A+D D + +A+ +Y +L     T+ F +   +GWI     +DRE +  YQL +LAI+  L                  ATT V I++ D+NDN PE   P++  + EN  P ++IG++   D+D G N    FS+ N   T   +               L  NGSL++    DRE++  YC  + V D       SST  ICV +LD NDN P  +++    ++ +        ++L    +  +  E PG+    A A+D+D+G NA + +T++   D   +  +A  PL  F++D  +G + ++R +S + +G Y + ++  D G  SL++EK I I I+D PP+ + + P+ + +         GN     +L+VI LS +SAFL A+LI AILCMI+PC  S+   +  Q D
Sbjct:    3 RLLMYLLVLGSASQVISGDLLSAVQHRIRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLIQSTKRSTLKYRLREPSNYFRLHESTSELSTKVSIDLEALCPRFCRDGLSAAQLNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPPTISRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVTRNDSRVMLVLQKDLDYERVQQYRFYLVASSPVSEERRPFGYVLDPQSAFHDQLEIQVDVLNINDIEPVFSQSIYNVEIPEDAKIGTTVHVLQATDRDANSTIEYSLENSN-----DLFKVQADGKVILINKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSNALPMPPGISLDGAIIDSSANPEHHVYQRFGLYTRVEFDRESDSNKHRSLIICTDGQDILTSHTSTNVAIQPR-TSTLTILLTVTDQNDNAPFFEKTHYEAELQENCPVGTKVVQVHANDADSETHAKPQYHLLRNALFTSPFDVESETGWIITSADIDRETQALYQLTVLAIDGHLPGTNHRNGRSNFRGQQHTATTHVQIKILDDNDNAPEFRGPRQFAVEENQAPSKWIGDLQVLDRDEGINRDVEFSMANLPSTAASEEQNKTFRVRSVIPIKLTNNGSLYTTEVLDREIQAHYCFEVVVKDKSPSKPLSSTDTICVRVLDLNDNTPKFVNIRGMSQDLNNRTDAKAFEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDTMKTESVAHTPLDAFMMDAQSGRLMLTRTLSGNELGAYPLTLVVEDGGSPSLKSEKNIYIIIEDGPPRGNWLFPENERSIASSMSAKEGNNEAHTILVVIGLSGVSAFLAAVLISAILCMIKPCRHSTRRTNTIQAD 969          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A4S2KYT3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010451 PE=4 SV=1)

HSP 1 Score: 463.381 bits (1191), Expect = 7.907e-138
Identity = 314/975 (32.21%), Postives = 498/975 (51.08%), Query Frame = 1
Query:  265 KIYLIVWILSNSLSIV----FSRFEGNLNYTIQENHPSGIQVGFISSDITQIP---NIDLPKFLDSS----FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDD-GVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPM---KSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL-------NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY-------------LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPA----------------------EYPLTVKYDMFSRVQLDREEAPTRTIYL-ICHDG------------GLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKAL-------------FNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFD---------------LKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP-VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAP---------LFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXXXXXXXXXXXGPKIQVT---------GN-----VLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQVD 2817
            K+ + + +L ++  ++     S  +  + Y I+EN P  +++G +  D+ Q P   N +L   + S+      +  R+ + YF L   +S L T   IDLE LCP+FC +      LNL V VW E +   VI+V++ I D +DN P FP    + +V ++KE++Y  GK +ELPKAIDKD+   N+ + Y+L       + A DTF L    D+   L L KD+DYE    Y   L+A +   +E + +             LEI+++++++ND EPVF + L+ + + E+TKIG  +  L+ATD+D +S + Y + +S      + F V+  G+VIL   LD E R  Y     A+DGEF + +++ I V DVN+ PP +  NP  L +EENQP    VGQ+ + D D+ +VNG + C EP   +  Q L F P+ +                      E+ +  ++ +++R++ DRE    +   L IC DG             +  R TST  I L V D NDN P F    Y+A+++EN  +G KV+QV A+D D + +A+ +Y +L     T+ F +   +GWI     +DRE +  YQL +LAI+  L                  ATT V I++ D+NDN PE   P++  + EN  P ++IG++   D+D G N    FS+ N + T   +               L  NGSL++    DRE++  YC  + V D       SST  ICV +LD NDN P  +++    ++ +        ++L    +  +  E PG+    A A+D+D+G NA + +T++   D + + P          F++D  +G + ++R +S + IG Y + ++  D G  SL++EK I I I+D PP+ + + P+ + +         GN     +L+VI LS +SAFL A+LI AILCMI+PC  S+   +  Q D
Sbjct:    3 KLLMYLLVLGSASQLISGDLLSAVQHRIRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLIQSTKRSTLKYRLREPSNYFRLHESTSELSTKLSIDLEALCPRFCREGLSAAQLNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPSTLSRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVTRNDSRVMLVLQKDLDYERVQQYRFYLVASSPVSEERRPFGYVLGPQSAFHDQLEIQVDVLNINDIEPVFSQSLYTVEIPEDTKIGTTVHVLQATDRDANSTIEYSLENSN-----DLFQVQADGKVILTNKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSSALPMPPGISLDGAIIDSSANPEHHVYQRFGLYTRMEFDRESDSNKHRSLIICTDGQDVLTSHTSTTAAIQPR-TSTLTIMLTVTDQNDNAPFFEKTHYEAELQENCPVGTKVIQVHANDADSETHAKPQYHLLRNALFTSPFDVESETGWIITSADIDRETQALYQLTVLAIDGHLPRTNHRNGQTNFRGQQHTATTHVQIKILDDNDNAPEFRGPRQFAVEENQAPSKWIGDLQVLDRDEGINRDVEFSMANLQSTAASEEQNKTFRVRSIAPIKLTNNGSLYTTEVLDREVQAHYCFEVAVKDKSPSKPLSSTDTICVRVLDINDNTPKFVNIRGMSQDLNNRTDAKALEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIK--FDGDAMKPESVSHTPLDAFMMDTQSGRLMLTRTLSGNEIGAYPLTLVVEDGGIPSLKSEKDIYIIIEDGPPRGNWLFPESERSIASSVSAKDGNNEAHTILVVIGLSGVSAFLAAVLISAILCMIKPCRHSTRRTNTIQAD 969          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A0R3TLN6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8168 PE=4 SV=2)

HSP 1 Score: 457.603 bits (1176), Expect = 1.068e-135
Identity = 312/978 (31.90%), Postives = 506/978 (51.74%), Query Frame = 1
Query:  271 YLI--VWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSS-----FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFP---MKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTF------ELQISKDNTPRLRLTKDIDYETKNFYELTLIAWN-NGHDEL------KSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRET-FAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF-------VPDPAEYPLT----VKYDMFSRVQLDREEA-PTRTIYLICHD--------------------------GGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFN--------ATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFD-----------LKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHS-----TLKEQDQLESKN--------NSQNLGSEI----IKASVYENPGFKIATAVADDADKGENAQVTFTM---EDITDSNQIA----------------------PL--FIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKX----------------XXXXXXXXXXXXXXXGPKIQVTGNVLIVIILSTISAFLTALLIGAILCMIRP 2775
            YL+  V++LS S      + +  L+YT++EN   G +VG+++ D+ +   ++  +    +       +  R+ + Y  LD  +S+L T   +D E LC   C      FL++ VNVW++ ++  V++V+I + D +DN   FP    + FV ++KE++Y  GKTIELPKA DKD+T   S + Y+L  +S  +      EL ++ D+ P L L +D+DYE    Y  +L+A N + H  +      ++ + I ++++++ND EPVF + ++ + L E+ + G +I +L+A D+D D+ L Y  +++   +N+ T F V+  G+V L +  D E R  Y +P+ A+DGEFT+++++ I + DVN+  P++ +NP  LT+EENQPPN+LVGQ+ V+D D   VNG + C EP   S  Q L+F        P   +   T    +++D+++R  LDREE  P R   L+C D                          G +  RLTST  +++ + D NDN P+F+   + A++ EN++I  +++Q+ + D D +ENA  +YS+ +     + F +N  +G + A+ R DRE + NYQL ++A + S   L N        +T  VNI++ D ND+ P I    +L ++EN  P   +G++ + D D G NG+  F ++       F+           +  NGS+FS   FDRE++  YC  ++ ND     + SST  ICVNILD NDNAP+I  HS        E+D L  K         ++QN  +      ++ S  E PG+ + +  A D D+GENA++ + +    + T  N                         PL  F IDE  G + + R +S   IG Y + ++  D+G  SL++ ++                     +      S   P      N+LIVI+LST+SAFL A+LI AILCM+RP
Sbjct:    6 YLLPFVFLLSTSRG---EQLQFQLHYTVRENEHIGYRVGYLNDDLRRQQTLNFSRLCGDADGCKDLRYRLREPSTYLELDETTSMLTTKSIMDFEQLCTAQCRSTLDAFLSVTVNVWQDKKIIAVLHVRIQVIDIDDNNVEFPEDISRPFVLRLKEVIYRKGKTIELPKAEDKDITPKYSTISYRLEFSSSQWASMKMVELTVTNDSRPLLVLKEDLDYEEAKEYAFSLVASNPDIHSGVPKSISQEAKIPILVQVLNINDMEPVFSQSVYTVELPEDVQPGTVIFELKAIDRDADAVLTYS-INAVPGMNQSTPFDVEPDGKVRLQEAFDFEKRADYNLPIKASDGEFTASTRLHIRLLDVNDEAPTFIVNPTHLTVEENQPPNVLVGQVVVRDADTFAVNGYLECSEPTEDSERQPLRFERRVVPIQPQLQQESTTAVPELQFDLYTRQSLDREEGEPVRLARLVCWDGVGGGVGLGGASDYIYGGGSLTSSNSGRVSVRLTSTLTLSIHIQDRNDNAPIFTQSTFTAELLENSDIRKEIIQLTSKDYDTEENAVTRYSLTDDSEDASLFYLNEETGRLYAMTRFDRETRDNYQLQVVAYDVSQNPLENPGGDHQTVSTAVVNIKIIDINDHTPLIQEAGELALLENKDPGFLVGHLTATDLDDGPNGEVTFEIVPEDPRAVFNGPQLTQAIGFRMTPNGSIFSTRQFDREVQSRYCFQVQANDKSPDNALSSTARICVNILDVNDNAPII--HSIEGPDARYERDSLAQKPTFPGMEPYDTQNSLAAYDLPSLRISQNEAPGYCVLSMQATDLDEGENAELRYALNNGANCTPPNSSPSRFGHGIDEEKQENKEPEFRQFPLNTFRIDERTGKLLLVRRLSHKEIGTYCLGLVVEDQGHPSLKSTQMIELVVEDVPSRGNWLGSSGSGKGGLNGGSHTNPSRLEAKNILIVIVLSTVSAFLAAVLISAILCMVRP 977          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A0R3UI68 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7092 PE=4 SV=2)

HSP 1 Score: 451.825 bits (1161), Expect = 1.204e-133
Identity = 314/998 (31.46%), Postives = 497/998 (49.80%), Query Frame = 1
Query:  277 IVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSS-----FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPM---KSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFE------LQISKDNTPRLRLTKDIDYETKNFYELTLIAWN-----NGHDEL--KSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRET-FAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF--------VPDPAEYPLTVKYDMFSRVQLDREEA-PTRTIYLICHD----------------GGLHE---RLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILE--GPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKAL--------FNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINS-----------KETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHS-----------------TLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTM---EDITDSNQIAP----------------------------LFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT------------EKXXXXXXXXXXXXXXXXGPKIQV---TGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNY--QVDLNNSNGQTLLQKLPP 2862
            IV +LS S      + +  L YT++EN P G ++G++  D+ +   ++  +            F  R+ +  F LD  +++L T   ID E  C   C      FL + VNVW+E +L   I+V+I + D +DN   FP    + FV ++KE++Y  GK +ELP+A+DKDVT   S + Y+L  +S  +E      L ++ D+ P L L +D+DYE    Y  TL+AWN     +G   +  ++ L + I ++++ND EPVF + L+ + + E+ ++G +I++L+A D+D D+ L Y  ++S   +N  T F V+  G+V L K  D E    Y +P+ A+DGEFT+++++ I + DVN+  P + +NP  + +EENQ PNILVGQ+ V+D D   VNG++ C EP  + + Q L+F        V D A  P  + +D++++  LDRE+  P R   L+C D                G +     RLTST  +++ VLD NDN P+F+ P + A+++EN++I  ++LQ+ + D D  ENA  +Y + +     + F +N  +G + A+ R DRE +  Y L ++A + S   L          +T  V + + D ND+ P I    +L + EN +    +G++ + D D G NG+ VF L+              +   F +  NGS+FS   FDRE +  YC  +R  D     S SST  +CVN+LD NDN PVI  HS                 +    D  E+  +        I+ S+ E PG+      A D D+GENA++ +++    + T  N  AP                             F +DE  G + + R +S   +G Y ++++  D+G   L++             +   +        S   GP         N+LIVI+LST+SAFL A+LI AILCM+RP  +S   + N    V +N   G     KLPP
Sbjct:   14 IVSMLSMSSG---EQLQFQLQYTMRENEPIGHRLGYLDDDLRRQQAMNFSRLCGGGAGCKDLRFRLREPSSRFGLDEATAMLTTKSIIDFEEQCIGQCRSTLDAFLTVTVNVWQEKKLIAFIHVRIQVVDVDDNNVEFPADISRPFVLRLKEVIYRKGKAVELPRAVDKDVTPKYSAISYRLEFSSGQWESMKMVELSVTNDSRPLLVLKEDLDYEEVKEYGFTLVAWNPESQSDGPKAMAREAQLPVVIHVLNINDMEPVFLQSLYTVEVPEDMELGTVIMELKAIDRDADAVLTYS-INSAPGVNLSTPFEVEPDGKVRLRKACDFEKTTDYNLPIRASDGEFTASTRLHIRILDVNDEAPIFIVNPTHIAVEENQLPNILVGQVVVRDADTFAVNGNLECTEPSEEQDQQPLRFVRRSTSTGVSDSAVVP-ELHFDLYTKHTLDREDGPPVRLSRLVCWDRVVGSSDLIYAGEVGHGAVSSKVTRLTSTLTVSVHVLDRNDNAPIFTQPTFTAELEENSDIRKEILQLTSKDYDTDENAVTRYRLTDENEDASLFYLNEETGRLYAMARFDRETRDVYHLQVVAFDSSSSPLEIPGAGQGAVSTALVTVRIVDVNDHAPIIQETGELILPENKEAGFLVGHVTATDLDAGANGEVVFELVPEDPRVVFSSPQLTQVMGFRMTSNGSIFSTKEFDREAQSRYCFQVRAKDKSPDASLSSTARVCVNVLDVNDNPPVI--HSIEGPNARYERDSPVPNPSFPGPDSFETLYSLAIYDLPSIRISLNEAPGYCALLIQATDLDEGENAELRYSINLAANCTPPNPPAPGYGQNADGNYQEKAESEWLEQPRQFRQHTFRMDERTGKLLLVRRLSHKELGAYCLELVVEDQGHPRLKSTQLIELTVEDTPSRGSWLGSASGGKDSQNHGPYASSRLEAKNILIVIVLSTVSAFLAAVLISAILCMLRPFHKSRGRRGNMGRAVAVNGGGG----VKLPP 1000          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 263.462 bits (672), Expect = 1.563e-72
Identity = 225/811 (27.74%), Postives = 380/811 (46.86%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLD-RQSSVLKTAKKIDLEILCPKFCNDDGVG-FLNLVVNVWK--ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLN---KASDTFELQISKDNT---PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASL--------TLEENQPPNILVGQINVKDVDASD-------VNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            +L+  +L +S++       G + Y ++E  P    +G +++D        LP   DS   +       Y  +D +   +  T   ID E L  K C   G   FL   V+V    +NQ   +I  +I + D NDN P FP       ++E  + +G T  +P+A D+D TE N  + Y L+   +AS  F LQ++ D     P+L +  ++D E K+ Y+LT+ A + G     S   +++ I D ND  P F+K  +E  + EN+ +G  +++++A D D   + ++ Y +  +++ + +     + TG + +   LD E   +++  V A D      +S + + I V D N++ P+  +    L         + E+ P    V  + V D D  +       V GD+  Q  P G S++ + K            KY + +   LD E      + ++  D G +  L+ST+ + +QV D NDN P+FS P ++ +  E N  G+KVL V+A D D   NA++ YSI+   +    F I+P+SG + A   LDRE K  Y+  + A +K + +    T TV I+V D NDN P+  L      ++EN+ P   +G +   D D G N +   S +     ++      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPV++  S                  S   + S    P   +    A+D D G NA++ +++           LF I   +G IK+++ ++R   G +++ +   D+GK S
Sbjct:    8 FLLFALLVDSINSAL----GGILYHVREEQPPNTLIGSLAADQ------GLP---DSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETL--KDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAH-MGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKK------------KYFLQTTTPLDYERIRDYRVEIVAVDSG-NPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPS-HRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLS-VEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNAPVVTKPSN-----------------SSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIA----GGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 764          

HSP 2 Score: 95.1301 bits (235), Expect = 2.920e-19
Identity = 90/352 (25.57%), Postives = 164/352 (46.59%), Query Frame = 1
Query: 1615 LQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSG------WITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET--DYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVA----DDADKGENAQVTFTME-DITDSNQIAPLFIIDEDNGS---IKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            ++V D+NDN P F  P     ++EN ++G       A D+D + N  +KY +  GP  +  FS+   +        +  +  LDRE K +Y L I A++    + + ++  + + +TD NDN P+      + E+ EN      +  + + D D G NG+  +++  + +       ++R+  + S K   DRE    +  ++   D G P  +SST  + + + D NDNAP + +         +  + +S  +      A++ E+    + TAVA     D D+GENA VT  +  D+    Q+ P      DN     ++ +  +  + I DY+++I+A D G  +L +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRY-SSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKG-PSPKSSTTYVSIEVTDQNDNAPAVEIRG-------IGLRTHSDGV------ANISED--MPVGTAVALVQVSDKDEGENAVVTCVVAGDV--PFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSS 451          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 265.003 bits (676), Expect = 3.153e-72
Identity = 225/811 (27.74%), Postives = 380/811 (46.86%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLD-RQSSVLKTAKKIDLEILCPKFCNDDGVG-FLNLVVNVWK--ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLN---KASDTFELQISKDNT---PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASL--------TLEENQPPNILVGQINVKDVDASD-------VNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            +L+  +L +S++       G + Y ++E  P    +G +++D        LP   DS   +       Y  +D +   +  T   ID E L  K C   G   FL   V+V    +NQ   +I  +I + D NDN P FP       ++E  + +G T  +P+A D+D TE N  + Y L+   +AS  F LQ++ D     P+L +  ++D E K+ Y+LT+ A + G     S   +++ I D ND  P F+K  +E  + EN+ +G  +++++A D D   + ++ Y +  +++ + +     + TG + +   LD E   +++  V A D      +S + + I V D N++ P+  +    L         + E+ P    V  + V D D  +       V GD+  Q  P G S++ + K            KY + +   LD E      + ++  D G +  L+ST+ + +QV D NDN P+FS P ++ +  E N  G+KVL V+A D D   NA++ YSI+   +    F I+P+SG + A   LDRE K  Y+  + A +K + +    T TV I+V D NDN P+  L      ++EN+ P   +G +   D D G N +   S +     ++      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDNAPV++  S                  S   + S    P   +    A+D D G NA++ +++           LF I   +G IK+++ ++R   G +++ +   D+GK S
Sbjct:   44 FLLFALLVDSINSAL----GGILYHVREEQPPNTLIGSLAADQ------GLP---DSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETL--KDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAH-MGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKK------------KYFLQTTTPLDYERIRDYRVEIVAVDSG-NPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPS-HRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLS-VEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNAPVVTKPSN-----------------SSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIA----GGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 800          

HSP 2 Score: 95.9005 bits (237), Expect = 1.937e-19
Identity = 90/352 (25.57%), Postives = 164/352 (46.59%), Query Frame = 1
Query: 1615 LQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSG------WITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET--DYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVA----DDADKGENAQVTFTME-DITDSNQIAPLFIIDEDNGS---IKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            ++V D+NDN P F  P     ++EN ++G       A D+D + N  +KY +  GP  +  FS+   +        +  +  LDRE K +Y L I A++    + + ++  + + +TD NDN P+      + E+ EN      +  + + D D G NG+  +++  + +       ++R+  + S K   DRE    +  ++   D G P  +SST  + + + D NDNAP + +         +  + +S  +      A++ E+    + TAVA     D D+GENA VT  +  D+    Q+ P      DN     ++ +  +  + I DY+++I+A D G  +L +
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRY-SSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKG-PSPKSSTTYVSIEVTDQNDNAPAVEIRG-------IGLRTHSDGV------ANISED--MPVGTAVALVQVSDKDEGENAVVTCVVAGDVP--FQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSS 487          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 251.521 bits (641), Expect = 2.669e-68
Identity = 222/792 (28.03%), Postives = 378/792 (47.73%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            +++V IL+  +S+ +++ +   +YT++E  P  +++G + +D+     PNI L   L     +   D            +  TA +ID E LC    N+    F  + V V  +   R ++ ++ +I D NDN P+F        I E    +     +P A D DV  IN    Y+L K+   F L I      D  P+L + +++D ETK+ + + +   + G+    S   +++ + D+ND  PVFK    E+ + EN  +G  + +L ATD D   ++++ +   +  +   +  FA+   TG + + + LD E    +++ V A+DG  T S + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D+NG + C          D+ F   P       ++ + +   LD E      I ++  D G    L +++++ +++ D NDN PVF  P  +  I ENN+ G +++++ A D D   NA I YS+     + F+I+P SG ++  +RLDRE++  Y   ++A +     L  +  TV + V D+NDN P   +      + ENL  Y  +G I   D D G+N     S+IN K+    D K  G +   ITFDRE +  Y   ++  D G+ I  +S   + +N++D NDN PV  + S+          N S +L           NPG  +    A D D G NA++ +++  I  S +   LF ID+  G+I +   ++    G +++ +   D G+
Sbjct:   48 HVLVLILTCLVSLCWAQEK---DYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRC-FYEIEVAVLPDEIFR-LVKIRFLIEDINDNAPLFQSTVINISIPENT-AINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA-DLNGKVTCYTD------HDVPFRLKPV---FNDQFLLETAAPLDYETTREYAIKIVASDSG-KPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPL-QSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPK-TGVIKPNITFDREQQSSYTFVVKAVDSGL-IQTTSYAKVTINVVDVNDNRPVFVIPSS----------NYSYDL------VPFTTNPGSVVTRVFAIDNDTGMNAELQYSI--IGGSPR--GLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQ 798          

HSP 2 Score: 63.5438 bits (153), Expect = 1.327e-9
Identity = 86/349 (24.64%), Postives = 143/349 (40.97%), Query Frame = 1
Query: 1609 ITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF----FSINPNSGWITAI--RRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEI--MENLKPYQFIGNIISEDKDFGNNGKTVFSL---INSKETDYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQ--LESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVT-FTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            I   + D+NDN P+F        I EN  I ++     A D D   N    Y +++  + F            W   I  + LDRE K  + + I  +        ++T  + + V+D NDN P ++   ++E+   EN      +  + + D D G+N +  FS    I+     +F +  +  L + K   DRE    + L +  +D     SR++   + VN+ D NDN P I     +   +   L S+N   N                KIA     D D   N +VT +T  D+    ++ P+F    D   ++ +  +  +   +Y +KI+A D GK  L T
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKI-KVEDGGNPPKSSTAILQVTVSDVNDNRP-VFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRAT---VIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNT---------------KIALITVTDRDADLNGKVTCYTDHDV--PFRLKPVF---NDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNT 488          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 253.062 bits (645), Expect = 2.781e-68
Identity = 220/792 (27.78%), Postives = 379/792 (47.85%), Query Frame = 1
Query:  271 YLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDI--TQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            +++V IL+  +S+ +++ +   +YT++E  P  +++G + +D+     PNI L   L     +   D            +  TA +ID E LC    N+    F  + V V  +   R ++ ++ +I D NDN P+F        I E    +     +P A D DV  IN    Y+L K+   F L I      D  P+L + +++D ETK+ + + +   + G+    S   +++ + D+ND  PVFK    E+ + EN  +G  + +L ATD D   ++++ +   +  +   +  FA+   TG + + + LD E    +++ V A+DG  T S + + + V DVN++ PS    Y +NP   ++ L EN P N  +  I V D DA D+NG + C          D+ F   P       ++ + +   LD E      I ++  D G    L +++++ +++ D NDN PVF  P  +  I ENN+ G +++++ A D D   NA I YS+     + F+I+P SG ++  +RLDRE++  Y   ++A +     L  +  TV + V D+NDN P   +      + ENL  Y  +G I   D D G+N     S+IN K+    D K  G +   ITFDRE +  Y   ++  D G+ I  +S   + +N++D NDN PV  + S+              N   +++  +   NPG  +    A D D G NA++ +++  I  S +   LF ID+  G+I +   ++    G +++ +   D G+
Sbjct:   48 HVLVLILTCLVSLCWAQEK---DYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRC-FYEIEVAVLPDEIFR-LVKIRFLIEDINDNAPLFQSTVINISIPENT-AINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA-DLNGKVTCYTD------HDVPFRLKPV---FNDQFLLETAAPLDYETTREYAIKIVASDSG-KPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPL-QSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPK-TGVIKPNITFDREQQSSYTFVVKAVDSGL-IQTTSYAKVTINVVDVNDNRPVFVIPSS--------------NYSYDLVPFTT--NPGSVVTRVFAIDNDTGMNAELQYSI--IGGSPR--GLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQ 798          

HSP 2 Score: 63.929 bits (154), Expect = 1.098e-9
Identity = 84/347 (24.21%), Postives = 144/347 (41.50%), Query Frame = 1
Query: 1609 ITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF----FSINPNSGWITAI--RRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEI--MENLKPYQFIGNIISEDKDFGNNGKTVFSL---INSKETDYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVT-FTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            I   + D+NDN P+F        I EN  I ++     A D D   N    Y +++  + F            W   I  + LDRE K  + + I  +        ++T  + + V+D NDN P ++   ++E+   EN      +  + + D D G+N +  FS    I+     +F +  +  L + K   DRE    + L +  +D     SR++   + VN+ D NDN P I     +   +           G+ ++  +   N   KIA     D D   N +VT +T  D+    ++ P+F    D   ++ +  +  +   +Y +KI+A D GK  L T
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKI-KVEDGGNPPKSSTAILQVTVSDVNDNRP-VFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRAT---VIVNVTDVNDNVPSIDTRYIMNPVN-----------GTVLLSENAPLN--TKIALITVTDRDADLNGKVTCYTDHDV--PFRLKPVF---NDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNT 488          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 249.98 bits (637), Expect = 5.941e-68
Identity = 233/797 (29.23%), Postives = 366/797 (45.92%), Query Frame = 1
Query:  328 GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEIL--CPKFCNDDGVGFLNLVVNVWKENQLRG--VINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT---FELQISKDNT----PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSK--IRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASD-------VNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL--EGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
             ++ Y ++E  P    VG +++D        LP   D+   +       Y  +D ++  +  T   ID E L  C      D   FL   V++    +  G  +I  +I I D+NDN P FP       I E  Y VG    +P A+DKD    N    YKLN  SD    F LQ++ DNT    P+L +  ++D E ++ Y+L++   + G     S   ++I I D ND  P F++  +E  + ENT +G+ +++++A D D   + ++ Y     + ++ R       TG + +  ++D E     +  V A D G    +SK  + I V+D N++ PS  +    L         + E+ P    V  + V D D  +       V GD+  Q  L  ++  D              KY + +   LD E      I ++  D G +  L+ST+ + +QV D+NDN PVFS   Y+    E N  GDKVL VVA D D   NA++ YSI+        F INPN+G +  + +LDRE K  Y+  + A +K + +L   T TV + V D NDN P+  L      ++EN+ P   +G +   D D G N     S+    E   F ++   G++ S I+FDRE +  Y   ++  D G P  RSS   I +N+LD+NDNAP ++  S           N+S      +       +P  ++    A+D D G NA++ ++   IT  N    LF I   +G I +++  +R   G +++ +   DKGK S  T
Sbjct:   33 ASITYQLREEQPPNTLVGSLAADQ------GLP---DTGHLYKLEVGGPYLRVDGKTGDIYTTDVPIDRETLKDCRNLFEGDPC-FLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTY-VGAHYSIPVAMDKDAGS-NGIADYKLNSGSDAMNLFSLQVA-DNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQ--LRSASASDSTS---------KRKYFLQTTTPLDYERIKEYRIEIVAVDSG-NPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSL-KGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSV--EPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPS-----------NSSYKFLQPLT------SPDTRVEKVDAEDIDTGLNAELVYS---ITGGNPHG-LFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHT 779          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 199.904 bits (507), Expect = 1.333e-52
Identity = 182/643 (28.30%), Postives = 290/643 (45.10%), Query Frame = 1
Query:  490 RQSSVLKTAKKIDLEILCPKF-----CNDD-GVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL----NKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDS--KLVYGMVSSTNSIN-----RETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATD-------------------GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQ--EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKAL-FNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI 2280
            R   +    +K+D E LC        C+ D  VG L +     +      +I V+I + D NDN P F        + E     GK   +  A D D +E N    Y+L          FEL +++    +  P L + K +D E +  YE+ L A + G         ++I + D ND  PVF +    + + EN+ +G  +++L A+D+D  S  ++VY + +ST         +  F + + +G V +   L+ E    Y I + ATD                    + +   +IR  V  VN            + + E    N+ V  I V D D    NG + C    P     L+ L +   P +Y L       +R  LD E      + +   D G    L+ T  +T+++LD NDN PVF+ P YK  + ENN IG  ++ V A D+D  +NA++ Y +       F ++P +G I+   +LDRE+K NY   ILA ++ +  L  NAT  VN  V D NDN P   L +    + EN+  +  +G +   D D G NG+   S++ +     F +   +G + S + FDRE +  Y L ++  D G P+ RSST  + ++++D NDN+P++
Sbjct:   91 RTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPV-----QPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENA-PAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVN----------GVIYISEASHVNLPVALITVSDPDIG-ANGAVTCYIYNPEVPFQLKKLTY---PNQYLLE------TRETLDYETKNEYVVQIKAADAGA-TSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVN--VLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPV-RSSTVKVVIHVMDINDNSPIV 702          

HSP 2 Score: 130.568 bits (327), Expect = 6.987e-31
Identity = 123/448 (27.46%), Postives = 209/448 (46.65%), Query Frame = 1
Query:  667 PMFPMKSFVKKIKEILY-GVGKTIELPKAI----DKDVTEINSRVLYKLNKASDTFELQ-ISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIP----FYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNV 1959
            P   ++  V  +  ++Y      + LP A+    D D+    +   Y  N     F+L+ ++  N   L   + +DYETKN Y + + A + G   L   + + I+++D ND  PVF +  +++ + EN  IGK +I + ATD+D  K++++VY +     ++    F +  ETG + L + LD E +  Y   + A D        N+ + + V DVN++ P ++L      + EN P +  VG + V D D  + NG +R    LG  N Q     P+           + S V  DRE+     + +   DGG   R +ST  + + V+D+NDN P+  +P     YK  +      G  V +V A D D + NA+++Y I+ G P N F I+P  G IT +  L       ++L +   +  +    +A   V++ V +  +N 
Sbjct:  378 PTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEV-PFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTM----FHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGE-NGRVRLSI-LGTDNRQLFSIDPESGM--------IRSNVGFDREQRHYYVLEVQATDGGEPVR-SSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLP-GTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENA 808          

HSP 3 Score: 107.457 bits (267), Expect = 8.825e-24
Identity = 146/575 (25.39%), Postives = 247/575 (42.96%), Query Frame = 1
Query:  949 LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLV--YGMVSS-TNSINRETFAVKET--GE----VILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFS-RVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNP---------PVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL--EGPTNFFSIN-PNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            +E++I + D+ND  P F   +  + + EN   GK      A D D ++  V  Y ++ S   +++    +V ET  GE    +++ K+LD E RQ YE+ + A DG     + ++ +RI V D N++ P ++    ++ + EN P    V Q++  D DA   N ++  +  LG S             + L     + +    L+REE+P   I ++  D G      + +V        +++P         PV  + +    I E +++   V  +   D D   N  +   I   E P     +  PN   +     LD E K  Y + I A +    +L + T +V I++ D NDN P    P  K+ + EN    + +  + + D+D   N + V+ L     T +      G +      DRE K  Y   I   D G+P+   +   + VN+LD NDN P  S    L E D   ++N        + K S        +      D+D+GEN +V  ++   TD+ Q   LF ID ++G I+ +    R+    Y +++ A D G+
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGS-NAEVVYR--LGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIY----ISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSL-SRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNAT-VIVNVLDVNDNRPRFS----LAEFDFYVNEN--------VPKHST-------VGMVTVADSDEGENGRVRLSILG-TDNRQ---LFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGE 679          

HSP 4 Score: 107.071 bits (266), Expect = 1.296e-23
Identity = 130/483 (26.92%), Postives = 204/483 (42.24%), Query Frame = 1
Query: 1237 GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQE--PLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT---------NFFSINPNSGWITAIRRLDREEKINYQLAILAINKS-----------LKALFNATTTVNIEVTDENDNV-PEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR----NGSLF-SKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFTMEDITDSNQIAP-LFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            G F    ++RI V D+N++ P++     ++++ EN P           D D S+ NG +R  E  P   + +   +           V Y +  R  LDREE     + L   DGG     + ++V+ + V D NDN PVF       +I EN+ +G  V+Q+ A D+D   NA++ Y +                F ++ NSG +T    L+REE   Y++ ILA +K            +        +  IE+ D    V   IY+ +   +  NL     +  I   D D G NG     + N +    F LK+    N  L  ++ T D E K+EY + I+  D G   S S T  + + +LD NDNAPV +                         K SV EN   G  + T  A D D  +NA++ + +         AP +F +D + G I ++  + R+   +Y   I+A D+G
Sbjct:  131 GPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPD-SEANG-VRRYELLPSDPATVSAFELSVTETANGEKVPY-LVVRKSLDREERQLYEMNLRAVDGGSPPH-SGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHV--NLP----VALITVSDPDIGANGAVTCYIYNPEVP--FQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGA-TSLSRTMSVTIKLLDSNDNAPVFT---------------------EPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFL------GPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQG 573          

HSP 5 Score: 95.5153 bits (236), Expect = 3.980e-20
Identity = 102/383 (26.63%), Postives = 178/383 (46.48%), Query Frame = 1
Query: 1180 KTLDVEFRQTYEIPVYATDGEFTSNSK---IRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV-PD-PAEYPLTVKYDMFSRV-QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN--FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISE----DKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYC----LNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI 2280
            +TLD E +  Y + + A D   TS S+   + I + D N++ P +       T + + P N ++G+ ++  V A+D + D          N + + F+ PD P  + +  +  + S   QLDRE+    +  ++  D G+   L   + + + VLDVNDN P FS+  +   + EN      V  V   D D+ EN +++ SIL G  N   FSI+P SG I +    DRE++  Y L + A +   + + ++T  V I V D NDN P + +P      + + P    G I++E    D D   N +  + ++     + F +     +   IT    L + +     L +RV+D+G+ +   +   + V + +  +NA  I
Sbjct:  449 ETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFT----EPTYKVSVPENNVIGK-HLITVSATDRDMD---------KNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGI-PVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSIL-GTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGG-EPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHID---PVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYI 811          

HSP 6 Score: 75.0998 bits (183), Expect = 7.202e-14
Identity = 75/278 (26.98%), Postives = 134/278 (48.20%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT-FELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMV--SSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQP---PNILVGQINVKDVDASDVNGDIR 1416
            L   ++V I + D NDN P+F   ++   + E    +GK +    A D+D+ + N+ ++Y L   + T F +      T  + LT+ +D E K  Y  T++A + G   L+    + + ++D+ND  P F    F+  ++EN      +  +   D D+      G V  S   + NR+ F++  E+G +      D E R  Y + V ATDG     +S  K+ I V D+N++ P   + P++ T +   P   P  +V +++  D DA ++N ++R
Sbjct:  473 LSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNV-IGKHLITVSATDRDMDK-NAEMVYFLGPDAPTMFHMD---PETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGEN---GRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDA-EINAELR 741          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 3.516e-49
Identity = 202/787 (25.67%), Postives = 354/787 (44.98%), Query Frame = 1
Query:  244 H*SKRNMKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVE--FRQ----TYEIPVYATDG----EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINS-KETDYFDL-KRNGSLFSKITFDRELKDE-YCLNIRVNDLGVPIS--RSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRD 2547
            H   R+  I  I    +      F+R   + ++ + EN   G  VG +S+       +DL    + ++     D+   F+++     + TA  ID E             F  L V V     + G  +V +++HD N++ P+F   S+   I E    V       +A DKD  + N  V Y++ + +   +  I  D   +L +  ++D ET+  Y LT+ A + G + L S + + + ++D+ND +P+F    +     E  ++G L+  ++ATD D  S    G V+ +    +  F +  ETG +  ++  D E   RQ    ++   V ATDG         + +++FV+DVN++PP +  +    ++ E+      + ++   DVD   VNG +R    + + N +  KF  D +   +T+         LDREE  + T+ +   D G    L ++  + +QVLD NDNPP F+         E+  +G+ ++ + A D+D   +  ++Y+I+ G T+  F+I+ ++G +   RRLD E +  Y+L + A +       +AT  V + V D NDN P  +LP  +   IMEN+     +  + + D D   NG+  +S+        +F +   +G + +    DRE+    + + +R  D  +P+   RS+ K + V + D+NDNAP   V  T    D L +                    G  + T  A D D+ ENA V + +         A LF +D   G I+ S  + R+
Sbjct:  635 HLRARSPAIVTITVADAQDTPPTFAR--DDYSFVVFENVAPGTLVGSVSAS-----TLDLNA--NVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQA----------FYQLRV-VANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAED-EPVNSRFFSVRATDKDSGK-NGEVKYEIGEGNGGEKFGIFPDG--QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSN---GGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEG-VNGALRYA--INEGN-EGGKFTVDASTGQITLLG------SLDREETASYTLVVSATDSGTSP-LAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILV-VHVRDFNDN-PPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRF-VTPTAILVDGLRAAA------------------GSVVGTLQASDPDEAENAAVRYAVT----GGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 2 Score: 182.956 bits (463), Expect = 1.012e-46
Identity = 177/675 (26.22%), Postives = 310/675 (45.93%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKE-ILYGVGKTIELPKAIDKDVTEINSRVLYKL--NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDI--RCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREE-APTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP---EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN-P-GFKIATAVADDADKGENAQVTFTMEDITDSNQIAP--LFIIDEDNGSIKISRIMSRDVIGD-YKMKIIACDKG 2592
            V I + D  D  P F    +   + E +  G      L  ++     ++N+ V Y +       +F ++ S     R+     ID E + FY+L ++A + G   +     + + + D+N+  PVF +  +E+ + E+  +      + ATDKD  K+ ++ Y +         E F +   G++ +   LD E R+ Y + V A D      +S+  + + V DVN++ P +N +       E Q    LVG +   D DA   NG +    ++P        + F  D +E        +F R  L R+  A + +  ++  DGG  + L   + + + V DVNDNPP F+   Y+A + E+ +   ++L+V A D D+  N  ++Y+I EG     F+++ ++G IT +  LDREE  +Y L + A +     L  A+ TV ++V DENDN P   E  L   ++ +E+ +  + +  + + D+D G +G   ++++       F + R+ GS+F     D E +  Y LN+   D G P  RSS   + V++ D NDN P                      L  ++  AS+ EN P G ++ T  A D D   N ++ +++     + Q  P   F ID ++G I  +  + R+V G  +++ + A DK 
Sbjct:  644 VTITVADAQDTPPTFARDDYSFVVFENVAPGT-----LVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGG---RIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGG---EKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGS-NGGVTYSFEKP-------QVNFELD-SETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPL-AASCTVAVQVLDENDNPPRFTESLL--SVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRP-PRSSATILVVHVRDFNDNPPAF--------------------LPGDVF-ASIMENIPIGTRVITVTARDPDADVNGELHYSI-----ARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKA 1265          

HSP 3 Score: 167.548 bits (423), Expect = 6.205e-42
Identity = 144/573 (25.13%), Postives = 254/573 (44.33%), Query Frame = 1
Query:  937 LKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPN-----ILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLK--ALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKIT----------FDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            + S+ +++I + D+ND  PVF     EL ++ENT  G++I  L ATD D  +++ + Y ++S +       F V   +G +   + LD E R +Y + V A+DG   +++++ + VRD N++ P ++ +  S  + E+  P+      ++G +   D D+           P   S+  D  F   P    L V         LDRE      +     DGG    L +T+ + + VLD NDN P        A++ E+   G  +L++ A D D+  NA++++SI  G P   F++  N G ++  R LDRE +  Y L +   +++    A  ++   V++ +TD NDN P    P+     E+      +  + + D D G N    ++L    E            F+  T           DRE +  Y L +   D G P   +ST  + V + D NDNAP          ++   +    +  G+E+++ S +             D D+G N ++ +   DI   +     F +D   G++ ++R + R+    Y++ + A D G
Sbjct: 1496 MSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEG----AFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTR------PLDRESRACYVLRARATDGG---GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRP-PLTSTATLAVTVGDANDNAP------RFPRREYEAAIAEDEPPGTEVLRLSAW-------------DPDEGANGELRY---DIASGDPTGD-FRLDPVLGTLAVARPLDRERTASYELAVRARDGG 2030          

HSP 4 Score: 166.007 bits (419), Expect = 1.767e-41
Identity = 179/686 (26.09%), Postives = 295/686 (43.00%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTE--INSRVLYKLNKASDTFELQISKDNTPR----LRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV---KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYN---LNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPD-PAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEI-MENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKIT----FDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            V++V+ D NDN P FP    ++   +    VG+ + L  A+D+DV    +N    YK+   ++   L   +  T R    L  T  +D E    Y L + A + G       L++ + + D ND  P F+K  +   + E++ +G  +  L          L  G         R   AV    +TG V   + LD E R+ Y + + A DG     +  +   I + DVN++ P+     L PA  S +++E+  P  +   + V D D+   NG++      G      +   P  P    L V        QLDRE  P   + ++  D G     ++T+ + + V DVND+ P F++  Y A + E    G  V  V A D D   NA+++YSI+ G    +FS++ ++G +T   ++DRE   +  L I A ++  +    A T++ + + D ND  P     K +   +EN  P  F+ ++ + D D G NG   ++        Y ++ R  SL  K+T     DRE  +EY L ++  D G P   S+ K + V + D NDN PV                            AS+ EN   G  + T  A D D+G N  V + +     +   A  F ++   G++     + R+    Y++++ A D G    R+
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHA-YKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDL----------LHRG---------RGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVAS------QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPK-TAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAK-VTVVVGDLNDNHPVFYPVQYF---------------------ASILENEPGGTAVTTVTATDPDRGANGTVRYQL-----TAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARS 640          

HSP 5 Score: 153.68 bits (387), Expect = 1.119e-37
Identity = 151/618 (24.43%), Postives = 269/618 (43.53%), Query Frame = 1
Query:  448 YFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGV-INVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKT----IELPKAIDKDVTEINSRVLYKLNKASDT------FELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD------GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAE-----------YPL-TVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLK-PYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVND 2199
            Y         F +D  S VL+ ++++D E               + ++ V   +        + + + D NDN P F   ++   + E     GKT    I    A D D       V Y L  + D+      F L      T  L +T+ +D E++  Y L   A + G   L +   + + ++D ND  P  +       + E+   G  ++++ ATD D+  +++L +  +SS +   R  FAV   G++ + + LD E +  Y + V  +D         +S  ++ + + DVN++ P++  +P S    E+ P   +V  +   D D+             G+++  +     D  E           + L TV  ++    +LDRE   +  + ++  D G    LTST+ + + V D NDN P F    Y+A I E+   G +VL++ A D D+  N +++Y I  G PT  F ++P  G +   R LDRE   +Y+LA+ A +    A  + T +V + ++D ND  P   L P  +   EN + P   I  +++ D D G++G+  ++     +   F +  +G +    + DRE + ++ L I   D
Sbjct: 1553 YSVLSGSEGAFVVDAASGVLRASRRLDREERA------------SYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFG-EVTYALAPSEDSDWADGAFGLHPV---TGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFS-ISSGDPEGR--FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDS-------------GRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKG-RPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSD-TASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 6 Score: 153.295 bits (386), Expect = 1.431e-37
Identity = 175/682 (25.66%), Postives = 294/682 (43.11%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFEL-VLDENTKIGK----LIIKLEATDKDKD--SKLVYGMVSSTNSINRE-TFAVKE-TGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGD----IRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLH--ERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL----------EGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK---LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACD 2586
            V+I + D NDN P+F +     +++E   G G+ I    A D D  + N+ V Y +   S+   +  +      LR ++ +D E +  Y LT+ A +  H    +   + + + D ND  P F +  +   V ++    GK    +I  + A D D     ++ Y +  S +S   +  F +   TG + + + LD E R  Y +   ATD G   + +++ + V D N++ PS   +  +  + E+ PP   + +I+  D D   VN +    I   +P G+  + +        +  L+V         LDRE      + +   D   H   RL+S   ++L + DVNDN P F+ P   A   E++ +G  V  V A D D   N+ ++Y++                 F++N  +G +  +R LDRE + +Y L +LA++K    L  +T T+ + V D NDN P    P++     I E+  P   +  + + D D G NG+  + + +   T  F L    G+L      DRE    Y L +R  D G P +RS T  + V + D ND +P   +         + ++ N+Q              P   I   VA D D G + QVT+      D       F +  D G + + R + R+    + + I A D
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENT-GEGEVIFTLSATDADQGQ-NALVTYSVLSGSEGAFVVDAASGV--LRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATD-DDEGVNAELEFSISSGDPEGRFAVGN--------DGQLSVAR------ALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPL-TSTATLAVTVGDANDNAPR--FPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGP-ARSDTASVRVTLSDVNDCSPAFQLSPY-----TVHARENTQ-------------GPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGA----FSVSPD-GHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 7 Score: 135.576 bits (340), Expect = 3.145e-32
Identity = 174/691 (25.18%), Postives = 282/691 (40.81%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPM-----FPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTK---DIDYETKNFYELTLIAWNNGHDELKSY-LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPD-PAEYPLTVKYDMFSRV-----QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKS-LKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGS-LFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI---SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            L G     I + D NDN P       P  +    + E     G    L    D D    N  +   +   ++     +     P LR+ K    +D E    Y LT++A +NG    +S    + + + D+ND  P F    +   L E    G  +  + A D D   ++KL Y +VS  N +    F+V E TG V     +D E   +  + + A D      T+ + + + + DVN+ PP +       T  EN  P + V  ++  D D  + NG +R              F PD PA+Y    + D  +        LDREE     + +   D G    L ST+ +T+ V D+NDN PVF    Y A I EN   G  V  V A D D   N  ++Y +  G    F +N  +G ++    LDREE+  YQL + A++   L+A   +   V I V D  D  P          + EN+ P   +G++ +   D   N    + +++  +   F ++ +G  +F+    DRE +  Y L +  N  GV    +    + V + D N++APV    S   ++ E + + S+  S       ++A+               D D G+N +V +   +I + N      I  +  G + +   + R+   +Y + + A D G   L
Sbjct:  205 LSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESA-APGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSG-NDLG--WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGE-NGTVR------------YNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRG-SPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRA--RSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV----AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFS-------VRAT---------------DKDSGKNGEVKY---EIGEGNGGEKFGIFPD--GQLYVRYELDRETREEYSLTVSAMDTGVEPL 842          

HSP 8 Score: 134.806 bits (338), Expect = 6.462e-32
Identity = 99/347 (28.53%), Postives = 170/347 (48.99%), Query Frame = 1
Query: 1591 LTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNAT-TTVNIEVTDENDNVPEIYLPK-KLEIMENLKP-----YQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-----RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            ++S + + + V DVNDNPPVF++P  + +++EN   G+ +  + A D D  +NA + YS+L G    F ++  SG + A RRLDREE+ +Y L + A + +     +AT   +++ V D NDN P         ++ E+  P        IG +++ D D G  G+  ++L  S+++D+ D         G+L      DRE +  Y L  R  D G     ++T  + VN+LD NDNAP +              +N+S  L +E+ + +    PG  +    A D D+G NA++ F++     S      F +  D G + ++R + R+    Y + +   D+ +
Sbjct: 1496 MSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGT-----HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG---GLAATARLYVNVLDANDNAPSV--------------QNDS--LAAEVPEDA---PPGTSLLRISATDDDEGVNAELEFSIS----SGDPEGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRAR 1810          

HSP 9 Score: 129.798 bits (325), Expect = 2.212e-30
Identity = 164/681 (24.08%), Postives = 276/681 (40.53%), Query Frame = 1
Query:  619 GVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKD-NTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFK-----KGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETG-----EVILMKTLDVEFRQTYEIPVYATDG----EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLK-FVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSI-LEGPTNF---FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            G + V + + D NDN P F   ++   + E               D  V      +L++         L +  D  T  +   + +D+E +  Y L+L A + G+  L       I+++D+ND +P  +            +DE+   G +   +  TD D  +      VS      R  F +   G      + +   LD E    Y + + A+D       ++ + + ++V DVN+H P + L+  +  L E  P    V  +   D D S +N  +R     G     DL  F  D +   +T         ++DRE A +  + +   D G   +   TS +T+ +LDVND PP+F+   Y A   EN+  G  V+ V A D D  EN  ++Y+   + P  +   F ++  +G +T ++ LDREE   Y L + A ++    L  +T  V + V D NDN P  Y  +    I+EN      +  + + D D G NG   + L       +      G++ ++++ DRE +  Y L +   D G   +RS    + + + D  D  P      T    D                   V+EN  PG  + +  A   D   NA VT+    I   +Q    F I+   G I  +  + R+    Y+++++A   G
Sbjct:  118 GRLQVNVTVQDANDNPPAFEKPAYRASVAE---------------DSPVGAALRDLLHRGRG-----PLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDAD-SGLNAKLRYSIVSGN----DLGWFSVDESTGLVTTDG------KVDREVASSVVLNISAQDQGAQPKTAYTS-LTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPL-GSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPP------TFARDD---------------YSFVVFENVAPGTLVGSVSASTLDL--NANVTYL---IVSGDQRGS-FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG 737          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 1.612e-48
Identity = 177/660 (26.82%), Postives = 307/660 (46.52%), Query Frame = 1
Query:  385 ISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFC----NDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL---NKASDTFELQISKDNTPRLRLTKDIDYET--KNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRET-FAV-KETGEVILMKTLDVEFRQTYEIPVYATDG-----EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMF--SRVQLDREE------APTRTIYLICHD-GGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPIS-RSSTKPICVNILDDNDNAPV 2277
            + + + Q+   DL   +     + F D ++ F+LD  S ++  A  +D E   P+F       DG G         +E   R    V+I + D NDN P+F   S+V   +E    +   + + +A D+D +  N+++ Y +   +  S  F + +S      + L + +DYE        LT++A + G   L S +   +E+ D ND  P+F +  + + + EN   G  ++ + ATD D+  +  YG +S   S+   T F +   +G++     LD E    Y + V A DG     + T  + + I + DVN++ P++   P ++T+ EN P    +  ++  D D ++    +   +P            P+P  Y +         + +QLDRE+      A  R+I +   D G    R T+++ +T+ + DVNDN P F    Y  Q+ E       + QV A D D+  N  + YS+    P   F ++  +G IT + +LDRE    YQL ++A ++   AL ++TTT+++ V D NDN P  +  +  + +ME++     + ++   D D G N +  F +    +   F +  R+G + + ++ DRE K  Y L I   D G   S R+ T  + V +LD NDN P+
Sbjct:   45 LGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGLISVAAALDFEA-TPRFTVTVMARDGGG---------QETAGR----VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRV-RATDED-SPPNNQITYSILPTSAYSSYFSITVSG-GYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPE--YGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP------------PNPF-YRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPAL-SSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPL 671          

HSP 2 Score: 157.918 bits (398), Expect = 5.757e-39
Identity = 177/683 (25.92%), Postives = 296/683 (43.34%), Query Frame = 1
Query:  619 GVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKET-GEVILMKTLDVEF--RQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKY-DMFSRVQLDREEAPTRTIYLICHDGG-LHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWI-TAIRRLDREEKINYQLAIL-------AINKSLKALFNATTTVNIEVTDENDNVPE-IYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            G   V I + ++NDN P+F +  +   + E    +G ++    A D D   +  +V Y  +  SD F L  +      + +   +D+E    + +T++A + G  E      ++I ++D+ND  PVF++  +     EN      ++++ ATD+D   ++++ Y ++ ++   +  +  V    G V L + LD E     T  + + A DG      S     + V D N++ P ++ N  S+ + EN      V  +N  D D S   G +     L  S            ++ +  +  D+ S   LDRE      + +   DGG  +++ T  + + + +LDVNDN P +    Y   I EN   G  +  V A D D  EN  + Y+I + P  F+ IN  SG I T   +LDRE+      A +       A   S      A+ TV + + D NDN P  + LP  L+++E L     +  + + D D G NG   +S+  +     F L    G + + +  DRE    Y L +   D G P + SST  + + +LD NDNAP  + H        +ES          + + SV       + +    DAD G NA+++F    IT  NQ    F +   +G ++    + R+    Y + I A D G +  R
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENAT-LGTSVVQVLATDLDA-GVFGQVSYHFSDDSDKFSLDPASG---LISVAAALDFEATPRFTVTVMARDGGGQETAG--RVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGST-----------QFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI-DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTP-ALSSTTTLSLVVLDVNDNAP--TFHPARSAVSLMES----------VARDSV-------VISLNCTDADSGLNAELSFF---ITGGNQDGQ-FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSR 651          

HSP 3 Score: 135.191 bits (339), Expect = 4.813e-32
Identity = 144/545 (26.42%), Postives = 245/545 (44.95%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRV--LYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIA--WNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGM--VSSTNSINRETFAVKETGEVILMKTLD-VEFRQTYEIPVYATDG-----EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILAI-NKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIM--ENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSK--ITFDRELKDEYCLNI 2187
            L   +   + + D+NDN P+F   S+   I E +   G T+    A D D +    ++  +Y L + S  F +     +   +  T  +D E  + Y L + A    +G+D+      + I ++D+ND +P ++   + + + ENT  G  I  + A D D  ++  LVY +   +    IN  +  ++ TG  +  + L+ + F     I V   D        T+++ + + ++DVN++ PS+   P +L + E  P N  + Q+   D D    NG++        + L    F  D A   +T      + VQLDRE      + L+  D G    L+ST+ ++L VLDVNDN P F        + E+      V+ +   D D   NA++ + I  G  +  FS+    G +  +  LDRE K +Y L I AI N    +    TTT+++ V D NDN P ++L    E+   EN+     I  + + D D G NG+  + +I+  +   F +  +  L S+     DRE    + L +
Sbjct:  221 LNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILA-GATVLYVNATDGDQSPEYGQLSLIYSL-EGSTQFRINARSGD---ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEG-ANGNVTYSM---TAALPRPDFQLDAATGLIT------TLVQLDREAVAAYQLRLVATDRGT-PALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRP-LFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQV 748          

HSP 4 Score: 130.954 bits (328), Expect = 9.149e-31
Identity = 185/774 (23.90%), Postives = 312/774 (40.31%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKE-----NQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQIS-KDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSI---NRETFAVKETGEVILMKTLD----VEFRQTYEI------PVYATDGEFTSNSKIRIF-VRDVNNHPPSYNLNPASLTLEENQPPN----ILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYL--ICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENN-NIGDKVLQVVAHDKDDK--ENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDN---------------------------VPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL--KRNGSLFSKITFDRELKDEYCLNIRVNDLGV--PISRSSTKP---ICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFI-IDEDNGSIKISRIMSRDVIGDYK----MKIIACDKGK 2595
            F +D  + VL   K +D E+           G   LVV    +      +L     V + + D ND  P F ++S+   I       G  I    A D+D + +N  + Y +       E  IS  D   R+R   ++D ET+ FY LT++A + G   L S L + + ++D++D +PVF        L E   +  ++ ++ A+D ++       +  S  S     R  +A  +TG V + + LD     E+R T  +      P YA       +S I I  + D N++ P ++       + EN P      +L G I   D D   VN  +     LG S+     F+ D     +++         LDRE  P   + L  +  DGG   R  +T  + + VLDVNDN P F++    A + EN+  +G  V+ V A D+D    +   ++YSI  G  + F I+ ++G I  +  +D E +  Y L ++A +++      A+  + + + +E D                             P++  P KL +     P   +     EDK               +E+D  +L     G + ++   DRE  D Y L +   D G    I+  + KP   + VN+ D+NDN+P            + E+ +      + +++      PG  +    A D D G N  V+      T + +I P +I I ++   + I  +   D +         +I+A D G 
Sbjct: 1221 FGIDNGTGVLTAVKALDFEV---------SAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF-LRSYEGPIDVSEGQPGPRIATFMASDQD-SGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYA-----RKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFG-VNATL-AYSLLGGSSAY---FLIDRDRGNVSMALGQ----GLDREGIPGGRLELTILVQDGG---RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA-PPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPL-----PLAILVQKWHEDKRH-----------KQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSP------------EFEAGS------ATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGT-RIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGS 1930          

HSP 5 Score: 122.479 bits (306), Expect = 3.773e-28
Identity = 128/501 (25.55%), Postives = 218/501 (43.51%), Query Frame = 1
Query:  871 IDYETKNFYELTLIAWNNGHDELKSYLE------IKIEIIDMNDCEPVFKKGLFELV-LDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINR----ETFAVKETGEVILMKTLDVEF----RQTYEIPVYATDGEFTSNSK---IRIFVRDVNNHPPSYNLNPA--SLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK---LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSL-----INSKETDYFDLKRNGSLFSKI-TFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISV 2286
            +D E  + Y LT+++ + G  E  + L       + + + D ND  P F+ G   LV + E+   G L+  L ATD+D  S       + T++  R        ++    V ++     +F     Q     + A DG     S    + + V DVN++ P + L+P   ++++ E   P  LV  +   D DA   NG +  +   G  +    K    P++  + V         +DRE     T+ ++  D G +  L+ ++++ + V DVND  P F  P     + E+ ++G  V  V A +     N +  Y I     N F+++  SG +T+ R L   E+ N  L  +A +     L+     + +EV D ND+ P   LP     + I E +     I  +++ D D G NG   +S      + S++ + F +     + S     DRE +  Y L +  +D G P+S  ST+P+ V + D +DN PV  V
Sbjct: 1791 LDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF-LSPGGYAVSVVELGAPGTLVASVWATDADAGP-NGQVTFRIESGGGD----KLSIGPSDGIIRVA----PGANIDRETRAAYTLMVVAVDRG-NPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYERFN--LTAVATDHGRPPLW-GQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIV 2277          

HSP 6 Score: 106.301 bits (264), Expect = 3.726e-23
Identity = 149/566 (26.33%), Postives = 244/566 (43.11%), Query Frame = 1
Query:  616 RGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYE-TKNFYELTLIAWNNGHD---ELKSYLEIKIEIIDMNDCEPVFKKGLFELVLD-ENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKET-GEVILMK--TLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVR--DVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTS--TSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVV-----AHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAI--RRLDRE--EKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK-LEIMENLKPYQFIGNII--SEDKDFGN-NGKTVFSLINSKETDYFDLKRNGSLFSKIT-FDRELKDEYCLNIRVNDLGVPISRSS 2226
            +   +V I I D+NDN P F   ++   + E     G  +    A D D  + N+RV+Y +   +      I  + T  L   K +D+E +   Y L + A +   D    L S   + + + D+ND  P F +  +E  +D    + G  I    A+D+D   + +L Y ++   +   R  F +    G++ + +   LD E +  Y + + A D G    NS + + VR  DV+++ P +   PA+ +L E      +V ++      ASD N    C   L  S         + A Y  +    ++    LDRE      + L   D   +       + ++ + +LD NDN PVFS   Y+A+I EN+  G  VL V+     A D D   NA + YS+L G + +F I+ + G ++    + LDRE       +L IL  +   +   NAT  + + V D NDN P   +  +   ++EN  P      I+  + D+D G  +  TV   I S   D F +  +  L   +   D E + EY L +   D   P   +S
Sbjct: 1153 QATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGD-NARVVYAIVSGNTAATFGI-DNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRS-YEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSII---DGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVR-----ASDANEGRNCAALLQHSPTSFCNG--ERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNG-TVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRR---NATVRLGVTVLDVNDNTPTFNVTSQTAHVLEN-SPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTAS 1700          

HSP 7 Score: 105.531 bits (262), Expect = 6.184e-23
Identity = 110/363 (30.30%), Postives = 170/363 (46.83%), Query Frame = 1
Query: 1231 TDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL--EGPTNFFSINPNSGW--ITAIRRLDREE--KINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKD----FGNNGKTVFSLINSKE--TDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVP-ISRSSTKPICVNILDDNDNAPV 2277
            T GE   ++++ I + + N++ P ++L   ++++ EN      V Q+   D+DA      +  Q     S+  D KF  DPA   ++V         LD E  P  T+ ++  DGG  E   +   + + +LDVNDN PVF    Y    +EN+N    V++V A D+D   N QI YSIL     +++FSI  + G+  +T  R LD E+       L I+A++     L N+T T  +EV DENDN P        + I EN+     +  + + D D    +G       SLI S E  T +    R+G + S    DRE   +Y L +R  D G     ++    + + +LD NDN P 
Sbjct:    6 TSGEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAG-----VFGQVSYHFSDDSD-KFSLDPASGLISVA------AALDFEATPRFTVTVMARDGGGQE---TAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPL-NSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQ-----LSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPA 347          

HSP 8 Score: 102.064 bits (253), Expect = 5.944e-22
Identity = 120/446 (26.91%), Postives = 206/446 (46.19%), Query Frame = 1
Query:  607 NQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQIS--KDNTPRLRLTKDIDYETKNFYELTLI---AWNNGHDELKSYLEIKIEII--DMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSK--LVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKY-DMFSR--VQLDREEAPTRTIYLICHDGG-LHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWIT-AIRRLDREEKINYQLAILAIN 1887
            +Q  G+  V I + D NDN P +    +   I E   G G  I    A D D+ E N  ++Y ++  +  + +  +  K  T  L+L ++ D    +F  +  I     + G    ++     + ++  D+ND EP F    + L + E       + ++ ATD D+ +   + Y M   T ++ R  F +   TG +  +  LD E    Y++ + ATD      +S + + + V DVN++ P+++   ++++L E+   + +V  +N  D D S +N ++      G    QD +F         +V + D   R  V LDRE   + ++ +   D G    R T T+ + + VLDVNDN P+F    Y+  + EN   G  +LQV A D D+  N ++ Y I+ G  +  F +N +SG I+     LDRE    + L + A N
Sbjct:  326 DQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPG-GTDIFTVSAADPDLNE-NGTLVYAIDPPNPFYRINAASGKIRTTGLQLDRE-DLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSM---TAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDAD-SGLNAELSFFITGGN---QDGQF---------SVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFN 752          

HSP 9 Score: 95.5153 bits (236), Expect = 6.278e-20
Identity = 88/343 (25.66%), Postives = 154/343 (44.90%), Query Frame = 1
Query: 1597 STSVITLQVLDVNDNPPVFSIPFYKAQIKEN-NNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKIN-YQLAILAINKSLKAL--FNATTTVNIEVTDENDNVPEIYLPKKLEI-MENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSK--ITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPV---ISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV-ADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACD 2586
            +T+ + +++ D NDN P F    Y+  + E  +  G  V  V A D D+ +NA++ Y+I+ G T   F I+  +G +TA++ LD E     Y L + A ++         +T TV++ V D ND  P      +  I +   +P   I   ++ D+D G NG+  +S+I+    + F +   +G L  +  +  DRE +  Y L I   D+G P   +ST  + V +LD +DN PV   +  +++L E   +                         I + V A DA++G N          +  N     F  D   G + ++R + R+ + +Y++ +   D
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTP-PLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAV-----------------------LAIVSRVRASDANEGRNCAALLQHSPTSFCNG-ERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRD 1471          

HSP 10 Score: 88.5817 bits (218), Expect = 7.386e-18
Identity = 165/721 (22.88%), Postives = 287/721 (39.81%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMF---PMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDN-TPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLE-----IKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLE----ATDKD--KDSKLVYGMVSSTNS---INRETFAVKETGEVILMKTLDVEF--RQTYEIPVYATDG-EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPP---NILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGG--LHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL------------EGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTT-----VNIEVTDENDNVPEIYLPKK--LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKET----DYFDLKRNGSLF-----SKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMED-ITDSNQIAPLFIIDEDNGSIKIS--RIMSRDVIGDYKMKIIACDKGKSSL 2604
            L   + V + + D +DN P+F   P  + + +   +L  V +     +A D +     + +L     +    E     D+ T  + + + +D E    Y LTL   +N  +   SY       + + I+D ND  PVF +  +E  + EN+  G ++  L     A+D D   ++ L Y ++  +++   I+R+   V     + L + LD E       E+ +   DG    +  ++ + V DVN++ P++N+   +  + EN P    +++V +   +D+   D  G +R     G +   D   + +     +TV         +D E  P   + ++  D     H   T++  + + + +  D    FS+  Y+A + E    G  V++V A          +  +IL            +   N   I    G IT    LDRE   +Y L +L+ +   +      T      V + VTDENDN PE        +E+ E+  P   +  + + D+D G+NG           T     Y  + +N S       +K  F  +        I   D G P  RS+T  + V +LD NDN P+                    + G   +       PG  +A+  A DAD G N QVTF +E    D   I P       +G I+++    + R+    Y + ++A D+G   L
Sbjct: 1369 LNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRV----RASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDN--PSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVS----MALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDA-GTVRYSIASGGN---DTFGIDESTGLIVTVA-------PIDYETRPEYLLMVVATDQAPPFH---TASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSP-PRSTTFNLSVIVLDVNDNVPIF------------------LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGP------SDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPL 2040          

HSP 11 Score: 87.0409 bits (214), Expect = 2.346e-17
Identity = 105/437 (24.03%), Postives = 190/437 (43.48%), Query Frame = 1
Query:  628 NVKIVIHDQNDNVPMF--PMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL-NKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATD--KDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASD-VNGDIRCQ-EPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ-LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSI------PFYKAQIKENNNIGDKVLQVV-AHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILA 1881
            N+ +++ D NDNVP+F  P    V  ++  L   G  +    A D D    N +V +++ +   D   +  S D   R+    +ID ET+  Y L ++A + G+  L     +++ + D+ND  P F   +  + + E+  +G  +  ++AT+  K  ++K  Y +      I +  F V  T  ++    L ++  + + +   ATD         + + + V DVN+H P + L P    +   +   +++  + V  VD  +  NG +R      G    +D +       + +     + S  + LDRE     ++ L+  D G      ST  + + + D++DN PVF +      P+    I E++  G  V  V  A D D   NA + Y I  G   N F+++   G +  +  LDRE    Y + + A
Sbjct: 1938 NLSVIVLDVNDNVPIFLSPGGYAVSVVE--LGAPGTLVASVWATDADAGP-NGQVTFRIESGGGDKLSIGPS-DGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIA----GIGKNAFTVHATSGLVTSTRL-LKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWE------SFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLS-RWGLLVVLSDLDREVSPYYAIIVKA 2358          

HSP 12 Score: 64.6994 bits (156), Expect = 1.544e-10
Identity = 59/240 (24.58%), Postives = 105/240 (43.75%), Query Frame = 1
Query: 1912 ATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQF---IGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKI-TFDRELKDE-YCLNIRVNDLGVPISR--SSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRI--MSRDVIGDYKMKIIACDKGKSSL 2604
            ATT+V I +TDENDN P  +     E++    P      + N+ + D D G+N + V+++++      F +     + + +   D E+    Y L +   D     +R  +ST  + V++ D ND  P       L+  +     +  Q              PG +IAT +A D D G N ++ +++ D    N+    F+I   +G +++ R   + R+    Y + I+A D G   L
Sbjct: 1154 ATTSVLIRITDENDNAPA-FGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF-----LRSYEGPIDVSEGQ--------------PGPRIATFMASDQDSGLNGELEYSIIDGDPRNE----FVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPL 1369          

HSP 13 Score: 58.5362 bits (140), Expect = 1.194e-8
Identity = 53/219 (24.20%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMF-PMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQIS-KDNTPRLRLTKDIDYETKNFYELTLIAWNNG--HDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVS 1116
            F LD  + ++ T  ++D E +            L LV        L     + +V+ D NDN P F P +S V  ++ +       I L    D D + +N+ + + +   +   +  +  +D    +R    +D ETK  Y L + A +NG           + + ++D+ND  P+F +G +E+ + EN   G +I++++ATD D+  + ++ Y ++S
Sbjct:  508 FQLDAATGLITTLVQLDREAVAAYQ--------LRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARD-SVVISL-NCTDAD-SGLNAELSFFITGGNQDGQFSVGFRDGL--VRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIIS 713          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 1.772e-47
Identity = 196/779 (25.16%), Postives = 335/779 (43.00%), Query Frame = 1
Query:  496 SSVLKTAKKIDLEILC---PKFCNDDGVGFLNLV-VNVWKENQ----LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKAS-DTFEL---------------------QISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELV-LDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSI-NRETFAVKETGEVILMKT---LDVEFRQTYEIPVYATDGEFTSNSK---IRIFVRDVNNHPPSYN--------LNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF-VPDPAEY--PLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIP--------FYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSIL-----EGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-------KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN---GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV-ADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            S  L  A ++D E LC   P  C     GF++ V V    + Q    LR +++V++++ D ND+ P F        I E    VG+ + LP+AID D    NS   Y+++ AS D  +L                          +   L L + +D E    YEL L   + G+ +L   + + I ++D ND  PVF       V + E++K+G  +++L A D D   +  + Y   +   S+  +    V  T  ++ ++    LD E    + + V A DG   S S    + + + D N++ P +         L    + + EN P    V  I+V D D             LG S   D++   P  AE   P  V++ + +   LD EEA    + ++  D G   +L+    + + V+D+NDN PVF  P         Y+  ++EN   G  VL ++A D D   N  I +++      E     FS+N  +G +T    LDRE+++ Y+L++ A +        A   V + V DENDN P             +  + E      ++G + + D D G+N +   +L+     D+     +   G + + +  DRE + +Y L++R  D G P   +S + + + + D NDNAPVI+                S N          +   G  +  +V A+D D G+N +  +   +I   N    +F+++ D+G++ ++R +S    G +++ +   D+G S  R
Sbjct:   80 SGELSVALRLDREALCMEEPDACRS--TGFMHTVQVAAMAKGQGSSNLR-LLDVQLLVRDINDHAPAFRAPHLNVSISES-EAVGRRVPLPRAIDPD-AGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPD-------------LGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRG-TPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGG-SPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCR-VSITVSDTNDNAPVIT----------------SPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLY---EIIGGNPKG-IFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSR 817          

HSP 2 Score: 64.6994 bits (156), Expect = 1.165e-10
Identity = 89/383 (23.24%), Postives = 158/383 (41.25%), Query Frame = 1
Query:  346 IQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEIL----CPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVK---KIKEILY---GVGKTIEL-PKAIDKDVTEINSRVLYKLNK------ASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVF------KKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPP---SYNLNPASLTLEENQPPNILVG-QINVKDVDASD 1398
            I EN PSG  V  IS     + + DL           F    E  + ++   +LKT + +D E            D G              +L  ++N+ I + D NDN P+F   + ++    + E+     G   T+ L   A D D +  N  + + L++       ++ F L +    T +L L   +D E +  YEL++ A + G  + K+   +++ ++D ND  P F         +++  ++E T +G  +  +  +D D+  ++++   +V                G V  +  LD E R  YE+ V A D      +++ ++ I V D N++ P   S N N     +    P  +LVG  +   D+DA D
Sbjct:  401 IVENLPSGTPVVLIS-----VSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGT------------PKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDAD-SGPNGAITFTLSELAGGESVAELFSLNM---RTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGD 762          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 176.407 bits (446), Expect = 2.313e-45
Identity = 168/680 (24.71%), Postives = 291/680 (42.79%), Query Frame = 1
Query:  331 NLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNT----PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLN------PASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP------TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP------KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLF---SKITFDRELKDEYCLNIRVNDLGVP-ISRSSTKPICVNILDDNDNA 2271
             + Y + E  P+G  VG +S D+       + +     F    RD      ++     +   + ID E    + C       +   V       L  +++ ++ + D ND+ P F       +I E +  +G  + L  A D DV   N+   Y L++ ++ F L +           L +   +D E +  Y L L AW+ G         ++I ++D ND  PVF +    + + E+   G +++ L ATD D+  + ++VY   S  ++  R  F +  +TG++ L   LD E    YEI + A D       ++ K+ + V D+N++ P   L+        ++ + E       VG + V D+D+++ NG + C           L+  P     P    Y + +   LDRE+     + L   DGG   R+ +    T+++LD NDN P F    Y+A + ENN+ G  V  V A D D + N  I Y+++E        + + SINP+SG I A+R LD E   +    + A +  +  L     TV++ + DENDN P +  P        + +  +      +  + + D D   NG+  + ++   E + F + R  G +F   + +T        + L + V D G P +S ++   I V    D D+ 
Sbjct:   30 TVKYALYEEQPAGTLVGRLSDDLQG----RVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDRE----QQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESV-ALGTRVPLEGARDLDVGG-NALRAYHLDE-NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAE-NGLVACH----------LRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQ-FTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVT-NATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGDDG 685          

HSP 2 Score: 92.8189 bits (229), Expect = 2.564e-19
Identity = 123/578 (21.28%), Postives = 234/578 (40.48%), Query Frame = 1
Query:  949 LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETG----EVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDI--RCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQ------IKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAI-RRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKE-----TDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGD---YKMKIIACDKGKSSL 2604
            +  ++E++D+ND  P F +    + + E+  +G  +    A D D     +       N         +  G    E+++   LD E    Y + + A DG     +  + +RI V D N++ P +     ++T+ E+  P  ++  +N  DVD    NG++      P+  + ++ L F  DP    L++K       QLD E      I +   D G    + +   + + V D+NDN P   + F          + E       V  V   D D  EN  +    L G  +F  +     ++      LDRE+  +Y L + A +        A     + + DENDN P  +    +  ++EN  P  ++  + + D D  +NG   ++++ S+      + Y  +   +G++++    D E        ++  D GVP    +   + V I+D+NDNAPV++ H  L+              G+ +++       G+ +    A D+D   N ++++ +    + N    LF I+   G +  +     D       + + ++  D+G  +L
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGP-NGEVVYSFSSPV-DAEVRRL-FQLDPKTGKLSLKG------QLDHELNSEYEISIQARDMG-PSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACH-LRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRV-AARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVP-PLVTNATVSVRIVDENDNAPVVT-HPPLRN-------------GTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN----LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPAL 666          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 223.402 bits (568), Expect = 4.769e-59
Identity = 211/777 (27.16%), Postives = 358/777 (46.07%), Query Frame = 1
Query:  343 TIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLR--GVINVKIVIHDQNDNVPMF--PMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL--NKASDTFELQISKDNTPR---LRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVS-STNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNS---KIRIFVRDVNNHPPSYNLNPASLT-LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKIT----FDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEK 2616
            T+ EN  +G+ V ++++      + D       S+     ++N  F +DR +  + T   +D E +             +L +N    + +R      V I I D+NDN P F  P +  + +       VG+      A D+D+   N  V Y +      ++F+L       PR   L +   +D ET   Y L + A + G  +      I + ++D+ND  P F+K LF   + E+  +   +++++  DKD+ S    G ++ S +    + F +  TG V+    LD E    Y++ V A DG   S S   +++I + +VN++ PS+ ++PA +T + E+   N  V ++N  D D + +  DI  +   G S      F  D +   ++V        +LDRE     T+ +   + G        +  T++VLDVNDN PVF+   Y   + EN  IG  V +V A D+D+ ENA++ Y +  G T+ F +NP +G +T  R LDRE++ +Y L + A++   K   +A   + + + D NDN P+    K  L + EN      I  +++ D D G NG+  +S+I+    + F   R  S   +IT     DRE    Y L I   D GVP    ST  + + + D+NDN+P+ + + T    D+          G  I         G ++A   A D D+G NAQV +++     S      F I+  NG + + + ++R+ +  Y + I A D+G   + ++K
Sbjct:  693 TVGENLAAGVAVCYVTA-----TDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIAS----------YSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQL----TATDRDIGP-NGAVTYAIISGNQGNSFQLD------PRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSN---GAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSF-VSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDI-VEGNAGSS------FKIDQSSGLISVAK------RLDRETTANYTLVVRATETGSQGESVYNNA-TIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHG-KPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAF---RIDSTTGRITVVGVVDREALASYNLTISAKDSGVP-PWVSTAFVAITVADENDNSPIFASNETSYGIDE----------GVSI---------GSRVAVVTATDRDEGSNAQVFYSIVRGDTS-----AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDK 1396          

HSP 2 Score: 205.682 bits (522), Expect = 1.438e-53
Identity = 198/715 (27.69%), Postives = 328/715 (45.87%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVIN-VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            F +D+ S ++  AK++D E             +  +V      +Q   V N   I + D NDN P+F   S+ K + E L  +G+T+    A D+D  E N++V Y+L+   DT + +++   T  +   + +D E +  Y L + A ++G     +   I + I D+ND  P F +  + L + ENT  G  I+++ A+D D   + ++ Y ++S  +      F +   TG + ++  +D E   +Y + + A D     + S + + I V D N++ P +  N  S  ++E       V  +   D D    N  +      G ++     F  +     LTVK       +++RE  PT T+ +   D G    +TS   +T+ V DVNDNPPVF+   Y   ++EN+     VL V A D D   NA ++YSI+ G     F IN  SG I     LD EEK  Y L + A +      + A T V I V + ND  P          + EN      +  + + D+D  + G   +S++  K++D F + +R+G + +    DREL   Y + +RV D G P   S+   + + ILD+NDN+P                K +S +  S I++ S   +  FK+A   A DAD+G NA++T+ +            F+I   +G I +++ + R+    Y + I A D G
Sbjct: 1042 FKIDQSSGLISVAKRLDRETTA---------NYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENL-PIGQTVAKVTATDRDEGE-NAKVTYELS-VGDTSKFEVNP-ATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHG---NAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS-NAQVFYSIVRGDTS----AFAINAMNGVLTVKK------EINRETVPTYTLTIRASDRG-SPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK----YTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNP-PLSNLTWVTIKILDENDNSP----------------KFDSSSYSSSILENSAPSSFSFKLA---ATDADEGTNARITYNLSR-------NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHG 1695          

HSP 3 Score: 199.134 bits (505), Expect = 1.701e-51
Identity = 187/668 (27.99%), Postives = 299/668 (44.76%), Query Frame = 1
Query:  637 IVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASD----VNGDIRCQEPL-----GKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACD 2586
            I + D NDN P F +  +   + E +  VG  +    A+D DV  IN+R+ Y L     ++    + D+   +R     D ETK  Y++ L A + G         ++IEI+D+ND  PVF    +   +DE+  IG  ++ + A+DKD   ++ L Y   S   +      AV  TG V + ++LD E R +Y + +  TD      T  S + I V D+N++PP ++ +     ++EN P      Q++  D D+S     V G I+  +       G + +  +   PD   Y    +YD+   VQ      P +      +D         T+ +T+ + DVND+ PVFS   Y  QI E+  IG  V+ V A D D     +++Y ++ G     F+I+ NSG I     LDRE   +Y L + A +    +  +++T V I + D NDN P    P    + E+  P   IG + + D D  +NG   ++L  S  TD F +  +  L + K   D E K +Y + +   D G P SRSS   + V + D NDN P                          +   +V EN   G  +    A DAD G N ++++++  ++ +  +A  F +D   G I     + R+ I  Y + I A D
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYEDV-AVGSIVRQLTAVDLDV-GINARLSYSLVSGDTSY---FTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAV--TGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPD---YENKTRYDL--TVQARDRGVPVK------YD---------TAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSR-SSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYAL--SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTP-SRSSLTVVKVMVDDVNDNPP---------------------QFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI--LSGNENMA--FAMDRFTGEITTRVPLDRETIASYSLTINADD 764          

HSP 4 Score: 183.341 bits (464), Expect = 1.247e-46
Identity = 189/729 (25.93%), Postives = 326/729 (44.72%), Query Frame = 1
Query:  451 FTFRDKNE--YFTLDRQS-SVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNS---KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN-FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSS 2601
            ++  D N+   FT+D  + S+  T +K D E         +    L ++         +G   V I + D+NDN P FP+ S+V  I+E        + +  A D+D +  N+ + Y L    + F +      T  +R    +D+ETK+ Y + + A++  H    +++ + I + D+ND  P F   +++  + E+  +G ++ +L A D D   +++L Y +VS   S     F V   G +      D E + +Y++ + A DG   S S    + I + DVN++ P ++    + +++E+      +  +   D D  + N D+R     G +N     F  D     +TV     SR  LD E+  +  + L   D G    LT TS + + V D+NDNPPVFS   Y++++KEN   G    QV A D+D   N  + + I++G  +  F+I+ ++G I+  +  D E K  Y L + A ++ +   ++ T  V I + D ND+ P ++ P     +I E+      +  + + D D G  G+  + LI+      F++  N GS+      DRE    Y L +   D     SRSS+  + + + D NDN+P+                      G  + + S   +PG +I    A DAD   N  V + + D TD      +F I+   G I +   +  +    Y + + A D G  S
Sbjct:    1 YSIMDGNDQGMFTIDSSTGSITTTGRKFDRE--------SESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRE--NTPAAQVAIVTATDRD-SGTNAAITYSLFSGENKFMMN---SKTGEIRTVTPLDHETKDSYTMRISAFDGKH---TTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSY----FTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGN-NADLRYSFTSGNTN---HAFTLDAVTGVVTV-----SR-SLDFEQRSSYALGLSVTDRG-SPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG---TQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYD-TAQVTIFIEDVNDHSP-VFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIFQ--------------------GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD------VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPS 664          

HSP 5 Score: 172.94 bits (437), Expect = 2.336e-43
Identity = 181/675 (26.81%), Postives = 297/675 (44.00%), Query Frame = 1
Query:  619 GVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDS--KLVYGMVSSTNSINRETFAVKET-GEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPL-TVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
             V  + + I+D NDN P F    +   + E     G  I    A D D    N RV Y +   +     +I    T R+ +   +D E    Y LT+ A ++G     S   + I + D ND  P+F        +DE   IG  +  + ATD+D+ S  ++ Y +V    S     FA+    G + + K ++ E   TY + + A+D      TS+ ++ + V DVN++PP +N      ++ EN   +  V  +   D   SDV  +   +  +   N        D   + + +    + +   LD EE     + +   D     + T+ + +T++V+++ND  P F+   Y A ++EN+     V++V A D+D      + YSI+ G  ++ FSI+  SG I+    LDRE    Y + +   +     L N T  V I++ DENDN P+         I+EN  P  F   + + D D G N +  ++L  S+   +     +G +      DRE K  Y L I+  D G P  ++S+  I V ++D ND+ P+I                NS +L     + SV EN      +   +A DAD G NA++TF++     SN+   +F +D   G I     + R+    Y ++I   DKG  SL +
Sbjct: 1185 AVAAITLTINDLNDNSPQFSQSKYTLTVTENTAN-GSNILRVLASDPDAGA-NGRVTYSIISGNHGNAFRIDS-TTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS----AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADD---SDVGANAVLRYSIISGN--------DEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD----SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTW-VTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL--SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTP-PQASSITIRVTVIDINDHRPLI----------------NSSSL-----RGSVRENQPKETHVMRILASDADTGLNAELTFSLL----SNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSS 1806          

HSP 6 Score: 171.785 bits (434), Expect = 4.863e-43
Identity = 193/774 (24.94%), Postives = 331/774 (42.76%), Query Frame = 1
Query:  322 FEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLE----ILCPKFCNDDGV-GFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLK--ALFNATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            F+G   + + E+   G Q+G       Q+   D     +    +   D  + F+++  + ++    ++D E     +      D G     +L V             VK+++ D NDN P F    +   + E L   G  +    A D D +  N ++ Y +   ++     + +  T  +     +D ET   Y LT+ A +       +   + I I D ND +P F  G     + E++  G  + +L ATD+D   +  + Y ++S        +F +   +G + +  TLD E   +Y + V A+D    + +  + I + V DVN++ P +  +  S  + E+   +  V Q+ V+D D    NG I     L  S      F  D   +       + S+  LD E      + +   DGG   + ++T+ + + +++VNDN P F  P     I E+  I   V+++ A D D      + + I+EG   + F I+ +SG I+  +RLDRE   NY L + A     +  +++N  T   I V D NDN P ++ P      + ENL   Q +  + + D+D G N K  + L +  +T  F++    G + +K   DRE +  Y L +   D G P S+S+   I + I D NDN+P  S     + +  L    N+ N GS I++              +A D D G N +VT+++      N     F ID   G I +  ++ R+ +  Y + I A D G
Sbjct:  583 FQGPYVFRVSESSSPGHQIG-------QVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTV-------------VKVMVDDVNDNPPQFAKSLYTCTVGENL-AAGVAVCYVTATDAD-SGANGKISYSILSGNENMAFAMDR-FTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQG---NSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGS-NGAIT----LSLSGEGSDNFTIDSTGF-------VLSKTPLDYETTAAYQLTVTARDGGSPSK-SATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNAT---IRVLDVNDNAP-VFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL-SVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKP-SQSAVAAITLTINDLNDNSPQFS-----QSKYTLTVTENTAN-GSNILR-------------VLASDPDAGANGRVTYSIISGNHGNA----FRIDSTTGRITVVGVVDREALASYNLTISAKDSG 1284          

HSP 7 Score: 120.939 bits (302), Expect = 1.624e-27
Identity = 126/542 (23.25%), Postives = 248/542 (45.76%), Query Frame = 1
Query:  445 FYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK--LEIMENLKPYQFIGNIISEDKD 2049
            FY   R     F ++  + VL   K+I+ E + P +        L +  +      +     + +V++D NDN P+F  +S++  ++E       T  L  A D      N+ + Y +   +D    +I+   +  +  T  +D+E K+ Y L + A ++ +    +   + I +I++ND  P F +  +   + EN+     ++K+ A+D+D    L Y +V   +S   + F++ + +G +     LD E    Y I V  TD      ++ + + I + D N++ P ++ +  S ++ EN  P+    ++   D D      + R    L +++     F+   +   +T+         LDRE   T  + +   D G   + +S + I + V+D+ND+ P+ +    +  ++EN      V++++A D D   NA++ +S+L     + F+++  +G I+    LDRE++  Y L I   +K   +L ++   V I+V DE+DN P  + P +  + I E+L     I  + + D D
Sbjct: 1344 FYSIVRGDTSAFAINAMNGVLTVKKEINRETV-PTYT-------LTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRE--NSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINS-TSGVIMTTTPLDFEEKSQYGLEVTATDSKY---TAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDS---DKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGT---NARITYNLSRND----AFMIGASSGVITLAQ------PLDRENKSTYDLAIQARDHGTPPQASSIT-IRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSL-SSVADVIIDVIDEDDNCPR-FQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 8 Score: 120.553 bits (301), Expect = 2.093e-27
Identity = 109/367 (29.70%), Postives = 158/367 (43.05%), Query Frame = 1
Query: 1519 QLDREEAPTRTIYLICHDGG--LHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            + DRE      + ++  D     H+  T   V+ + V D NDN P F +  Y   I+EN     +V  V A D+D   NA I YS+  G  N F +N  +G I  +  LD E K +Y + I A +       + T    I V D NDN P   L   K  + E++     +  + + D D G N +  +SL+ S +T YF +   G + +K  FDRE K  Y + +R  D G P SRS    + + ILD NDN PV S                     S    ASV E+   G  + T  A D D G NA + ++      S      F +D   G + +SR +  +    Y + +   D+G   L
Sbjct:   27 KFDRESESRYRLTVLAQDAANRCHKGRT---VVVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSGE-NKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGK-----HTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLV-SGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSP-SRSGQATVEIEILDVNDNRPVFS---------------------SAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFT----SGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPL 356          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO46417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ19])

HSP 1 Score: 196.438 bits (498), Expect = 1.740e-50
Identity = 201/750 (26.80%), Postives = 347/750 (46.27%), Query Frame = 1
Query:  463 DKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQ-LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT-FELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHD--ELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-------KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYN--LNPASLT------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDD---KENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKIN-YQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK--KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPI-SRSSTKPICVNILDDNDNAPVI---SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSN-----QIAPLFIIDEDNGSIKISRI---MSRDVIGDYKMKIIACDKG 2592
            D +E F+++    + KTA ++D E L P      G     L V   +EN  L    +V I + D ND+ P F + ++  +++E    +G T+   KA D+D  +    V Y L   SD  F + +   N+  L   K  D E ++ + + +IA + G++   L   + +K+ ++D ND  P F +  F+  + E+  IG  I+++ ATD+D   ++KL Y  +S  +   R  FAV       +  GEV +   LD E + +Y I V ATDG F++ +++ I + D N+  P +     P  L+      + E     + V ++   D D+ ++   +      G S+   +    +  ++   V         LDRE  P  +  ++  D G+H   T ++ I + V D+NDN P F    Y   ++EN   G  V+ V AHD DD     NA+I+Y++ +     F I+ N+  +T    LDRE   N + + +LA ++    L + T    I VTD ND+ P ++  +  +  + E+++P   + ++ + D D G N +  F + +  E   F +    G++      +  L+  Y L + V+D G+P+ S +S   + + I D NDNAP+      + T+ E            +GS ++           + TAV  D D G+NA+  F   DIT  N     ++ P    + DN S+ I R    + R+    + ++I A D G
Sbjct: 1758 DIDEKFSVETNGQI-KTASQLDYEQLSP------GDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTFDLGNYDARVRENA-PIGTTVITIKATDRDTGDAGV-VTYFLKAGSDEHFAIDV---NSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEY-FISGGD--GRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATDGRFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSPNIQYTLE-----GSSSYFTIAARQEGGKF---VGIISTGSQPLDREATPIFSFNVLAKD-GVH---TGSAYIEINVTDINDNQPRFPNSLYVGYVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTLTDNAGGKFKIDANTALVTTEEILDRETSPNSFTITVLATDQGANKL-STTKVATIYVTDANDHAP-VFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGPNAELEFVVTHGNEPAAFYVDPSKGTVHVSGILNYTLRKSYNLTVTVSDRGMPVLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAED---------LAVGSPVV-----------VVTAV--DYDSGDNAKFVF---DITGGNPDDLFEVVP----NPDNSSLGIVRTRLPLDRETTPIHHLEITAKDTG 2449          

HSP 2 Score: 152.525 bits (384), Expect = 5.323e-37
Identity = 183/744 (24.60%), Postives = 319/744 (42.88%), Query Frame = 1
Query:  328 GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVIN----VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI-----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFK--------KGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGE--VILMKT----LDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASL---TLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAP-TRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG--PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALF-NATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN------GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPV---------------ISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIAT 2400
            GN +  ++EN P G  V  I +      +  +        YF     +E+F +D  S  L T K  D E          G    +++V    +    G ++    VK+++ D+ND+ P F    F   + E    +G +I    A D+D+ + N+++ Y ++     F   +     S      +++   +D+ETK+ Y + + A +       +   + I I D ND  P+F           ++   + E T  G  ++K+ A D D    + Y +  S++     T A ++ G   V ++ T    LD E    +   V A DG  T ++ I I V D+N++ P +   P SL    +EEN+     V  +   D D   + G+   +  L  ++    KF  D A   L    ++     LDRE +P + TI ++  D G + +L++T V T+ V D ND+ PVF+   ++  + E+   G  V  V A D D   NA++++ +  G  P  F+ ++P+ G +     L+   + +Y L +   ++ +  L  N+   V I +TD NDN P I++P +    + E+L     +  + + D D G+N K VF +      D F++  N      G + +++  DRE    + L I   D G    ++    + + +LD NDN P                +    T    +  ++KNN       I   +V  N  F IAT
Sbjct: 1825 GNYDARVRENAPIGTTVITIKATDRDTGDAGVVT------YFLKAGSDEHFAIDVNSGTLTTKKSFDRE----------GQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESAT-IGTSILEVVATDQDIGD-NAKLEYFISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATDG---RFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDS-PNIQYTLEGSSSYF---TIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLAKDGVHTGSAYIEINVTDINDNQPRF---PNSLYVGYVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTL--TDNAGGKFKID-ANTALVTTEEI-----LDRETSPNSFTITVLATDQGAN-KLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGPNAELEFVVTHGNEPAAFY-VDPSKGTVHVSGILNYTLRKSYNLTVTVSDRGMPVLSDNSPAYVLITITDANDNAP-IFIPNQYNKTVAEDLAVGSPVVVVTAVDYDSGDNAKFVFDITGGNPDDLFEVVPNPDNSSLGIVRTRLPLDRETTPIHHLEITAKDTGGLTGKAH---VWLTLLDVNDNGPWFQPPFFVGKIKENVNVKQFVTKVSANDPDTKNNGAPFTYAIYNGTVSGNFAFDIAT 2526          

HSP 3 Score: 126.331 bits (316), Expect = 5.040e-29
Identity = 165/642 (25.70%), Postives = 283/642 (44.08%), Query Frame = 1
Query:  346 IQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKK-IDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEI--NSRVLYKL-NKASDTFELQISKDNTPRLRLTKDIDYETK-NFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF-----TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDL-KFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKEN-AQIKYSILEGPT--NF-FSINPNSGWITAIRR---LDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISE----DKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELK-DEYCLNIRVNDL 2202
            + E   SG++V  + +  T  PNI       SS YFT   + E     +   ++ T  + +D E   P F         N++    K+    G   ++I + D NDN P FP   +V  ++E     G ++   +A D D   +  N+ + Y L + A   F++     NT  +   + +D ET  N + +T++A + G ++L +     I + D ND  PVF K +F   + E+ + G ++  + ATD D         V +  +     +     G V +   L+   R++Y + V  +D         S + + I + D N++ P +  N  + T+ E+      V  +   D D+ D   + +    +   N  DL + VP+P    L +   + +R+ LDRE  P   + +   D G    LT  + + L +LDVNDN P F  PF+  +IKEN N+   V +V A+D D K N A   Y+I  G    NF F I   +   T +      DRE    + + I   +    A  N  T V ++V D+NDN P      ++ I+ N    +F G  I++    D D+  +  T ++L +    ++F +    +   +I+  +++   EY L I V ++
Sbjct: 2053 VSEMTGSGVEVLKVYAVDTDSPNIQY-TLEGSSSYFTIAARQEG---GKFVGIISTGSQPLDRE-ATPIFS-------FNVLA---KDGVHTGSAYIEINVTDINDNQPRFPNSLYVGYVEE-NKAAGTSVMYVQAHDDDDPYLGGNAEIRYTLTDNAGGKFKIDA---NTALVTTEEILDRETSPNSFTITVLATDQGANKLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGPNAELEFVVTHGNEPAAFYVDPSKGTVHVSGILNYTLRKSYNLTVTVSDRGMPVLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAEDLAVGSPVVVVTAVDYDSGD---NAKFVFDITGGNPDDLFEVVPNPDNSSLGI---VRTRLPLDRETTPIHHLEITAKDTG---GLTGKAHVWLTLLDVNDNGPWFQPPFFVGKIKENVNVKQFVTKVSANDPDTKNNGAPFTYAIYNGTVSGNFAFDIATITNVTTDMSSSGTFDRETMTTWTIGIAGTDSGRPAKSNF-TYVYVDVQDDNDNEP---YDGRMTIIVNSYNGKFRGGPIAKTYYRDADYDGDVNT-YTLQSQTGGNFFTVD---TTTGEISAAKDIPVGEYSLVISVTEV 2658          

HSP 4 Score: 114.775 bits (286), Expect = 1.539e-25
Identity = 148/595 (24.87%), Postives = 248/595 (41.68%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYG-----VGKTIELPK--AIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRL----TKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD-----KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQT----YEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERL-TSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNS-----GWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFGNNGKT-VFSLINSKETD--YFDLKR----NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            + +      V I I D ND VPMF   +    +  I  G      G  +E+ K  A+D D   I     Y L  +S  F +   ++    + +    ++ +D E    +   ++A +  H    +Y+EI +   D+ND +P F   L+   ++EN   G  ++ ++A D D      ++++ Y +  +           K      L+ T ++  R+T    + I V ATD    + ++     I+V D N+H P +       T+ E+  P  +V  ++  D D    N ++      G    +   F  DP++   TV         L +    T T+     D G+      S + + + + D NDN P+F    Y   + E+  +G  V+ V A D D  +NA+  + I  G P + F + PN      G +     LDRE    + L I A  K    L      V + + D NDN P    P  + +I EN+   QF+  + + D D  NNG    +++ N   +    FD+         + S  TFDRE    + + I   D G P ++S+   + V++ DDNDN P
Sbjct: 2013 DGRFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSPNIQ----YTLEGSSSYFTIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLAKDGVHTG-SAYIEINV--TDINDNQPRFPNSLYVGYVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTLTDNAGG------KFKIDANTALVTTEEILDRETSPNSFTITVLATDQGANKLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGP-NAELEFVVTHGN---EPAAFYVDPSKG--TVHVSGILNYTLRKSYNLTVTV----SDRGMPVLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAEDLAVGSPVVVVTAVDYDSGDNAKFVFDITGGNPDDLFEVVPNPDNSSLGIVRTRLPLDRETTPIHHLEITA--KDTGGL-TGKAHVWLTLLDVNDNGPWFQPPFFVGKIKENVNVKQFVTKVSANDPDTKNNGAPFTYAIYNGTVSGNFAFDIATITNVTTDMSSSGTFDRETMTTWTIGIAGTDSGRP-AKSNFTYVYVDVQDDNDNEP 2580          

HSP 5 Score: 114.39 bits (285), Expect = 2.068e-25
Identity = 175/764 (22.91%), Postives = 318/764 (41.62%), Query Frame = 1
Query:  469 NEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIH--DQNDNVPMFPMKSFVKKIKEIL--YGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIK----LEATDKDKD-----------SKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVE----FRQTYEIPVYATD--GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSV-ITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNS------GWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP---EIYLPKKLEIMENLKPYQFIGNIISEDKDFG---NNGKTVFSLINSKETDYFDLKRNGSLFSKIT------FDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI--SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVI-GDYKMKIIACDKGKSSLRTEK 2616
            N+ F ++  S V+ T +++D E         +  G+   ++N+   +      +V+++I+  + NDN PMFP ++  +  +++   +  G       A+DKD   I  RV YK++  ++ +    + D   +L    D+      F   T+ A + G  +      + +  ++        K+    +++ E T+   +I +    LE+   + D             +VY  V +   I+ E F+V+  G++     LD E      +T+++ V A +      S   + I + DVN+  P+++L      + EN P    V  I   D D  D  G +      G     D  F  D     LT K         DRE     ++ +I  D G +    S  V + + V+D ND+PP F    ++  + E+  IG  +L+VVA D+D  +NA+++Y I  G   F F++   S      G +    RLD E K +Y + + A +      F+ATT V I +TD ND VP    +  P  L  +   +  +  G+ +   K +    ++    ++L  S        ++ G  F  I        DRE    +  N+   D GV    + +  I +N+ D NDN P    S++    E+++          G+ ++    +++          DD   G NA++ +T+ D          F ID +   +    I+ R+     + + ++A D+G + L T K
Sbjct: 1544 NDMFAINPSSGVILTTRELDYE---------EATGY---IMNIIARDTRDRSASVQVIINVVNINDNEPMFPGETNGQIDRKVAGPFAPGVIATRLTAVDKD---IGDRVYYKISIEAENY---FTIDERGQLICKNDLKGIASPF-RFTIEARDGGLPQKVHTANVLLVFVNYRP-----KQQPVRVIVPETTRAXTVITRVPRILESLSVNSDVLKVSAQAPGGKSIVYSPVKANADID-EKFSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVITIKATDRDTGDA-GVVTYFLKAGS----DEHFAIDVNSGTLTTKK------SFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEYFISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATD----GRFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSPNIQYTLEGSSSYFTIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLAKD-GV---HTGSAYIEINVTDINDNQPRFPNSLYVGYVEENKAA--------GTSVMYVQAHDD----------DDPYLGGNAEIRYTLTD-----NAGGKFKIDANTALVTTEEILDRETSPNSFTITVLATDQGANKLSTTK 2240          

HSP 6 Score: 106.301 bits (264), Expect = 5.522e-23
Identity = 160/687 (23.29%), Postives = 282/687 (41.05%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTP---RLRLTKDIDYETKN------FYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYAT--DGEFTSNSKIR--IFVRDVNNHPPSYNLNPAS--LTLEENQPPNILVGQINVKDVD-ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLI---CHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNAT--TTVNIEVTDENDNVPEIYLPKKLEIM--ENLKPYQFIGNIISEDKDFGNNGKTVFSLINS---KETDYFDLKRNG---SLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP---VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            V++ + D N   P+F   SF     + L      ++LP  IDKD+  +   V Y+L       +  +S   T    R R+      E+ N       Y+L   A + G   L++ +++ I +   +D    F +  +   + EN+ +   + +  AT     S + Y +V          F++  +G V+L++ LD E  ++Y++ V  T   G  T  + +   + V DVN++ P +  +  +    ++   P N ++  +   D D  ++    +  Q  +             P+  P T+  D  S V     +  T   Y I     D G   + + T+VI ++VL++   PPVF    Y   ++EN  +G +V+ V A   D   NA ++YS + G   + F I+ +SG IT  + LDRE   +Y L +        AL N    T V + +TD ND+ P  +     E    E++     IG + + D+D G++G+  +  + +   +  D FDL +     SL S  + D E  D     +R+                  + D NDN P     S H+ L                   + A V E+    +    A D D   N ++ ++   I   NQ    F +  DNG I++++ ++      + + + A D G
Sbjct:  875 VEVTVTDTNTYTPVFSRTSFWASKPDTLPTDTSVMQLP-IIDKDMGSLG-EVTYQL------IDPTVSAGETSGYDRFRVDDSGMIESTNILTANTLYKLQAKAKDGGSPALEATVDVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKSGSSSGIAYSLVGGQIENGNTMFSIDSSGRVLLLRQLDRERTKSYKLYVRGTYTGGSLTLATDVECLVTVTDVNDNTPLFTFDRVNKQFVVDNYAPANTIIATLRAVDSDEGANAQVTMSIQGTV-------------PSNAPFTI--DTPSNVLKTTTKLSTVIDYQITVRATDKGSPPQYSETTVI-VKVLNIQ-TPPVFGQAKYTVDVQENTKVGQQVISVKATYGD--SNALLQYSFVSGNLGDAFCID-SSGQITVAQPLDREVLPSYTLRVRV------ALGNNEDFTEVVVSLTDINDDSP-TFTKSVYEFFANEDISSGTSIGKVAATDRDSGSHGQISYRFLYASDIQSMDKFDLDQTTGIISLASGKSLDYE--DITIAEVRIY-----------------LRDINDNDPKFSAASYHAKLS------------------LDAPVLEH----VVQVTATDLDTANNGRIRYS---IVAGNQEGA-FQVLTDNGLIRVAKSLTTVAASSFLLTLEAADSG 1481          

HSP 7 Score: 93.5893 bits (231), Expect = 4.668e-19
Identity = 122/557 (21.90%), Postives = 234/557 (42.01%), Query Frame = 1
Query:  637 IVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTI-ELPKAIDKDVTEINSRVLYKLNK---ASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKS---LKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPV 2277
            + + D NDN P+F      K+     Y    TI    +A+D D    N++V   +     ++  F +     +TP   L       T   Y++T+ A + G     S   + ++++++    PVF +  + + + ENTK+G+ +I ++AT  D ++ L Y  VS       + F +  +G++ + + LD E   +Y + V    G     +++ + + D+N+  P++  +       E+      +G++   D D S  +G I  +  L  S++Q +             K+D+         +  T  I L       +E +T   V  + + D+NDN P FS   Y A++  +  + + V+QV A D D   N +I+YSI+ G     F +  ++G I   + L      ++ L + A +      K   N    V +      D  P+  L P  +   E +   Q +    +   +        + +++    D F +   +G + +    D E    Y +NI   D      RS++  + +N+++ NDN P+
Sbjct: 1092 VTVTDVNDNTPLFTFDRVNKQFVVDNYAPANTIIATLRAVDSD-EGANAQVTMSIQGTVPSNAPFTI-----DTPSNVLKTTTKLSTVIDYQITVRATDKGSPPQYSETTVIVKVLNIQ-TPPVFGQAKYTVDVQENTKVGQQVISVKATYGDSNALLQYSFVSGNLG---DAFCIDSSGQITVAQPLDREVLPSYTLRVRVALGNNEDFTEVVVSLTDINDDSPTFTKSVYEFFANEDISSGTSIGKVAATDRD-SGSHGQISYRF-LYASDIQSMD------------KFDL---------DQTTGIISLASGKSLDYEDITIAEV-RIYLRDINDNDPKFSAASYHAKLSLDAPVLEHVVQVTATDLDTANNGRIRYSIVAGNQEGAFQVLTDNGLIRVAKSLTTVAASSFLLTLEAADSGDPERKGSVNVQVNVFLP-----DGPPKFVLDPVIVNATEGIAANQRVAVAKAATSE-----ALKYEILSGNTNDMFAINPSSGVILTTRELDYEEATGYIMNIIARDTR---DRSASVQVIINVVNINDNEPM 1601          

HSP 8 Score: 92.0485 bits (227), Expect = 1.385e-18
Identity = 126/509 (24.75%), Postives = 216/509 (42.44%), Query Frame = 1
Query:  886 KNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLE---ATDKDKDSKLVYGMVSSTNSINRETFAVKETGEV-----ILMKTLDVEF-----RQTYEIPVYATD-GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRV-----QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVN--------------DNPPVF-SIPFYKAQIKENNNIGDKVLQVVAHDKD-DKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKIN-----YQLAILAINKSLKA-LFNATTTVNIEV--TDENDNVPEIYLPKKLE--IMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            +N Y LT++    G  E      ++I + D N+ +P F    +   + E    G  +  LE   A DKD+     Y +VS     N   + V ET  V     +++K  +        R +  + V A D G     ++I+I ++D NN+PP +  +  ++T+ E+ P    + ++  +D D    NG I         N QD                D  + V      LD +    RT+ +   D G   +  + +V      D++              + PPVF     +   I+E+  +   +  V A+D D    N Q++YS L G  N F+I+  SG +T   +L  E K N       L + A +++ ++   +A+  + IEV   D+N+N P ++ P++LE  + E+    + I  + + D D G++G+ V+S+I       F ++   G L      DRE    Y L I+  D      +SS   + V I D +D+ P
Sbjct:   95 ENLYVLTVLRRQRGMTEGGIAWTLRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEIVSG----NERGYFVAETKTVGAQKFLVLKATNTRIVRDPARPSITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTVGEDTPVMTSILRVRARDADIGR-NGGIYYY----LRNTQDFTI-------------DAITGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVFPEGSSFTLSIREDFPVNGAIQVVKANDPDAGSTNGQLRYS-LSGNNN-FAIDSTSGVVTLQTQL--EYKGNPAQDVIDLVVTATDRNGQSGALSASVNLKIEVLDVDDNNNAP-VFNPQQLELTVSEDSAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKAT-FPKSSNLYVMVKIQDVDDHFP 575          

HSP 9 Score: 90.1225 bits (222), Expect = 5.249e-18
Identity = 142/602 (23.59%), Postives = 246/602 (40.86%), Query Frame = 1
Query:  577 LNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEI----------------IDMNDCEPVFKKG-LFELVLDENTKIGKLIIKLEATDKDKDS---KLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFR-----QTYEIPVYATD-----GEFTSNSKIRIFVRDV--NNHPPSYNLNPASLTLEENQPPNILVGQINVKDV-DASD--VNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENN--NIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLD-REEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY-LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDND 2265
            + L V       L G   ++I I D N+N P+F    +   + E    V  +I   +A D D+   N  + Y L    D F +      T  +R  + +D+++     L + A + G     + + +++ I                 D N   PVF +G  F L + E+  +   I  ++A D D  S   +L Y +  + N      FA+  T  V+ ++T  +E++        ++ V ATD     G  +++  ++I V DV  NN+ P +N     LT+ E+      + +++  D  D SD  V   I     LG   +Q                 D+     LDRE+     + +   D     + +S   + +++ DV+D+ P F+ P Y A+  E +  N    V++VV HD  +     + YSI    +  F I P SG I     +D   E   Y+L + A + +      AT  VN+E+T + ++ P     P  + + EN      I N++         G+ V   I S+   +    ++G   S  +FD E  D+Y + I       P   +S+  + + I D+ D
Sbjct:  212 ITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTVGEDT-PVMTSILRVRARDADIGR-NGGIYYYLRNTQD-FTIDAI---TGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNR-PPVFPEGSSFTLSIREDFPVNGAIQVVKANDPDAGSTNGQLRYSLSGNNN------FAIDSTSGVVTLQT-QLEYKGNPAQDVIDLVVTATDRNGQSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDSAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLGVFQVQ-------------ATTGDLIVAAPLDREKMSFYDLVIKAEDKATFPK-SSNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKSPENTFVTVVKVVDHDLGES----VSYSITGASS--FKIVPTSGLILTTGPIDLTTEPSTYELVVTATSTNYGTTKRATGQVNVEITSKTESPPVFKNTPYAVSVPENQGS---IANLVCV-AAIDTKGQPVIYSIESRGEPFGIDSKSGRFSSLQSFDYETADKYRIQISAQSGIAPNIMTSSSDVAITIKDEKD 775          

HSP 10 Score: 77.7962 bits (190), Expect = 2.702e-14
Identity = 161/684 (23.54%), Postives = 270/684 (39.47%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKT-----IELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETK-NFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE----FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRC--QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKIN----------YQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMEN--LKPYQFIGNIISEDKDFGNNGKTVFSLINSK---ETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            V + I D +D+ P F    +  K  E      K+     + + K +D D+ E    V Y +  AS +F++  +   +  +  T  ID  T+ + YEL + A +  +   K +  ++ +EI    +  PVFK   + + + EN      ++ + A D  K   ++Y + S       E F +  ++G    +++ D E    Y I + A  G      TS+S + I ++D    PP ++ +   +++ E       + +  ++ VD   ++  + C  +E   +  L  L  V D  E    ++        LD   A   T  +   D        +T V  + V D N   PVFS   + A   +       V+Q+   DKD     ++ Y +++ PT   S    SG+     R+D    I           Y+L   A +    AL  AT  V I V   +D        P    I EN  L    F           G++    +SL+  +       F +  +G +      DRE    Y L +R    G  ++ ++     V + D NDN P+ +     K   Q    N              Y      IAT  A D+D+G NAQVT +++    SN  AP F ID  +  +K +  +S   + DY++ + A DKG
Sbjct:  563 VMVKIQDVDDHFPQFTQPMYYAKAPE------KSPENTFVTVVKVVDHDLGE---SVSYSITGAS-SFKIVPT---SGLILTTGPIDLTTEPSTYELVVTATSTNYGTTKRATGQVNVEITSKTESPPVFKNTPYAVSVPENQGSIANLVCVAAIDT-KGQPVIYSIES-----RGEPFGIDSKSGRFSSLQSFDYETADKYRIQISAQSGIAPNIMTSSSDVAITIKD-EKDPPQFSQSEYKVSVPEGASVRSTLSR-GIRFVDEDTLSTQLECSMEEMTSRIPLDYLSVVQDGGECKFVIEK------TLDTFVASKFTFDMKVTDKNFPGMFATTKV-EVTVTDTNTYTPVFSRTSFWASKPDTLPTDTSVMQLPIIDKDMGSLGEVTYQLID-PT--VSAGETSGYDRF--RVDDSGMIESTNILTANTLYKLQAKAKDGGSPAL-EATVDVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKS----GSSSGIAYSLVGGQIENGNTMFSIDSSGRVLLLRQLDRERTKSYKLYVRGTYTGGSLTLATDVECLVTVTDVNDNTPLFTFDRVNK---QFVVDN--------------YAPANTIIATLRAVDSDEGANAQVTMSIQGTVPSN--AP-FTIDTPSNVLKTTTKLS--TVIDYQITVRATDKG 1186          

HSP 11 Score: 64.6994 bits (156), Expect = 2.603e-10
Identity = 153/666 (22.97%), Postives = 278/666 (41.74%), Query Frame = 1
Query:  547 KFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDE---NTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVIL-MKTLDVEFRQTYEIPVYATDGEFTSNS-KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF--VPDPAEYPLTV--KYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQV----------LDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF---FSINPNSGWITAIRRLDREE----KINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLE---SKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTF 2448
            KF  D   G ++L      + +   +  V+I + D NDN P F   S+  K+      +   +++  A D D T  N R+ Y +   +     Q+  DN   +R+ K +     + + LTL A ++G  E K  + +++ +  + D  P F       VLD    N   G    +  A  K   S+ +   + S N+   + FA+  +  VIL  + LD E    Y + + A D    S S ++ I V ++N++ P +              P    GQI+ K V      G I  +      ++ D  +  +   AE   T+  +  +  +  L    +P R   +   DGGL +++ + +V+ + V          + V +     ++     +I E+ ++   VL+V A     K    I YS ++   +    FS+  N G I    +LD E+       ++L + A  ++      +T +V I + D ND+ P   L      + EN      +  I + D+D G+ G   +  + +   ++F +  N G+L +K +FDRE +  + + +   D G  P + S    + V ++D+ND+ P         + DQ E   S + S  +G+ I++              VA D D G+NA++ +
Sbjct: 1358 KFDLDQTTGIISLASGKSLDYEDITIAEVRIYLRDINDNDPKFSAASYHAKLSLDAPVLEHVVQV-TATDLD-TANNGRIRYSIVAGNQEGAFQVLTDNG-LIRVAKSLTTVAASSFLLTLEAADSGDPERKGSVNVQVNVF-LPDGPPKF-------VLDPVIVNATEGIAANQRVAVAKAATSEALKYEILSGNT--NDMFAINPSSGVILTTRELDYEEATGYIMNIIARDTRDRSASVQVIINVVNINDNEPMF--------------PGETNGQIDRK-VAGPFAPGVIATRLTAVDKDIGDRVYYKISIEAENYFTIDERGQLICKNDLKGIASPFR-FTIEARDGGLPQKVHTANVLLVFVNYRPKQQPVRVIVPETTRAXTVITRVPRILESLSVNSDVLKVSAQAPGGK---SIVYSPVKANADIDEKFSVETN-GQIKTASQLDYEQLSPGDKTFKLQVRAQEENTN--LYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVITIKATDRDTGDAGVVTY-FLKAGSDEHFAIDVNSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPP---------QFDQAEFQTSVSESATIGTSILE-------------VVATDQDIGDNAKLEY 1965          

HSP 12 Score: 60.077 bits (144), Expect = 6.278e-9
Identity = 114/475 (24.00%), Postives = 197/475 (41.47%), Query Frame = 1
Query: 1261 IRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSN---LQDLKFVPDPAEYPLTVKYDMFSRVQLDREEA-PTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINK--SLKALFNATTTVNIEVTDEND----------------NVPEIYLPK----KLEIMENLKPYQFIGNIISEDKDFGN-NGKTVFSLINSKETDYFDLKRNGSLFSKITFD----RELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +RI V D NN  P++  +     + E       VG +     +  D +G  R +   G      + + K V   A+  L +K    +  ++ R+ A P+ T+ +  +DGG    L  T+ I + + D N+NPPVF    Y   + E+  +   +L+V A D D   N  I Y +    T  F+I+  +G I  IR LD +      L + A ++  S KA       VN++VT  +D                N P ++ P+     L I E+      I  + + D D G+ NG+  +SL  +            +L +++ +     +++ D        N     +S S    I V  +DDN+NAPV +      +Q +L    +S  +G  I + S             A D+D G + QV ++   I   + +  +F +    G + ++  + R+ +  Y + I A DK 
Sbjct:  118 LRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEIVSGNERGYFVAETKTVG--AQKFLVLKA---TNTRIVRDPARPSITLTVRANDGG---GLHGTTRIQIDIQDTNNNPPVFEKSEYTVTVGEDTPVMTSILRVRARDADIGRNGGIYYYLRN--TQDFTIDAITGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKA-----ANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVF-PEGSSFTLSIREDFPVNGAIQVVKANDPDAGSTNGQLRYSLSGNNNFAIDSTSGVVTLQTQLEYKGNPAQDVIDLVVTATDRNGQSGALSASVNLKIEVLDVDDNNNAPVFN-----PQQLELTVSEDSA-VGRTIRRVS-------------ATDSDDGSDGQVVYS---IIQGSGLG-VFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKA 553          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO46484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ20])

HSP 1 Score: 192.971 bits (489), Expect = 1.709e-49
Identity = 200/750 (26.67%), Postives = 346/750 (46.13%), Query Frame = 1
Query:  463 DKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQ-LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT-FELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHD--ELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-------KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNL--NPASLT------LEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDD---KENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKIN-YQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK--KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPI-SRSSTKPICVNILDDNDNAPVI---SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSN-----QIAPLFIIDEDNGSIKISRI---MSRDVIGDYKMKIIACDKG 2592
            D +E F+++    + KTA ++D E L P      G     L V   +EN  L    +V I + D ND+ P F + ++  +++E    +G T+   KA D+D  +    V Y L   SD  F + +   N+  L   K  D E ++ + + +IA + G++   L   + +K+ ++D ND  P F +  F+  + E+  IG  I+++ ATD+D   ++KL Y +   +    R  FAV       +  GEV +   LD E + +Y I V ATDG F++ +++ I + D N+  P +     P  L+      + E     + V ++   D D+ ++   +      G S+   +    +  ++   V         LDRE  P  +  ++  DG +H   T ++ I + V D+NDN P F    Y   ++EN   G  V+ V AHD DD     NA+I+Y++ +     F I+ N+  +T    LDRE   N + + +LA ++    L + T    I VTD ND+ P ++  +  +  + E+++P   + ++ + D D G N +  F + +  E   F +    G++      +  L+  Y L + V+D G+P+ S +S   + + I D NDNAP+      + T+ E            +GS ++           + TAV  D D G+NA+  F   DIT  N     ++ P    + DN S+ I R    + R+    + ++I A D G
Sbjct: 2478 DIDEKFSVETNGQI-KTASQLDYEQLSP------GDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTFDLGNYDARVRENA-PIGTTVITIKATDRDTGDAGV-VTYFLKAGSDEHFAIDV---NSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEYFI---SGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATDGRFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSPNIQYTLE-----GSSSYFTIAARQEGGKF---VGIISTGSQPLDREATPIFSFNVLAKDG-VH---TGSAYIEINVTDINDNQPRFPNSLYVGYVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTLTDNAGGKFKIDANTALVTTEEILDRETSPNSFTITVLATDQGANKL-STTKVATIYVTDANDHAP-VFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGPNAELEFVVTHGNEPAAFYVDPSKGTVHVFDILNYTLRKSYNLTVTVSDRGMPVLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAED---------LAVGSPVV-----------VVTAV--DYDSGDNAKFVF---DITGGNPNDLFEVVP----NPDNSSLGIVRTRLPLDRETTPIHHLEITAKDTG 3169          

HSP 2 Score: 145.206 bits (365), Expect = 9.440e-35
Identity = 170/684 (24.85%), Postives = 301/684 (44.01%), Query Frame = 1
Query:  328 GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVIN----VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQI-----SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFK--------KGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGE--VILMKT----LDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASL---TLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAP-TRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG--PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALF-NATTTVNIEVTDENDNVPEIYLPKKL--EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN------GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDND 2265
            GN +  ++EN P G  V  I +      +  +        YF     +E+F +D  S  L T K  D E          G    +++V    +    G ++    VK+++ D+ND+ P F    F   + E    +G +I    A D+D+ + N+++ Y ++     F   +     S      +++   +D+ETK+ Y + + A +       +   + I I D ND  P+F           ++   + E T  G  ++K+ A D D    + Y +  S++     T A ++ G   V ++ T    LD E    +   V A DG  T ++ I I V D+N++ P +   P SL    +EEN+     V  +   D D   + G+   +  L  ++    KF  D A   L    ++     LDRE +P + TI ++  D G + +L++T V T+ V D ND+ PVF+   ++  + E+   G  V  V A D D   NA++++ +  G  P  F+ ++P+ G +     L+   + +Y L +   ++ +  L  N+   V I +TD NDN P I++P +    + E+L     +  + + D D G+N K VF +      D F++  N      G + +++  DRE    + L I   D G    ++    + + +LD ND
Sbjct: 2545 GNYDARVRENAPIGTTVITIKATDRDTGDAGVVT------YFLKAGSDEHFAIDVNSGTLTTKKSFDRE----------GQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESAT-IGTSILEVVATDQDIGD-NAKLEYFISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATDG---RFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDS-PNIQYTLEGSSSYF---TIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLAKDGVHTGSAYIEINVTDINDNQPRF---PNSLYVGYVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTL--TDNAGGKFKID-ANTALVTTEEI-----LDRETSPNSFTITVLATDQGAN-KLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGPNAELEFVVTHGNEPAAFY-VDPSKGTVHVFDILNYTLRKSYNLTVTVSDRGMPVLSDNSPAYVLITITDANDNAP-IFIPNQYNKTVAEDLAVGSPVVVVTAVDYDSGDNAKFVFDITGGNPNDLFEVVPNPDNSSLGIVRTRLPLDRETTPIHHLEITAKDTGGLTGKAH---VWLTLLDVND 3186          

HSP 3 Score: 130.183 bits (326), Expect = 2.825e-30
Identity = 178/688 (25.87%), Postives = 298/688 (43.31%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAID----KDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKG--LFELVLDENTKIGKLIIKLEATDKDKD--SKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTV---KYDMFSRVQLDREEAPTRTIYLICHDGGL----HERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNAT-----TTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLI--NSKETDYFDLKRNGSLFSKITFDREL----KDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L   ++V I + + ND  P F    +  K+ E   GVG  I    A D     D T    ++ Y + +A  +F++    D T  + + + +DYET     L ++A + G     +   + + + D ND  PVFK+   LF +  D +T  G +I  + A D+D+D   K+ Y +VS T   N  T    ETG + + K L    +  Y + + ATD   ++++++R+ V   N + P +       T++E    N+L GQ+ +  V A+D     R Q   G++   + K VP   +   T+     ++ +   LDRE   T T+ +   DGG      ERL S   + ++V DVNDN P F    Y   I+    IG  VL V A D D  +NA+I Y+  + P + F I+  SG I     L   + +N ++ ++A N       +A      T V I +TD    V +    K L     L+      +++            V+S +  N+   + F ++ NG + +    D E        + L +R  +    +   ST  + + + D ND+ P                     +LG+    A V EN   G  + T  A D D G+   VT+ ++  +D +     F ID ++G++   +   R+    + + +IA DKG
Sbjct: 1995 LSSEVDVTITVINANDFHPYFDDPVYRLKVPE-SRGVGDVIMTVTARDCDCPSDCTCQVGQLKYSV-EAGTSFDI----DQTGAIVVARTLDYETSKVQVLKVMASDQGEKVFTAVTFVVVTLEDTNDNAPVFKRNDYLFRMTADAST--GSMIGAVIARDQDQDDIEKVRYSVVSGTE-FNVNT----ETGVLTVAKDLSTGAKSEYSMEIRATDSTKSNDARVRVNVEYKNMYRPEFT-KCGKATIQE----NLLKGQL-IATVTATD-----RDQ---GRNGEVEYKIVPVGGQDFFTINNKTGEVITTSSLDRETKATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSFITRAYLGSIQNTKPIGTSVLTVSATDPDAGDNAKITYA-FKSPNDKFEIDSTSGDIRTKVALTGTKDVNEKMTVVASNTEAIQGGDANNRDRETEVTIYITDLAPPVCD----KNLFTARILESLSVNSDVLKVSAQAPGGKSIVYSPVKANADIDEKFSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNL--YSTCSVAITLEDVNDDKPTF-------------------DLGN--YDARVRENAPIGTTVITIKATDRDTGDAGVVTYFLKAGSDEH-----FAIDVNSGTLTTKKSFDREGQSLFSVIVIARDKG 2622          

HSP 4 Score: 116.701 bits (291), Expect = 4.321e-26
Identity = 163/687 (23.73%), Postives = 289/687 (42.07%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTP---RLRLTKDIDYETKN------FYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYAT--DGEFTSNSKIR--IFVRDVNNHPPSYNLNPAS--LTLEENQPPNILVGQINVKDVD-ASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLI---CHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNAT--TTVNIEVTDENDNVPEIYLPKKLEIM--ENLKPYQFIGNIISEDKDFGNNGKTVFSLINS---KETDYFDLKRNG---SLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP---VISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            V++ + D N   P+F   SF     + L      ++LP  IDKD+  +   V Y+L       +  +S   T    R R+      E+ N       Y+L   A + G   L++ +++ I +   +D    F +  +   + EN+ +   + +  AT     S + Y +V          F++  +G V+L++ LD E  ++Y++ V  T   G  T  + +   + V DVN++ P +  +  +    ++   P N ++  +   D D  ++    +  Q  +             P+  P+T+  D  S V     +  T   Y I     D G   + + T+VI ++VL++   PPVF    Y   ++EN  +G +V+ V A   D   NA ++YS + G   + F I+ +SG IT  + LDRE   +Y L +        AL N    T V + +TD ND+ P  +     E    E++     IG + + D+D G++G+  +  + +   +  D FDL +     SL S  + D E    + L +R  D G     S+   + + + D NDN P     S H+ L                   + A V E+    +    A D D   N ++ ++   I   NQ    F +  DNG I++++ ++      + + + A D G
Sbjct:  875 VEVTVADTNTYTPVFSRTSFWASKPDTLPTDTSVMQLP-IIDKDMGSLG-EVTYQL------IDPTVSAGETSGYDRFRVDDSGKIESTNILTANTLYKLQAKAKDGGSPALEATVDVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKSGSSSGIAYSLVGGQIENGNTMFSIDSSGRVLLLRQLDRERTKSYKLYVRGTYTGGSLTLATDVECLVTVTDVNDNTPLFTFDRVNKQFVVDNYAPANTIIATLRAVDSDEGANAQVTMSIQGTV-------------PSNAPITI--DTPSNVLKTTTKLSTVIDYQITVRATDKGSPPQYSETTVI-VKVLNIQ-TPPVFGQAKYTVDVQENTKVGQQVISVKATYGD--SNALLQYSFVSGNLGDAFCID-SSGQITVAQPLDREVLPSYTLRVRV------ALGNNEDFTEVVVSLTDINDDSP-TFTKSVYEFFANEDISSGTSIGKVAATDRDSGSHGQISYRFLYASDIQSMDKFDLDQTTGIISLASGKSLDYEDISMHVLFVRAEDNGAN-KLSAIAEVRIYLRDINDNDPKFSAASYHAKLS------------------LDAPVLEH----VVQVTATDLDTANNGRIRYS---IVAGNQEGA-FQVLTDNGLIRVAKSLTTVAASSFLLTLEAADSG 1499          

HSP 5 Score: 115.931 bits (289), Expect = 7.112e-26
Identity = 140/586 (23.89%), Postives = 251/586 (42.83%), Query Frame = 1
Query:  724 GKTIELPKAIDKDVTEINSRVLYKLN--KASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGH-----DELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPP----NILVGQINVKDVDASDVNGDI---RCQEPLGKSNLQDLKFVPDPAEYPLTVKYD------MFSRVQLDREE-APT-RTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLK-ALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGN----IISEDKDFGNNGKTVFSLINSKETDYFDLK---RNGSLFSKITFDREL----KDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVY 2373
            G+ I    A D+D    N  V YK+      D F +    + T  +  T  +D ETK  Y + + A + GH     + L SY  +++E+ D+ND  P F    +   +     IG  ++ + ATD D   ++K+ Y   S  +    ++ +     +V L  T DV  + T    V A++ E            D NN      +   ++ + +  PP    N+   +I    +++  VN D+     Q P GKS    + + P  A   +  K+       + +  QLD E+ +P  +T  L       +  L ST  + + + DVND+ P F +  Y A+++EN  IG  V+ + A D+D  +   + Y +  G    F+I+ NSG +T  +  DRE +  + + ++A +K       +    V + V DEND+ P+     + E   ++     IG     +++ D+D G+N K  + +       +F ++   ++G  + ++  D  L    K  Y +++   D       S+T  + + I D ND  P+    +T      + +   S+  GS +    VY
Sbjct: 2235 GQLIATVTATDRDQGR-NGEVEYKIVPVGGQDFFTIN---NKTGEVITTSSLDRETKATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSFITRAYLGSIQNTKPIGTSVLTVSATDPDAGDNAKITYAFKSPNDKFEIDSTSGDIRTKVALTGTKDVNEKMT----VVASNTEAIQGG-------DANNRDRETEV---TIYITDLAPPVCDKNLFTARI----LESLSVNSDVLKVSAQAPGGKS----IVYSPVKANADIDEKFSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVITIKATDRDTGDAGVVTYFLKAGSDEHFAIDVNSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQF---DQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEYFISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATDGRF----SATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVY 2787          

HSP 6 Score: 115.161 bits (287), Expect = 1.221e-25
Identity = 160/683 (23.43%), Postives = 294/683 (43.05%), Query Frame = 1
Query:  613 LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTF-------ELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDEN----TKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQT-YEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF-VPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVL-DVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGV---PISR-SSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSI--KISRIMSRDVIGDYKMKIIACD 2586
            L   I+V+I + D NDN P F M S + ++           +L +A D D +  N  + ++L      F       ++++ +   PRL+ ++         Y L +I ++ G   +  +   + IE +      PVF +  +   + E     TKIG +            ++L Y ++   N+ N+  F  K+ G+++L   LD E  Q+ + + V A +      +S   + I V + N+  P ++     L + E++    ++  +  +D D      D  CQ       +  LK+ V     + +     +     LD E +  + + ++  D G  E++ +     +  L D NDN PVF    Y  ++  + + G  +  V+A D+D  +  +++YS++ G    F++N  +G +T  + L    K  Y + I A + +     +A   VN+E   +N   PE     K  I ENL   Q I  + + D+D G NG+  + ++     D+F +  + G + +  + DRE K  Y + I   D G    P  R  S   + V + D NDN P      +   +  L S  N++ +G+ ++  S             A D D G+NA++T+  +   D       F ID  +G I  K++   ++DV  + KM ++A +
Sbjct: 1794 LENYIDVEITVLDVNDNAPFFTMISTLGRVNSNSRAGATAFQL-QARDLD-SGSNGLIGFQLENIPTPFMINPLTRQIEVGQ---PRLQTSR---------YGLDIIPFDYGKPSVNGTKATVDIETV---QSPPVFNESSYTFTVSERAPTMTKIGDVTAV-----SVSGARLSYTIIEG-NTGNK--FLAKDNGDIVLNSLLDFERDQSVFNLKVEAKEQIPKGLSSEVDVTITVINANDFHPYFDDPVYRLKVPESRGVGDVIMTVTARDCDCP---SDCTCQ-------VGQLKYSVEAGTSFDIDQTGAIVVARTLDYETSKVQVLKVMASDQG--EKVFTAVTFVVVTLEDTNDNAPVFKRNDYLFRMTADASTGSMIGAVIARDQDQDDIEKVRYSVVSGTE--FNVNTETGVLTVAKDLSTGAKSEYSMEIRATDSTKSN--DARVRVNVEY--KNMYRPEFTKCGKATIQENLLKGQLIATVTATDRDQGRNGEVEYKIVPVGGQDFFTINNKTGEVITTSSLDRETKATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYP------SFITRAYLGSIQNTKPIGTSVLTVS-------------ATDPDAGDNAKITYAFKSPNDK------FEIDSTSGDIRTKVALTGTKDV--NEKMTVVASN 2406          

HSP 7 Score: 104.375 bits (259), Expect = 2.095e-22
Identity = 126/555 (22.70%), Postives = 242/555 (43.60%), Query Frame = 1
Query:  637 IVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTI-ELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDL-KFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKS---LKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPV 2277
            + + D NDN P+F      K+     Y    TI    +A+D D    N++V   +     +    I+ D TP   L       T   Y++T+ A + G     S   + ++++++    PVF +  + + + ENTK+G+ +I ++AT  D ++ L Y  VS       + F +  +G++ + + LD E   +Y + V    G     +++ + + D+N+  P++  +       E+      +G++   D D S  +G I  +  L  S++Q + KF  D      T    + S   LD E+     +++   D G + +L++ + + + + D+NDN P FS   Y A++  +  + + V+QV A D D   N +I+YSI+ G     F +  ++G I   + L      ++ L + A +      K   N    V +      D  P+  L P  +   E +   Q +    +   +        + +++    D F +   +G + +    D E    Y +NI   D      RS++  + +N+++ NDN P+
Sbjct: 1092 VTVTDVNDNTPLFTFDRVNKQFVVDNYAPANTIIATLRAVDSD-EGANAQVTMSIQGTVPS-NAPITID-TPSNVLKTTTKLSTVIDYQITVRATDKGSPPQYSETTVIVKVLNIQ-TPPVFGQAKYTVDVQENTKVGQQVISVKATYGDSNALLQYSFVSGNLG---DAFCIDSSGQITVAQPLDREVLPSYTLRVRVALGNNEDFTEVVVSLTDINDDSPTFTKSVYEFFANEDISSGTSIGKVAATDRD-SGSHGQISYRF-LYASDIQSMDKFDLDQT----TGIISLASGKSLDYEDISMHVLFVRAEDNGAN-KLSAIAEVRIYLRDINDNDPKFSAASYHAKLSLDAPVLEHVVQVTATDLDTANNGRIRYSIVAGNQEGAFQVLTDNGLIRVAKSLTTVAASSFLLTLEAADSGDPERKGSVNVQVNVFLP-----DGPPKFVLDPVIVNATEGIAANQRVAVAKAATSE-----ALKYEILSGNTNDMFAINPSSGVILTTRELDYEEATGYIMNIIARDTR---DRSASVQVIINVVNINDNEPM 1619          

HSP 8 Score: 97.4413 bits (241), Expect = 3.230e-20
Identity = 128/509 (25.15%), Postives = 215/509 (42.24%), Query Frame = 1
Query:  886 KNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLE---ATDKDKDSKLVYGMVSSTNSINRETFAVKETGEV-----ILMKTLDVEF-----RQTYEIPVYATD-GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRV-----QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVN--------------DNPPVF-SIPFYKAQIKENNNIGDKVLQVVAHDKD-DKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKIN-----YQLAILAINK-SLKALFNATTTVNIEV--TDENDNVPEIYLPKKLE--IMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            +N Y LT++    G  E      ++I + D N+ +P F    +   + E    G  +  LE   A DKD+     Y +VS     N   + V ET  V     +++K  +        R +  + V A D G     ++I+I ++D NN+PP +  +  ++T+ E+ P    + ++  +D D    NG I         N QD                D  + V      LD +    RT+ +   D G   +  + +V      D++              + PPVF   P +   I+E+  +   +  V A+D D    N Q++YS L G  N F+I+  SG +T   +L  E K N       L + A ++  L    +A+  + IEV   D+N+N P ++ P++LE  + E+    + I  + + D D G++G+ V+S+I       F ++   G L      DRE    Y L I+  D      +SS   + V I D +D+ P
Sbjct:   95 ENLYVLTVLRRQRGMTEGGIAWTLRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEIVSG----NERGYFVAETKTVGAQKFLVLKATNTRIVRDPARPSITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTIGEDTPVMTSILRVRARDADIGR-NGGIYYY----LRNTQDFTI-------------DAITGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVFPEGPSFTLSIREDFPVNGAIQVVKANDLDAGSTNGQLRYS-LSGNNN-FAIDSTSGVVTLQTQL--EYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAP-VFNPQQLELTVSEDTAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKAT-FPKSSNLYVMVKIQDVDDHFP 575          

HSP 9 Score: 93.2041 bits (230), Expect = 6.400e-19
Identity = 97/390 (24.87%), Postives = 177/390 (45.38%), Query Frame = 1
Query:  901 LTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVR-DVN--------------NHPPSYNLNPA-SLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTR----TIYLICHDGGLHERLTSTSVITLQVLDVNDN--PPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTT--VNIEVTDENDNVPEIYLP 1977
            +TL    N    L     I+I+I D N+  PVF+K  + + + E+T +   I+++ A D D  ++  + Y +       N + F +   TG +  ++ LD +  Q   + V A D       +N  +++ +R D++              N PP +   P+ +L++ E+ P N  +  +   D+DA   NG +R    L  +N     F  D     +T++       QL+ +  P +     +       GL   L+++  + ++VLDV+DN   PVF+    +  + E+  +G  + +V A D DD  + Q+ YSI++G     F +   +G +     LDRE+   Y L I A +   KA F  ++   V +++ D +D+ P+   P
Sbjct:  212 ITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTIGEDTPVMTSILRVRARDADIGRNGGIYYYLR------NTQDFTIDAITGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVFPEGPSFTLSIREDFPVNGAIQVVKANDLDAGSTNGQLRYS--LSGNN----NFAIDSTSGVVTLQ------TQLEYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDTAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAED---KATFPKSSNLYVMVKIQDVDDHFPQFTQP 580          

HSP 10 Score: 87.4261 bits (215), Expect = 3.606e-17
Identity = 143/602 (23.75%), Postives = 246/602 (40.86%), Query Frame = 1
Query:  577 LNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEI----------------IDMNDCEPVFKKG-LFELVLDENTKIGKLIIKLEATDKDKDS---KLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQ-----TYEIPVYATD-----GEFTSNSKIRIFVRDV--NNHPPSYNLNPASLTLEENQPPNILVGQINVKDV-DASD--VNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENN--NIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLD-REEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY-LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDND 2265
            + L V       L G   ++I I D N+N P+F    +   I E    V  +I   +A D D+   N  + Y L    D F +      T  +R  + +D+++     L + A + G     + + +++ I                 D N   PVF +G  F L + E+  +   I  ++A D D  S   +L Y +  + N      FA+  T  V+ ++T  +E++        ++ V ATD     G  +++  ++I V DV  NN+ P +N     LT+ E+      + +++  D  D SD  V   I     LG   +Q                 D+     LDRE+     + +   D     + +S   + +++ DV+D+ P F+ P Y A+  E +  N    V++VV HD  +     + YSI    +  F I P SG I     +D   E   Y+L + A + +      AT  VN+E+T + ++ P     P  + + EN      I N++         G+ V   I S+   +    ++G   S  +FD E  D+Y + I       P   +S+  + + I D+ D
Sbjct:  212 ITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTIGEDT-PVMTSILRVRARDADIGR-NGGIYYYLRNTQD-FTIDAI---TGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNR-PPVFPEGPSFTLSIREDFPVNGAIQVVKANDLDAGSTNGQLRYSLSGNNN------FAIDSTSGVVTLQT-QLEYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDTAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLGVFQVQ-------------ATTGDLIVAAPLDREKMSFYDLVIKAEDKATFPK-SSNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKSPENTFVTVVKVVDHDLGES----VSYSITGACS--FKIVPTSGLILTTGPIDLTTEPSTYELVVTATSSNYGTTKRATGQVNVEITSKTESPPVFKNTPYAISVPENQGS---IANLVCV-AAIDTKGQPVIYSIESRGEPFGIDSKSGRFSSLQSFDYETADKYRIQISAQSGIAPNIMTSSSDVAITIKDEKD 775          

HSP 11 Score: 85.1149 bits (209), Expect = 1.538e-16
Identity = 151/643 (23.48%), Postives = 271/643 (42.15%), Query Frame = 1
Query:  643 IHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSY-LEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIF--------VRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLT--STSVITLQVLDVNDN--------------PPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF---FSINPNSGWITAIRRLDREE----KINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLE---SKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTF 2448
            + D NDN P+F    ++ ++       G  I    A D+D  +I  +V Y +   +   E  ++ + T  L + KD+    K+ Y + + A     D  KS    +++ +   N   P F K   +  + EN   G+LI  + ATD+D  ++ ++ Y +V       ++ F +  +TGEVI   +LD E + TY + + A DG    +   R+         V+DVN++ PS+       +++  +P    V  ++  D DA D N  I                      Y      D F   ++D      RT   +     ++E++T  +++   +Q  D N+               PPV     + A+I E+ ++   VL+V A     K    I YS ++   +    FS+  N G I    +LD E+       ++L + A  ++      +T +V I + D ND+ P   L      + EN      +  I + D+D G+ G   +  + +   ++F +  N G+L +K +FDRE +  + + +   D G  P + S    + V ++D+ND+ P         + DQ E   S + S  +G+ I++              VA D D G+NA++ +
Sbjct: 2111 LEDTNDNAPVFKRNDYLFRMTADA-STGSMIGAVIARDQDQDDIE-KVRYSVVSGT---EFNVNTE-TGVLTVAKDLSTGAKSEYSMEIRAT----DSTKSNDARVRVNVEYKNMYRPEFTK-CGKATIQENLLKGQLIATVTATDRDQGRNGEVEYKIVPVG---GQDFFTINNKTGEVITTSSLDRETKATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSFITRAYLGSIQNTKPIGTSVLTVSATDPDAGD-NAKI---------------------TYAFKSPNDKF---EIDSTSGDIRTKVALTGTKDVNEKMTVVASNTEAIQGGDANNRDRETEVTIYITDLAPPVCDKNLFTARILESLSVNSDVLKVSAQAPGGK---SIVYSPVKANADIDEKFSVETN-GQIKTASQLDYEQLSPGDKTFKLQVRAQEENTN--LYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVITIKATDRDTGDAGVVTY-FLKAGSDEHFAIDVNSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPP---------QFDQAEFQTSVSESATIGTSILE-------------VVATDQDIGDNAKLEY 2685          

HSP 12 Score: 73.9442 bits (180), Expect = 4.143e-13
Identity = 167/720 (23.19%), Postives = 284/720 (39.44%), Query Frame = 1
Query:  514 AKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVIN--VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETK-NFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE----FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRC--QEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKIN----------YQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL-PKKLEIMEN--LKPYQFIGNIISEDKDFGNNGKTVFSLINSK---ETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            A   DL +  P   + + + F +LV+    +       N  V + I D +D+ P F    +  K  E        + + K +D D+ E    V Y +  A  +F++  +   +  +  T  ID  T+ + YEL + A ++ +   K +  ++ +EI    +  PVFK   + + + EN      ++ + A D  K   ++Y + S       E F +  ++G    +++ D E    Y I + A  G      TS+S + I ++D    PP ++ +   +++ E       + +  ++ VD   ++  + C  +E   +  L  L  V D  E    ++        LD   A   T  +   D        +T V  + V D N   PVFS   + A   +       V+Q+   DKD     ++ Y +++ PT   S    SG+     R+D   KI           Y+L   A +    AL  AT  V I V   +D        P    I EN  L    F           G++    +SL+  +       F +  +G +      DRE    Y L +R    G  ++ ++     V + D NDN P+ +     K   Q    N              Y      IAT  A D+D+G NAQVT +++    SN  AP+  ID  +  +K +  +S   + DY++ + A DKG
Sbjct:  524 ATTGDLIVAAP--LDREKMSFYDLVIKAEDKATFPKSSNLYVMVKIQDVDDHFPQFTQPMYYAKAPE-KSPENTFVTVVKVVDHDLGE---SVSYSITGAC-SFKIVPT---SGLILTTGPIDLTTEPSTYELVVTATSSNYGTTKRATGQVNVEITSKTESPPVFKNTPYAISVPENQGSIANLVCVAAIDT-KGQPVIYSIES-----RGEPFGIDSKSGRFSSLQSFDYETADKYRIQISAQSGIAPNIMTSSSDVAITIKD-EKDPPQFSQSEYKVSVPEGASVRSTLSR-GIRFVDEDTLSTQLECSMEEMTSRIPLDYLSVVQDGGECKFVIEK------TLDTFVASKFTFDMKVTDKNFPGMFATTKV-EVTVADTNTYTPVFSRTSFWASKPDTLPTDTSVMQLPIIDKDMGSLGEVTYQLID-PT--VSAGETSGYDRF--RVDDSGKIESTNILTANTLYKLQAKAKDGGSPAL-EATVDVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKS----GSSSGIAYSLVGGQIENGNTMFSIDSSGRVLLLRQLDRERTKSYKLYVRGTYTGGSLTLATDVECLVTVTDVNDNTPLFTFDRVNK---QFVVDN--------------YAPANTIIATLRAVDSDEGANAQVTMSIQGTVPSN--API-TIDTPSNVLKTTTKLS--TVIDYQITVRATDKG 1186          

HSP 13 Score: 73.9442 bits (180), Expect = 4.863e-13
Identity = 133/582 (22.85%), Postives = 234/582 (40.21%), Query Frame = 1
Query:  952 EIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDS------KLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQ-IKENNNIGDKVLQVV-AHDKDDKENAQIKYSILEG--PTNF-FSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK--LEIMENLKPYQFIGNIISEDKDFGN-NGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVT--------------FTMEDITDSNQIAP-------------LFIIDEDNGSIKIS-----RIMSRDV 2550
            ++++ + D N   PVF +  F     +       +++L   DKD  S      +L+   VS+  +   + F V ++G++     L       Y++   A DG      +   + I V   ++ P  ++ NP S ++ EN P N  V +       +S     I      G+    +  F  D +   L ++       QLDRE   +  +Y+     G    L +     + V DVNDN P+F+      Q + +N    + ++  + A D D+  NAQ+  SI +G  P+N   +I+  S  +    +L     I+YQ+ + A +K     ++ TT +   V   N   P ++   K  +++ EN K  Q    +IS    +G+ N    +S ++    D F +  +G +      DRE+   Y L +RV  LG   +      + V++ D ND++P  +             K+  +   +E I +      G  I    A D D G + Q++              F ++  T    +A              LF+  EDNG+ K+S     RI  RD+
Sbjct:  874 KVEVTVADTNTYTPVFSRTSFWASKPDTLPTDTSVMQLPIIDKDMGSLGEVTYQLIDPTVSAGETSGYDRFRVDDSGKIESTNILTAN--TLYKLQAKAKDGGSPALEATVDVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKSGSS---SGIAYSLVGGQIENGNTMFSIDSSGRVLLLR-------QLDRERTKSYKLYVRGTYTGGSLTLATDVECLVTVTDVNDNTPLFTFDRVNKQFVVDNYAPANTIIATLRAVDSDEGANAQVTMSI-QGTVPSNAPITIDTPSNVLKTTTKL--STVIDYQITVRATDKGSPPQYSETTVI---VKVLNIQTPPVFGQAKYTVDVQENTKVGQ---QVISVKATYGDSNALLQYSFVSGNLGDAFCIDSSGQITVAQPLDREVLPSYTLRVRVA-LG---NNEDFTEVVVSLTDINDDSPTFT-------------KSVYEFFANEDISS------GTSIGKVAATDRDSGSHGQISYRFLYASDIQSMDKFDLDQTTGIISLASGKSLDYEDISMHVLFVRAEDNGANKLSAIAEVRIYLRDI 1411          

HSP 14 Score: 62.7734 bits (151), Expect = 9.555e-10
Identity = 152/726 (20.94%), Postives = 297/726 (40.91%), Query Frame = 1
Query:  469 NEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIH--DQNDNVPMFPMKSFVKKIKEIL--YGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVY--ATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEY-PLTVKYDMFS-RVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN--FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNN-----GKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKS 2598
            N+ F ++  S V+ T +++D E         +  G+   ++N+   +      +V+++I+  + NDN PMFP ++  +  +++   +  G       A+DKD   I  RV YK++  ++ +    + D   +L    D+      F   T+ A + G  +      + +  ++        K+    +++ E T+ G +I ++       +  +VY          +  F +   G V L + LD E      I V      G   +   + I V DVN++ P + +      +  N        Q+  +D+D S  NG I  Q          L+ +P P    PLT + ++   R+Q  R       + +I  D G      + + + ++ +    +PPVF+   Y   + E      K+  V A        A++ Y+I+EG T   F + +     + ++   +R++ + + L + A  +  K L ++   V I V + ND  P    P  +L++ E+      I  + + D D  ++     G+  +S+   +    FD+ + G++    T D E      L +  +D G  +  + T  + V + D NDNAPV       K  D L              + +   + G  I   +A D D+ +  +V +++   T+       F ++ + G + +++ +S     +Y M+I A D  KS
Sbjct: 1562 NDMFAINPSSGVILTTRELDYE---------EATGY---IMNIIARDTRDRSASVQVIINVVNINDNEPMFPGETNGQIDRKVAGPFAPGFIATRLTAVDKD---IGDRVYYKISIEAENY---FTIDERGQLICKNDLKGIASPF-RFTIEARDGGLPQKVHTANVLLVFVNYRP-----KQQPVRVIVPETTRAGTVITRVPRYFPTGEFSIVYP--------EKTNFTIDNDGNVTLNRPLDYEEIAFTLITVREKQASGPLENYIDVEITVLDVNDNAPFFTMISTLGRVNSNSRAGATAFQLQARDLD-SGSNGLIGFQ----------LENIPTPFMINPLTRQIEVGQPRLQTSR-----YGLDIIPFDYGKPSVNGTKATVDIETV---QSPPVFNESSYTFTVSERAPTMTKIGDVTAV---SVSGARLSYTIIEGNTGNKFLAKDNGDIVLNSLLDFERDQSV-FNLKVEAKEQIPKGL-SSEVDVTITVINANDFHPYFDDPVYRLKVPESRGVGDVIMTVTARDCDCPSDCTCQVGQLKYSV---EAGTSFDIDQTGAIVVARTLDYETSKVQVLKVMASDQGEKVFTAVTF-VVVTLEDTNDNAPV------FKRNDYL-------------FRMTADASTGSMIGAVIARDQDQDDIEKVRYSVVSGTE-------FNVNTETGVLTVAKDLSTGAKSEYSMEIRATDSTKS 2201          

HSP 15 Score: 60.4622 bits (145), Expect = 4.938e-9
Identity = 117/477 (24.53%), Postives = 198/477 (41.51%), Query Frame = 1
Query: 1261 IRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSN---LQDLKFVPDPAEYPLTVKYDMFSRVQLDREEA-PTRTIYLICHDGG-LHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINK--SLKALFNATTTVNIEVTDEND----------------NVPEIYLPK----KLEIMENLKPYQFIGNIISEDKDFGN-NGKTVFSLINSKETDYFDLKRNGSLFSKITFD----RELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLE-SKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            +RI V D NN  P++  +     + E       VG +     +  D +G  R +   G      + + K V   A+  L +K    +  ++ R+ A P+ T+ +  +DGG LH     T+ I + + D N+NPPVF    Y   I E+  +   +L+V A D D   N  I Y +    T  F+I+  +G I  IR LD +      L + A ++  S KA       VN++VT  +D                N P ++ P+     L I E+      I  + + D D G+ NG+  +SL  +            +L +++ +     +++ D        N L   +S S    I V  +DDN+NAPV +         QLE + +    +G  I + S             A D+D G + QV ++   I   + +  +F +    G + ++  + R+ +  Y + I A DK 
Sbjct:  118 LRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEIVSGNERGYFVAETKTVG--AQKFLVLKA---TNTRIVRDPARPSITLTVRANDGGGLH----GTTRIQIDIQDTNNNPPVFEKSEYTVTIGEDTPVMTSILRVRARDADIGRNGGIYYYLRN--TQDFTIDAITGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKA-----ANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVF-PEGPSFTLSIREDFPVNGAIQVVKANDLDAGSTNGQLRYSLSGNNNFAIDSTSGVVTLQTQLEYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAPVFNPQ-------QLELTVSEDTAVGRTIRRVS-------------ATDSDDGSDGQVVYS---IIQGSGLG-VFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKA 553          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 191.815 bits (486), Expect = 3.772e-49
Identity = 215/769 (27.96%), Postives = 350/769 (45.51%), Query Frame = 1
Query:  343 TIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQ-LRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKL-NKASD-TFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKI------RIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFV-PDPAEYPLTVKYDMFSRV-QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            T+ E+ P G      SS +T I   D  +  +S   +      + F+L++ + VL     +D E+             L++V +    NQ L  +  ++I + D NDN P+F  ++  K + E L  +G  +    A+D D  + N +V YK+ N  +D TF++    + T  +   + +D+E  N Y L + A + G  + K SY  + I + D ND  P F K      + EN  I   +  ++A D D   +S++ Y + S +    R  F +  ETG +     +D E    Y + V ATD  FT   ++      +I ++D+N++ P +     +  +E+ +P N  V  I   D D              G+    + + V PD  ++ L +K  +   +  LD E+ P  T+++   D G    LTS  +  + V+DVNDNPP F+   +   + EN   G  V++V A+D+D   NA++ YSI  G   + FSI+ +SG I     LDRE+K  Y L + A   S      ++T+V I V D NDN P+   P   L++ EN  P + I  +  +D D+GNN K ++S+++      F + R+ G L +    DRE K  Y L+++  D+  P   ++   I + I D NDN PV                   Q+L S  I  S    PG  I    A D D G N  + +T+     SN    ++ ID   G +  +      +  +Y    IA D+G+
Sbjct: 1127 TVNEDLPVG------SSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHI--------LHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKL-PIGSVVAAVLAVDSDQGD-NGKVRYKIVNGNTDGTFKIN---ETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSP---RAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMED-EPFNFQVTSITALDPDT-------------GQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLG-SPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRV-SSTSVRINVMDRNDNPPKFISPVVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDI-TPPYYTAFANITIFIEDQNDNPPVF-----------------QQSLYSSTI--SELTPPGTSILNLTASDKDSGSNGNIVYTL-----SNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQ 1831          

HSP 2 Score: 181.415 bits (459), Expect = 5.880e-46
Identity = 179/726 (24.66%), Postives = 324/726 (44.63%), Query Frame = 1
Query:  472 EYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRL---TKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKI-NYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY-LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHST---LKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEK 2616
             +F +D  S ++ TA  +D E + P+         L ++V+      L    +V + + D NDN P F   S+   + E        ++L  A D D+ E NS +LY +   +  F L       PR  L   ++ +D+E ++ Y   + A + G     +   + + + D+ND +PVF    + +   ENT+IG+ I +L+A D+D     +   +    + + E F+V  +G + L K LD E +  Y + V A DG   +  + + + I V DVN+ PP ++    + T++E+     ++G ++    D    N ++     + K N  ++  +             ++ + ++D E+ P+  + +   D G    L   + +T+ V+D+NDN P F+      ++ E+  IG     V   D D     ++ +S+L  P   F+++ N+G ++  + +D      +Y L + A +       ++T  + ++V D ND  P          ++E   P   I  +++ D D G NG+  ++  +  +T  F L+  G +F K   DRE  +EY L +   D G P  RSS+  + V + D NDN P     S    +KE + + +                       +    A D+D+G N  VT+  +      Q+A  FI+D+  G I  S+++ R+    Y   I+A D G SS R +K
Sbjct:  439 HWFAIDPSSGMITTATDLDREQI-PQVV-------LTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQL-LAQDPDIGE-NSLILYSILTPNTPFFLD------PRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNA--TVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNAD-EVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKG-TNAEVVYS--ISKGNTDNIVLINSTGT--------LYLQSEVDHEKIPSLYLTVQAKDKGTPP-LFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPR-SSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTP-RRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVAT----------------------YLGAVSASDSDEGSNGHVTYRFD-----TQVAQ-FIVDKQTGKITTSQVLDREAKASYVFSIVATD-GGSSPRVDK 1102          

HSP 3 Score: 164.466 bits (415), Expect = 9.187e-41
Identity = 175/675 (25.93%), Postives = 290/675 (42.96%), Query Frame = 1
Query:  619 GVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFT---SNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ-LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN-FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRS--STKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAP---LFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
             ++ +K+V  D ND  P+F   S+   + E        IE+  A D D  E N R+ Y  +   DT +  +   N  ++ +   +D E    Y L +IA ++G     S  ++K+ + D+ND  P F++  +   + EN  +   +  + A+D D+ S    G V+         F V K+TG++   + LD E + +Y   + ATDG  +     +++ + VRDVN+  P ++ N  S+T+ E+ P    +  +   D D    N DI                V  P  + L     + + V  LDRE      ++++  D G ++ L + + I + VLDVNDN PVF        + E   IG  V  V+A D D  +N +++Y I+ G T+  F IN  +G I+ +R LD E    Y L + A +   K    +   V I V D NDN P     P    I EN+     +  I + D D G N +  +++ +     +F +    G + +    DRE   EY L +R  D          +T  + + I D NDNAP            +  S+N +  +  E           F++ +  A D D G+   V + +        ++P    F +D   G +K+   +  + +  Y + I A D G   L
Sbjct:  896 AMLELKVV--DVNDYSPVFGNWSYTAHVLETTPPDSNIIEV-VATDVDSGE-NGRISYAFDSKVDTSKFGLR--NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSN---GHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYM------------IVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAP------------KFVSRNLTYVMEDEPFN--------FQVTSITALDPDTGQGGNVEYRI--------VSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPL 1521          

HSP 4 Score: 158.688 bits (400), Expect = 5.455e-39
Identity = 204/789 (25.86%), Postives = 333/789 (42.21%), Query Frame = 1
Query:  343 TIQENHPSGIQVGFISS-DITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKF--CNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSK--LVYGMVSSTNSINRETFAV----KETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNS--KIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDA-SDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVF--SIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWIT--AIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY----LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVI---------------SVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDY-KMKIIACDKG 2592
            T+ EN P+G  V  +++ D     N +L   + S        + + F++D+ S ++ T   +D E     F   +  GV +   V +           +V+I + D+NDN P F       K+ E      + I      D D    N++VLY +   +      I + +T  L  T  +D ETK  Y+L++ A +       ++  I I I D ND  PVF++ L+   + E T  G  I+ L A+DKD  S   +VY       +++ +T+ V      TG V      +   +Q Y     A D G+    +   +RI + D NNH P +   P  + +  N   + LV  +   D D     NG +  +  L  S      FV +     +      FS     R       +Y+I  D G    L    ++ + + ++ D+PP F    P  +  I EN+ +G  +  V A    D   AQ+ YSI+ G     F ++P +G I+  +   LD E   N++L ++A  +   +L N    ++I V D NDN P  +    L +  E     KP +F+  + + D D G NGK  +S+    E   F +    G + +    DRE    + L IR  D G+P  +S+   + V + D NDN P+                +V +++   D  +    + NL S          PG  I    A D D G NAQ+ ++   IT+S+QI   + ID D G I   R +   +   + ++ + A D+G
Sbjct: 1549 TVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGV------EMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSST----------SVRINVMDRNDNPPKFISPVVTLKVPE--NSPARLIYTLTVQDLDYGN-NTKVLYSIMSGNTDGAFTIGR-STGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVY-------TLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYR--LDDSKNSTSLFVVESNTGSVRTSAG-FSNPPQGRH-----ALYIIAEDHG-SPPLRGYGIVQIVIGNIQDDPPRFLNQTP-ARVSIPENSKVGSYITTVRARASSD---AQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSL-NGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKP-RFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIP-PKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSA-------STPGIAILRVSATDQDSGSNAQIKYSFP-ITNSDQID--YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQG 2284          

HSP 5 Score: 157.918 bits (398), Expect = 9.633e-39
Identity = 197/725 (27.17%), Postives = 324/725 (44.69%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNG---HDELKSYLEIKIEIIDMNDCEPVF-KKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVK-ETGEVILMKTLDVEFRQTYEIPVYATD---GEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHE--RLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN-FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVP----EIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLR 2607
            F ++  + V+ T + +D E+                  ++ K+ Q      V I + D NDN P F     +  I E +  +   +   KA D D + +NSR+ Y ++  S     +I+ + T  ++ T  ID E  + Y L + A +      D L +   +KI I D+ND  P F  + L  ++ DE        I     D  +   + Y +VS     +   F++  +TG + L+ +LD E    Y + + ATD      TS     + V DVN++PP +  +    T+ EN+P    V ++   D D S  N ++    P G   ++  KF  D     L V   +     LDRE+    T +L  H  G+    R++STSV  + V+D NDNPP F  P    ++ EN+     +  +   D D   N ++ YSI+ G T+  F+I  ++G ++   +LDRE K +YQL++ A + +    + A   + I + D+NDN P     +Y      I E   P   I N+ + DKD G+NG  V++L N     Y    R G ++S   F+  +K EY       D G    + +  P+ + I D N++AP  +     K   ++    N+    S ++           + TA   D DK  N +VT+ ++D  +S     LF+++ + GS++ S   S    G + + IIA D G   LR
Sbjct: 1272 FKINETTGVISTLRALDFEVTNRYVLRVSAT-------DMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENV-PINTNVTTIKAHDDD-SGLNSRIWYTIDSQSPRAHFKINSE-TGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSP----DTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRD-SGSNAELTYSIPSG---VEMDKFSID-KHSGLIVTNSI-----LDREKK--DTYFLTVHATGVSYPFRVSSTSV-RINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDIT-PPYYTAFANITIFIEDQNDNPPVFQQSLY---SSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQD-PKMAIVPVRIKIEDKNNHAPQFT-----KTPYEVHIFPNTS--ASALVT----------MVTATDADTDKSTNGKVTYRLDDSKNSTS---LFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLR 1943          

HSP 6 Score: 135.191 bits (339), Expect = 8.864e-32
Identity = 154/616 (25.00%), Postives = 268/616 (43.51%), Query Frame = 1
Query:  577 LNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDV-TEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSST------------------NSINRETFAV-----------KETGEVILMKTLDVEFRQTY-EIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGK--SNLQDLKF-----------VPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYL--PKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKD--EYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAP 2274
            L+LV        L G + + I + D+NDN P F   + + ++ E   G  K   + K    DV +  N +V Y +   ++     I    T  +   K +D ET   ++L +   ++G     +  ++K+ + D+ND  P+F   L E+ + E+T+ G ++  + ATD DK+S+L Y + S++                  N+  + +F +            +TG +   +T+DV  R ++ +IPV A D +     +  ++VR +    P + L      + EN      V  + V D  A           PLG+   N+++  +           V  P +Y    ++ +   V    + AP++ + +  +               + V DVND  PVF    Y AQ  E   +G  V+ V A DKD   N ++ ++I  G     F+I+  +G I   R LD E    + +++ A ++    + +   +V I V D NDN P   +  P  ++++ENL     +  I + D+D G N +  F++I       F + K +G L + ITFD E     +Y L I+  D G P   SS   I VN+ D+++  P
Sbjct: 2035 LHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDT-GAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDS-TTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDP-LSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMD-QGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAG---------LPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLV--VSAIDDTAPSKPVRVPVY---------------INVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPM-HTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNP-PLSSNITIIVNVADEDEYDP 2618          

HSP 7 Score: 130.568 bits (327), Expect = 2.639e-30
Identity = 158/677 (23.34%), Postives = 291/677 (42.98%), Query Frame = 1
Query:  607 NQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEIL--YGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRL-RLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINR-ETFAVKETGEVILMKT-LDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQ-LDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN-FFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK--LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSR-DVIGDYKMKIIACDKG 2592
            +QL     V+I + D NDN P+  +   +    ++     +G  +      D D  + N  V   L      F ++    N   +  + + +D ET + + L  +  + G     +    +I + D+NDC P F +  +E  + EN  +  L+  + A D+D   +S+LVY + ++T S +    FA+  +  +I   T LD E      + V   D      + N  + + + D N++ P +N +  + +L EN P    V Q+  +D D             +G+++L     +     + L  +  + +  + LD E   + T  +   DGG     +  + + + + D+NDN PVF    Y  +  EN  IG  + Q+ A D+D  + A  ++ I +G  +  FS++  SG IT  + LDRE + NY L + A++   +   N    VNI V D ND  P I+   +    I E+ +    IG++ +  +D G N + V+S+      +   +   G+L+ +   D E      L ++  D G P        + + ++D NDN+P  +  S L    +         +G      SV+             DAD G   +V+F++      +    LF +D + G++ +++++   +    Y + + A D G
Sbjct:  257 HQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGK-NGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPD-------------IGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGR---SCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNK-AIVNITVLDVNDE-PPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYAN-VTIAVIDINDNSPQFNSSSILVRLPE------DTPIGHTFYTVSVF-------------DADSGVLGRVSFSLL-----SNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGG 888          

HSP 8 Score: 124.405 bits (311), Expect = 1.724e-28
Identity = 110/379 (29.02%), Postives = 170/379 (44.85%), Query Frame = 1
Query: 1510 SRVQLDREEAPTRTIYLICHDGGL---HERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSI--LEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL----EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKE--TDYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV--ADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            S + +DRE   +  + +   DGG    H  L     +++ V D NDN P FS   Y   I EN ++G  +LQV A DKD   NA+I+YSI     P   F I+P +G I    RLD E K +Y + + A +K      +++  V IEV D NDN P I++   L    ++ EN      +  +   D D G NG+   +L       +  FD+  + S+ +   + DRE  D + L     D G P  R++ K   +N+ D ND AP    H+                      +  V+EN       A+  A D D G N+++ +T+ + T+S      F ID  +G I  +  + R+ I    + ++  D+G   L
Sbjct:  126 SSIGVDRERLDSYVLNISASDGGNPANHGFLR----LSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDP-PRTTEKSFRINVGDVNDCAPKFDRHT---------------------YETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPL 478          

HSP 9 Score: 123.635 bits (309), Expect = 2.887e-28
Identity = 156/635 (24.57%), Postives = 267/635 (42.05%), Query Frame = 1
Query:  871 IDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKG--LFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPP----------------------------------SYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPD----PAEYPLTVKY-DMFSRV---QLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQV-VAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNG--SIKISRIMSRDVIGDYKMKIIACDKGKSSLRT 2610
            +DYE+   + L L+A   G   L  Y+ + I +ID ND  P F     L +L  D      + ++K+ ATD D   + K+ Y + +   +     F +   TGE+   K LD E   ++++ +  TD      ++N ++++ V D+N++PP                                  +YNL  AS        P I + +++  D D S  N  I+   P+  S+  D K   D     A   + V+  D F ++    +D+   P R +        ++ R+    +IT +        P F +P Y  ++ EN  +G  VL V V  +       +I Y+I    +N+F I   SG I+  + LD E K  + L + AI+ +  +       V I V+D ND  P       + +  E +     + N+ + DKD G NG+  F++ +  +   F + R  G + ++   D E    + +++R  D G P   +    + + +LD NDN PV  V             N+ Q L +  + + +YE          A D D G NA+++FT+  I  + Q   LF+ID+ +G  +  I+       +  Y + I A D G   L +
Sbjct: 2025 LDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEA---GVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSAST-------PGIAILRVSATDQD-SGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL--------VYVRI----IITRE--------PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIEN--SNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSK-PVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVS-VTIRVLDLNDNPPVFRV----------PGPNDVQVLENLPLNSRLYE--------INATDRDSGANARLSFTV--IGGTGQ--GLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSS 2602          

HSP 10 Score: 112.464 bits (280), Expect = 7.124e-25
Identity = 167/709 (23.55%), Postives = 294/709 (41.47%), Query Frame = 1
Query:  619 GVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTE-INSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVF-KKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETG--EVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIF---VRDVNNHPPSYNLNPASLTLEENQ---PPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIG-----------DK-----------------VLQVVAHDKDDKENAQIKYS--ILEGPTNFFSINPNSGWITAIRRLDREEKINY-QLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKL-EIMENLKPYQFIGNIISEDKDFG-NNGKTVFSLINSKETDYFDL-KRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
             ++ V+I I D+N++ P F    +   I          + +  A D D  +  N +V Y+L+ + ++  L + + NT  +R +       +  + L +IA ++G   L+ Y  ++I I ++ D  P F  +    + + EN+K+G  I  + A     D+++ Y ++S      R  +    TG   V     LD E  + + + + AT   + S +   I    V D N++ P+++ +     L E+     P  +V ++   DVD S  NG +      G    +   F  D     +T          LDRE   +  + +   D G+  + T+  V  + V D+NDNPP+F  P  +  I+E+   G           DK                 +L+V A D+D   NAQIKYS  I       + I+ ++G I+A R +D   + ++ Q+ + A+++ +     A   V I +T E    P+  LP    ++ EN      +  +   D   G   G+  +++ NS   +YF + +R+G +      D E K  + L +   D   P S+    P+ +N+ D ND  PV      + +              SE I        G  +    A D D G N +V F ++   D       F ID   G I+  R +  + I  + + + A D+G   + T+
Sbjct: 1836 AIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNT-SASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR-ASSDAQVTYSIISGNKG--RAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVV-KVTATDVD-SGTNGKVTYSIWTGN---EAGVFTIDSTTGEITTAK------LLDRETTASFDLVIRGTDSGIPPKSTNCQVKVV-VTDLNDNPPLFD-PLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQ-RALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS---NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAP-SKPVRVPVYINVSDVNDEKPVFGQSGYMAQW-------------SEGIPV------GTIVVNVSAADKDSGANGRVWFAIQSGDDKGS----FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTD 2495          

HSP 11 Score: 105.916 bits (263), Expect = 8.217e-23
Identity = 145/583 (24.87%), Postives = 243/583 (41.68%), Query Frame = 1
Query:  478 FTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVIN--VKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKAS-------------------------------DTFELQISKDNTPRLRLTKDIDYETKN-FYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSK-----IRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMF-SRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPF-YKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQ--LAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLIN 2088
            FT+D  +  + TAK +D E               +LV+            N  VK+V+ D NDN P+F   S V   ++   G   T  +    DK+     SR+ Y L  AS                               D  + +I  D T  +   + ID   ++ F ++ + A + G    ++ + ++I I      EP F+   +   + EN  +G  ++ +  TD    + L  G +S  N  N   F + + +G + + K LD E ++ + + V A D   T+ SK     + I V DVN+  P +  +       E  P   +V  ++  D D S  NG +      G           D   + +  K  +  ++  LD E   T  + +   D G     T  SV T++VLD+NDNPPVF +P     Q+ EN  +  ++ ++ A D+D   NA++ ++++ G     F I+  SGW+T     D E    YQ  L I A +     L ++  T+ + V DE++  P    +  K ++  N K   F+G + + D+D G+ G+  F   N
Sbjct: 2117 FTIDSTTGEITTAKLLDRETTAS----------FDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKE-----SRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDAD-TGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNA--AGLPLGRISY-NIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDD--TAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKD-SGANGRVWFAIQSGD----------DKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSV-TIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPL-SSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYN 2661          

HSP 12 Score: 92.0485 bits (227), Expect = 1.182e-18
Identity = 111/470 (23.62%), Postives = 210/470 (44.68%), Query Frame = 1
Query:  442 SFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKEN--QLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSK-LVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSKIRIFVR--DVNNHPPSYNL-NPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPT--RTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWI 1821
            SF  T  D+ +Y  +D  + V+   + ID+ I            F+ + V    +     R ++ V+I+I  +    P F + S+  K+ E    +G ++   +  D        R+ Y +   S+ F +      +  + + K +DYETK  + L + A ++        + + I + D+ND +PVF +  +     E   +G +++ + A DKD  +   V+  + S +  ++ +FA+ ++TG +   + LD E  +T+ + V ATD G    ++ + + +R  D+N++PP + +  P  + + EN P N  + +IN  D D+     + R    +     Q L F+ D     LT      + +  D E       ++ +   D G +  L+S   I + V D ++  P F+   YK  +  N  IGD V QV A D+D  +  ++ +      +N   +N  +G I
Sbjct: 2239 SFPITNSDQIDY-KIDADTGVISARRTIDVRIRD---------SFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAM-MGTSVLTVRVTDNAAGLPLGRISYNIEN-SNYFRI---GQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD--DKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSG---ANARLSFTVIGGTGQGL-FLIDKFSGWLT------TNITFDYENTAVYQYSLTIKATDAG-NPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 13 Score: 75.0998 bits (183), Expect = 1.837e-13
Identity = 92/350 (26.29%), Postives = 150/350 (42.86%), Query Frame = 1
Query: 1609 ITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT-NFFSI---NPNSGWITA-------IRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY-LPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSL-INSKETDYFDLK-RNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEK 2616
            + + V D+NDN P F +    A++    N  D   +++A D D   N+   Y+I+ G   N F +       G + A          +DRE   +Y L I A +    A  +    ++I V D NDN PE   +     I EN+     I  + + DKD G N +  +S+  +S     F +    G + + +  D E K  Y + ++  D G     SS+  + + +LD NDN PVI V  TL    Q+     +  +G+++ + SV              DAD G+N +V  T+E        +  F +  D   I + + + R+    + +K +  DKG     TEK
Sbjct:   44 VLVYVQDLNDNSPSF-VRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPA-NHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQV---TENATIGTQVARVSV-------------SDADSGKNGEVNVTLEG--GDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEK 373          

HSP 14 Score: 74.7146 bits (182), Expect = 2.754e-13
Identity = 85/283 (30.04%), Postives = 123/283 (43.46%), Query Frame = 1
Query: 1807 NSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIY--LPKKLEIMENLKPYQFIGNIISEDKDFGNNGK-----------TVFSLINSKETD---YFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPV---ISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKS 2598
            N+G IT    LDRE+   Y L I+  +   K+      TV + V D NDN P        KL + EN K   F   +I+ D DFG+N              VF LI+ ++TD   Y DL  N    S I  DRE  D Y LNI  +D G P +    + + + + D NDN P    +S   T+ E         + ++G+ I++ S             A D D G NA++ +++E  +D   I   F I    G I  +  +  +    Y + + A DKG S
Sbjct:   10 NAGVITTKTVLDREKVSAYNLTIVEFSTPPKSY-----TVLVYVQDLNDNSPSFVRGTSAKLVVFENDK--DFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNA---SSIGVDRERLDSYVLNISASDGGNPANHGFLR-LSITVEDTNDNKPEFSNVSYSGTIPE---------NIDVGTSILQVS-------------ASDKDIGTNAEIQYSIETHSDPQAI---FGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSS 256          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 187.578 bits (475), Expect = 6.397e-49
Identity = 200/777 (25.74%), Postives = 349/777 (44.92%), Query Frame = 1
Query:  346 IQENHPSGIQVGFISS-DITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEIL----CPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEII--DMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKD--SKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKE---NAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKK--LEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENP--GFKIATAVADDADKGENAQVTFT-MEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEK 2616
            + EN P G  V  + + D     N DL   + +       + N  FT+D  +  + T K+ D E           +D GV  L+ +             NV I++ D+NDN P F  K +   + E  + VG  +    A DKD +  N+ + Y ++  +      I  D +  + L K +D ET   Y L LI  + G   L+S   + + +I   +N+  P F    +   + EN  +G  I+++ A + D    ++ +Y +  + +S   + F V +TG++ L + LD E R+ YE  +Y      TS +++                    LTL  +     + GQ+    V +S V G        G  +L                        +LDRE      + ++  DGG   R T+++ + ++VLD NDNPPVF+  +Y  Q+ E  +IG ++L+V A+D+DDK+   NA+I+Y + +   +  FSIN  +G IT  + +D EE+ +Y   + A +   +A    +++V I + D NDN P  +LP +  ++++EN+     +  + + D D   NGK +FS++       F + +N G + +  + D E   EY L I+  D G  P++ S    + V++++ NDN+PV S                      ++  AS+ EN   G  I    A D D   N +V F+ +E  +D       F++D++ G +  ++ +  + + +Y + I A D G   L + +
Sbjct:  118 VSENTPLGTIVARVKAVDKDSTSNADLIYSIQNG------NNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSL----------NFANVVIIVVDENDNPPEFAQKRYTATVYE-NFTVGTVVLRVTAHDKD-SGPNAMLKYSIHSGNTDDAFVIIAD-SGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASS---KVFLVNQTGDITLARELDYETRRRYEFEMYE---NVTSGTQV--------------------LTLFAHDRDEGINGQVFYYIVTSS-VKGVFTTNSTTGVVSLT----------------------AELDRESVYQYNMLVVAQDGGSPPR-TASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGG-EARLTGSSSVRITIIDVNDNRP-YFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFS---------------------QKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGK-----FVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQ 797          

HSP 2 Score: 149.828 bits (377), Expect = 7.157e-37
Identity = 160/661 (24.21%), Postives = 283/661 (42.81%), Query Frame = 1
Query:  667 PMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSK--LVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIR-----IFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQD-LKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLH-----ERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFS-KITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSL 2604
            P+F    +   I E  + VG T+    A D+D   +N+RV Y +   S   +  +  + T  +R +K+ DYET+  Y  ++ A + G     +   I ++I D ND  P+F+   +E  + ENT +G ++ +++A DKD  S   L+Y +    N  N  +F +   TGE++  K  D E  + Y + +  +D    + S +      I V D N++PP +     + T+ EN     +V ++   D D+     +   +  +   N  D    + D  +  L           LD+E     T+ LI  D G+      +R+    V+ + V  VN++ P F   FY A I EN  +G  +++V A + D    A+  Y I +  ++   +   +G IT  R LD E +  Y+                                        E+ EN+     +  + + D+D G NG+  + ++ S     F       + S     DRE   +Y + +   D G P  R+++  + V +LD NDN PV    +TL    QL   + + ++G+ I++ S  +           DD D+G NA++ + ++D   S +    F I++  G I I + +  +    Y  ++ A D G++ L
Sbjct:    1 PIFNQTLYSAIIPED-FTVGGTLLTVLARDQDAA-LNARVTYSIVSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSI---QNGNNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGP---NAMLKYSIHSGNTDDAFVIIADSGDISLDKP--------LDKETIENYTLVLIVTDMGIPPLESIKRM----VVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYE---------------------------------------FEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSP-PRTASAHVKVEVLDCNDNPPVF---TTLYYTLQL---SEATSIGTRILRVSANDR----------DDKDEGVNAEIRYFLKDAIVSKK----FSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARL 581          

HSP 3 Score: 144.436 bits (363), Expect = 3.884e-35
Identity = 121/413 (29.30%), Postives = 203/413 (49.15%), Query Frame = 1
Query:  772 INSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSS--TNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTST--SVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILA-------INKSLKALFNATTTVNIEVTDENDNVP 1962
            IN +V Y +  +S    +  +   T  + LT ++D E+   Y + ++A + G     +   +K+E++D ND  PVF    + L L E T IG  I+++ A D+D   + V   +     ++I  + F++ + TG++ + + +D E R +Y   V+A+DG     T +S +RI + DVN++ P +      + L EN      V Q+   D+D+S +NG +      G S   D KFV D     +T      +   LD E+    T+ +   D G    L S+   ++ + V+++NDN PVFS   Y A I EN  +G  +L+V A D D   N ++ +SILEG ++  F ++ N+G +T  + LD E+   Y L I A       +N S   +       ++ V + NDN P
Sbjct:  419 INGQVFYYIVTSS-VKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSS-LNGKVLFSILGGNS---DGKFVIDQNTGVVT------TNKSLDYEDVTEYTLVIQATDCG-DPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGML------HVSVVNINDNSP 813          

HSP 4 Score: 141.354 bits (355), Expect = 3.682e-34
Identity = 156/573 (27.23%), Postives = 260/573 (45.38%), Query Frame = 1
Query:  616 RGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEF---TSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASD--VNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNF-FSINPNSGWITAIRRLDREEKINYQLAILA-------INKSLKALFNATTTVNIEVTDENDNVPEIYLPK--KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPV 2277
            R V+NV  ++   N++ P F  + +   I E L  +G +I   +A++ DV+ + +R +Y +  A+ +    +++  T  + L +++DYET+  YE                                     FE+   EN   G  ++ L A D+D+  + ++ Y +V+S  S+         TG V L   LD E    Y + V A DG     T+++ +++ V D N++PP +     +L L E       + +++  D D  D  VN +IR      K  +   KF  +     +T+K        +D EE  + +  +   DGG   RLT +S + + ++DVNDN P F    Y  Q+ EN  IG  V QV A D D   N ++ +SIL G ++  F I+ N+G +T  + LD E+   Y L I A       +N S   + +      + V + NDN P ++  K     I EN      I  + + D D   NGK +FS++       F + +N G + +  + D E   EY L I+  D G  P++ S    + V++++ NDN+PV
Sbjct:  306 RMVVNV--IVSGVNEHAPRFLNEFYNASIPENL-PLGTSIVRVRAVEDDVS-VGARFIYVIKDAASSKVFLVNQ--TGDITLARELDYETRRRYE-------------------------------------FEMY--ENVTSGTQVLTLFAHDRDEGINGQVFYYIVTS--SVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRY---FLKDAIVSKKFSINDTTGQITIKQ------AVDYEERSSYSFEVFASDGG-EARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLH------VSVVNINDNSP-VFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPV 814          

HSP 5 Score: 115.546 bits (288), Expect = 4.435e-26
Identity = 90/334 (26.95%), Postives = 161/334 (48.20%), Query Frame = 1
Query: 1645 PVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPT--NFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLE--IMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRN-GSLFSKITFDRELKDEYCLNIRVNDLGVP-ISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAV----ADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEK 2616
            P+F+   Y A I E+  +G  +L V+A D+D   NA++ YSI+   T  ++F I+  +G + + +  D E +  Y  ++ A ++    + +A  T+++++TD NDN P I+ P + E  + EN      +  + + DKD  +N   ++S+ N      F +  + G + ++  FD E  + Y L I V+D GVP +S  +   + + ++D+NDN P                         +   A+VYEN  F + T V    A D D G NA + +++     S      F+I  D+G I + + + ++ I +Y + +I  D G   L + K
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRG-SPIRSAIATIHVQITDTNDNRP-IFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPP---------------------EFAQKRYTATVYEN--FTVGTVVLRVTAHDKDSGPNAMLKYSIH----SGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIK 305          

HSP 6 Score: 78.9518 bits (193), Expect = 7.943e-15
Identity = 70/243 (28.81%), Postives = 127/243 (52.26%), Query Frame = 1
Query:  604 ENQLRGVINVKIVIHDQNDNVPMF-PMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLE--IKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAVKE-TGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSK----IRIFVRDVNNHPP 1299
            E +L G  +V+I I D NDN P F P + +V+ ++ +   +G  +    A D D + +N +VL+ +   +   +  I + NT  +   K +DYE    Y L + A + G   L S     + + ++++ND  PVF + ++   +DENT +G +I+++ A+D D   + K+++ ++   NS  +  F V + TG V   K+LD E    Y + + ATD G+   NS     + + V ++N++ P
Sbjct:  578 EARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENV--AIGTPVTQVTASDLD-SSLNGKVLFSILGGNSDGKFVIDQ-NTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEG-NSDGK--FVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 813          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 238.039 bits (606), Expect = 1.632e-63
Identity = 201/723 (27.80%), Postives = 346/723 (47.86%), Query Frame = 1
Query:  484 LDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKET-GEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L     +  T+ +ID E LCP    +D      + V V   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  NS   Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND +PVF++   E+ + EN+ IG  +++L+ATD D   ++++ Y   +  +   +  FA+  T G + + + LD E    +++ V A+DG  + + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +D+NG + C             F+     + L   YD    + +   LD E        ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN     +  + A D+D  +NA+I Y +  GP  +FF ++  +G +TA R  DRE++  +   + A +     L  A   V + V DENDN P+  +   +  + ENL  Y  +G I   D D G N     S++N  E    D   +G + S ++FDRE +  Y  ++R  D G P   S+ K + +N++D NDN P++    +              N   +++  S    PG  +A   A D+D G NA++ +T+  ++ +N+   LF ID   G+I +    +   IG +++ +   D G
Sbjct:   79 LGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKD-TDINGKVIC-------------FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSG-KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL-QAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILD-PFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAK-VTINVIDVNDNTPIVIYPPS--------------NTSFKLVPLSSI--PGSVVAEVFAVDSDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLG 758          

HSP 2 Score: 138.272 bits (347), Expect = 2.041e-32
Identity = 163/639 (25.51%), Postives = 276/639 (43.19%), Query Frame = 1
Query:  763 VTEINSRVLYKL-NKASD---------TFELQISKDNTPRLRLTKDIDYE-TKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLV--YGMVSSTNSINR---ETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQI------KENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
             T  ++ ++Y+L +KA D         T E+  + +   R +L     +E  +  +E+ ++   N +  L   ++IKI + D ND  P+F   +  + + ENT I        ATD D     V  Y +++  ++      ET   ++  ++I+ + LD E + TY + +   DG   + +S + +++ V DVN++ P +  N   + + EN P    V Q+   D D    N +I        S      F  +     +TV+        LDREE     + ++  DG       + + + + V DVNDNPP   + +  + I       E + I  K+  +   DKD   N ++   I +  P +  ++  N   +     LD E    Y   I+A + S K   N T  V + + DENDN P    P  +L +MEN K   F+  + + D+D G N + V+ L       +FDL R  G L +   FDRE +D +   +   D G P  ++    + V +LD+NDN P  +              N+ Q   SE +    Y   G    T    D+D GENA ++ ++ +  ++      FI+D  +G IK +    R+    Y   + A D G+
Sbjct:   55 ATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGP-NAEIHYVFGTQVSPATKRLFALNSTSGLITVQR------PLDREETAIHKLSVLASDGSSSP---ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVA-SDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAA-VIVTVLDENDNNPKFT-------------HNHFQFFVSENLPK--YSTVGVITVT----DSDAGENAAISLSILNDNEN------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGR 651          

HSP 3 Score: 121.324 bits (303), Expect = 2.737e-27
Identity = 144/530 (27.17%), Postives = 225/530 (42.45%), Query Frame = 1
Query: 1108 MVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQ-DLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            + +++N I+RE      + E       D E   ++EI V     ++    KI+I V+D N++ P +     ++++ EN   N      +  D D    N   + +   G+S    D+   P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN+ IG  V+Q+ A D D   NA+I Y     +       F++N  SG IT  R LDREE   ++L++LA + S      A  TV I VTD NDN P I             +L +K  I  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   EY   I  +D G P S + T  + V + D+NDN P+ +                       +I+ +V EN      + T  A D D G+NA++ + +         A  F +D   G +  SR+  R+    +   + A D G   L+ +
Sbjct:   85 IFTTSNRIDREKLCPGSSFE-------DAEC--SFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELINGQSAFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGSPQK-SSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP---ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPI--NTK----IALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYL-------LETSALLDYEGTKEYNFKIVASDSGKP-SLNQTALVRVRLEDENDNPPIFT---------------------QPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL------GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQ 554          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 237.269 bits (604), Expect = 2.620e-63
Identity = 201/723 (27.80%), Postives = 346/723 (47.86%), Query Frame = 1
Query:  484 LDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKET-GEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L     +  T+ +ID E LCP    +D      + V V   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  NS   Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND +PVF++   E+ + EN+ IG  +++L+ATD D   ++++ Y   +  +   +  FA+  T G + + + LD E    +++ V A+DG  + + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +D+NG + C             F+     + L   YD    + +   LD E        ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN     +  + A D+D  +NA+I Y +  GP  +FF ++  +G +TA R  DRE++  +   + A +     L  A   V + V DENDN P+  +   +  + ENL  Y  +G I   D D G N     S++N  E    D   +G + S ++FDRE +  Y  ++R  D G P   S+ K + +N++D NDN P++    +              N   +++  S    PG  +A   A D+D G NA++ +T+  ++ +N+   LF ID   G+I +    +   IG +++ +   D G
Sbjct:   79 LGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKD-TDINGKVIC-------------FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSG-KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL-QAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILD-PFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAK-VTINVIDVNDNTPIVIYPPS--------------NTSFKLVPLSSI--PGSVVAEVFAVDSDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLG 758          

HSP 2 Score: 137.502 bits (345), Expect = 3.201e-32
Identity = 163/639 (25.51%), Postives = 276/639 (43.19%), Query Frame = 1
Query:  763 VTEINSRVLYKL-NKASD---------TFELQISKDNTPRLRLTKDIDYE-TKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLV--YGMVSSTNSINR---ETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQI------KENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
             T  ++ ++Y+L +KA D         T E+  + +   R +L     +E  +  +E+ ++   N +  L   ++IKI + D ND  P+F   +  + + ENT I        ATD D     V  Y +++  ++      ET   ++  ++I+ + LD E + TY + +   DG   + +S + +++ V DVN++ P +  N   + + EN P    V Q+   D D    N +I        S      F  +     +TV+        LDREE     + ++  DG       + + + + V DVNDNPP   + +  + I       E + I  K+  +   DKD   N ++   I +  P +  ++  N   +     LD E    Y   I+A + S K   N T  V + + DENDN P    P  +L +MEN K   F+  + + D+D G N + V+ L       +FDL R  G L +   FDRE +D +   +   D G P  ++    + V +LD+NDN P  +              N+ Q   SE +    Y   G    T    D+D GENA ++ ++ +  ++      FI+D  +G IK +    R+    Y   + A D G+
Sbjct:   55 ATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGP-NAEIHYVFGTQVSPATKRLFALNSTSGLITVQR------PLDREETAIHKLSVLASDGSSSP---ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVA-SDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAA-VIVTVLDENDNNPKFT-------------HNHFQFFVSENLPK--YSTVGVITVT----DSDAGENAAISLSILNDNEN------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGR 651          

HSP 3 Score: 120.939 bits (302), Expect = 3.863e-27
Identity = 144/530 (27.17%), Postives = 225/530 (42.45%), Query Frame = 1
Query: 1108 MVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQ-DLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            + +++N I+RE      + E       D E   ++EI V     ++    KI+I V+D N++ P +     ++++ EN   N      +  D D    N   + +   G+S    D+   P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN+ IG  V+Q+ A D D   NA+I Y     +       F++N  SG IT  R LDREE   ++L++LA + S      A  TV I VTD NDN P I             +L +K  I  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   EY   I  +D G P S + T  + V + D+NDN P+ +                       +I+ +V EN      + T  A D D G+NA++ + +         A  F +D   G +  SR+  R+    +   + A D G   L+ +
Sbjct:   85 IFTTSNRIDREKLCPGSSFE-------DAEC--SFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELINGQSAFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGSPQK-SSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP---ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPI--NTK----IALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYL-------LETSALLDYEGTKEYNFKIVASDSGKP-SLNQTALVRVRLEDENDNPPIFT---------------------QPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL------GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQ 554          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 235.728 bits (600), Expect = 2.669e-63
Identity = 201/723 (27.80%), Postives = 346/723 (47.86%), Query Frame = 1
Query:  484 LDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISK----DNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKET-GEVILMKTLDVEFRQTYEIPVYATDGEFT-SNSKIRIFVRDVNNHPPS----YNLNP--ASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYD----MFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKG 2592
            L     +  T+ +ID E LCP    +D      + V V   +  R +I +KI++ D NDN PMFP       I E    +     +P A D D T  NS   Y+L      F L I +    +  P+L + +++D E K+ Y + +   + G  +  S   +++ + D+ND +PVF++   E+ + EN+ IG  +++L+ATD D   ++++ Y   +  +   +  FA+  T G + + + LD E    +++ V A+DG  + + + + I V DVN++PP+    Y ++P   ++ L E  P N  +  I V D D +D+NG + C             F+     + L   YD    + +   LD E        ++  D G    L  T+++ +++ D NDNPP+F+ P  +  + ENN     +  + A D+D  +NA+I Y +  GP  +FF ++  +G +TA R  DRE++  +   + A +     L  A   V + V DENDN P+  +   +  + ENL  Y  +G I   D D G N     S++N  E    D   +G + S ++FDRE +  Y  ++R  D G P   S+ K + +N++D NDN P++    +              N   +++  S    PG  +A   A D+D G NA++ +T+  ++ +N+   LF ID   G+I +    +   IG +++ +   D G
Sbjct:   79 LGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKD-TDINGKVIC-------------FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSG-KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL-QAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILD-PFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAK-VTINVIDVNDNTPIVIYPPS--------------NTSFKLVPLSSI--PGSVVAEVFAVDSDTGMNAELKYTI--VSGNNK--GLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLG 758          

HSP 2 Score: 137.502 bits (345), Expect = 2.907e-32
Identity = 152/584 (26.03%), Postives = 253/584 (43.32%), Query Frame = 1
Query:  895 YELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLV--YGMVSSTNSINR---ETFAVKETGEVILMKTLDVEFRQTYEIPVYATDG---EFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQI------KENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKR-NGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            +E+ ++   N +  L   ++IKI + D ND  P+F   +  + + ENT I        ATD D     V  Y +++  ++      ET   ++  ++I+ + LD E + TY + +   DG   + +S + +++ V DVN++ P +  N   + + EN P    V Q+   D D    N +I        S      F  +     +TV+        LDREE     + ++  DG       + + + + V DVNDNPP   + +  + I       E + I  K+  +   DKD   N ++   I +  P +  ++  N   +     LD E    Y   I+A + S K   N T  V + + DENDN P    P  +L +MEN K   F+  + + D+D G N + V+ L       +FDL R  G L +   FDRE +D +   +   D G P  ++    + V +LD+NDN P  +              N+ Q   SE +    Y   G    T    D+D GENA ++ ++ +  ++      FI+D  +G IK +    R+    Y   + A D G+
Sbjct:  110 FEIEVVVLPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGP-NAEIHYVFGTQVSPATKRLFALNSTSGLITVQR------PLDREETAIHKLSVLASDGSSSP---ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVA-SDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAA-VIVTVLDENDNNPKFT-------------HNHFQFFVSENLPK--YSTVGVITVT----DSDAGENAAISLSILNDNEN------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGR 651          

HSP 3 Score: 120.553 bits (301), Expect = 4.404e-27
Identity = 144/530 (27.17%), Postives = 225/530 (42.45%), Query Frame = 1
Query: 1108 MVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQ-DLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKY----SILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEI-------------YLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTV--------FSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYEN--PGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTE 2613
            + +++N I+RE      + E       D E   ++EI V     ++    KI+I V+D N++ P +     ++++ EN   N      +  D D    N   + +   G+S    D+   P+  ++P      +  +  LDRE+  T  + +   DGG  ++ +ST+++ + V DVNDN PVF     +  I EN+ IG  V+Q+ A D D   NA+I Y     +       F++N  SG IT  R LDREE   ++L++LA + S      A  TV I VTD NDN P I             +L +K  I  N K    I  I   DKD   NGK +        F L    +  Y        L +    D E   EY   I  +D G P S + T  + V + D+NDN P+ +                       +I+ +V EN      + T  A D D G+NA++ + +         A  F +D   G +  SR+  R+    +   + A D G   L+ +
Sbjct:   85 IFTTSNRIDREKLCPGSSFE-------DAEC--SFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELINGQSAFGLDIVETPEGEKWP-----QLIVQQNLDREQKDTYVMKIKVEDGGSPQK-SSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP---ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPI--NTK----IALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYL-------LETSALLDYEGTKEYNFKIVASDSGKP-SLNQTALVRVRLEDENDNPPIFT---------------------QPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQL------GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQ 554          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 230.72 bits (587), Expect = 3.737e-61
Identity = 214/792 (27.02%), Postives = 352/792 (44.44%), Query Frame = 1
Query:  325 EGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEILCPKFCNDDGVG---FLNLVVNVWK--ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT---FELQISKDNT---PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSK--IRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASD-------VNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            +G++ Y +QE  P    +G +++D        LP   DS   +       Y  +D ++  +  T   ID E L  + C     G   +L   V+V    +N    +I  +I + D NDN P FP+      + E    +G    +P A D+D +E N    Y L    D    F LQ++ D     P+L +  ++D E K+ Y+LT+ A + G+ +  S   +++ + D ND  P F+   +E  + EN+ +G  +++++A D D   + ++ Y +  + + + +     + TG + +   LD E   +    V A D G    +SK  + I V D N++ P+  +    L         + E+ P    V  + V D D  +       V GD+  Q      +  D K            KY + +   LD E      + ++  D G +  L+ST+ + +QV DVNDN PVFS   ++    E N  G+ +L V A D D   NA++ Y+I+        F I+PN+G + A   LDRE K  Y+  + A +K    +   T TV I+V D NDN P+  L      ++EN+ P   +G +   D D G N     S +      +      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDN PV++  S                  S   + S   +P   +    A+D D G NA + F+   I   N    LF I   +G I +++ M+R   G +++ +   D+GK
Sbjct:   98 KGSILYRVQEEQPPNTLIGSLAADH------GLP---DSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--RDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTI-MGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKR-----------KYFLQTTTPLDYERVKEYRVEIVAVDSG-NPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKG-SPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS-VEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNDPVVTKPSN-----------------SSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFS---IAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGK 840          

HSP 2 Score: 142.51 bits (358), Expect = 9.793e-34
Identity = 137/470 (29.15%), Postives = 219/470 (46.60%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSF--------VKKIKEILYGVGKTIELPKAIDKDVTE-------INSRVLYKLNKASDTFELQISKDNTPR--LRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPL-TVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKA--QIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNV 1959
            V I + DQNDN P   ++          +  I E +  VG  + L +  DKD  E       +   V ++L  ASD+     + DN  +  L+ T  +DYE    Y + ++A ++G+  L S   +K+++ D+ND  PVF   +FE+   E  + G+ I+ + ATD D   +++L Y +V   +S  +  F +   TGEV     LD E ++ YE  V A D         + + I V D N++ P + L+  S ++ EN PP   VG + V D+D              G++    L   PD  ++ +      + S +  DRE+  + T  L   DGG   R +S   +T+ VLD NDN PV + P   +  Q+    +    V  V A D D   NA + +SI  G P   F I+P+SG IT  + + R+    ++L +   ++  K   +AT  V+I V +   NV
Sbjct:  414 VTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDM-PVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS-----TSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVG--DSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDK-------------GENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR-SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRG-KPPRHATALVHIYVNETISNV 860          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 228.409 bits (581), Expect = 4.731e-61
Identity = 213/791 (26.93%), Postives = 350/791 (44.25%), Query Frame = 1
Query:  325 EGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSS-VLKTAKKIDLEIL--CPKFCNDDGVGFLNLVVNVWK--ENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDT---FELQISKDNT---PRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKD--KDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATD-GEFTSNSK--IRIFVRDVNNHPPSYNLNPASLT--------LEENQPPNILVGQINVKDVDASD-------VNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP--TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPK-KLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK 2595
            +G++ Y +QE  P    +G +++D        LP   DS   +       Y  +D ++  +  T   ID E L  C          +L   V+V    +N    +I  +I + D NDN P FP+      + E    +G    +P A D+D +E N    Y L    D    F LQ++ D     P+L +  ++D E K+ Y+LT+ A + G+ +  S   +++ + D ND  P F+   +E  + EN+ +G  +++++A D D   + ++ Y +  + + + +     + TG + +   LD E   +    V A D G    +SK  + I V D N++ P+  +    L         + E+ P    V  + V D D  +       V GD+  Q      +  D K            KY + +   LD E      + ++  D G +  L+ST+ + +QV DVNDN PVFS   ++    E N  G+ +L V A D D   NA++ Y+I+        F I+PN+G + A   LDRE K  Y+  + A +K    +   T TV I+V D NDN P+  L      ++EN+ P   +G +   D D G N     S +      +      G++ S I+FDRE +  Y   ++  D G P  RSS   + +N+LD+NDN PV++  S                  S   + S   +P   +    A+D D G NA + F+   I   N    LF I   +G I +++ M+R   G +++ +   D+GK
Sbjct:   21 KGSILYRVQEEQPPNTLIGSLAADH------GLP---DSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPC-YLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTI-MGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKR-----------KYFLQTTTPLDYERVKEYRVEIVAVDSG-NPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKG-SPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS-VEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNDPVVTKPSN-----------------SSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFS---IAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGK 763          

HSP 2 Score: 141.354 bits (355), Expect = 1.752e-33
Identity = 137/470 (29.15%), Postives = 219/470 (46.60%), Query Frame = 1
Query:  631 VKIVIHDQNDNVPMFPMKSF--------VKKIKEILYGVGKTIELPKAIDKDVTE-------INSRVLYKLNKASDTFELQISKDNTPR--LRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDK--DSKLVYGMVSSTNSINRETFAV-KETGEVILMKTLDVEFRQTYEIPVYATDGE---FTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLT-VKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKA--QIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEG-PTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNV 1959
            V I + DQNDN P   ++          +  I E +  VG  + L +  DKD  E       +   V ++L  ASD+     + DN  +  L+ T  +DYE    Y + ++A ++G+  L S   +K+++ D+ND  PVF   +FE+   E  + G+ I+ + ATD D   +++L Y +V   +S  +  F +   TGEV     LD E ++ YE  V A D         + + I V D N++ P + L+  S ++ EN PP   VG + V D+D              G++    L   PD  ++ +      + S +  DRE+  + T  L   DGG   R +S   +T+ VLD NDN PV + P   +  Q+    +    V  V A D D   NA + +SI  G P   F I+P+SG IT  + + R+    ++L +   ++  K   +AT  V+I V +   NV
Sbjct:  337 VTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDM-PVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS-----TSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVG--DSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDK-------------GENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR-SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRG-KPPRHATALVHIYVNETISNV 783          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000046654.1 (SMESG000046654.1)

HSP 1 Score: 2264.19 bits (5866), Expect = 0.000e+0
Identity = 1126/1128 (99.82%), Postives = 1126/1128 (99.82%), Query Frame = 1
Query:  262 MKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXXXXXXXXXXXGPKIQVTGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQVDLNNSNGQTLLQKLPPPHYNLYTYGPFEPSYESSWNQTLNRNDRLCSNVTLDFYENNPLEKPEYVGYESPRMYLSENTLCHVDHIVGKLNGCSCGRGGCVRYSNHGNPNCLSPNPEEQCSDSGRGASDDDMKALNVNGSVASSSRPPLSVYGTYTLGDSRSKSPRPDGFLTMNSNLTDQILDQRRIHMNQSQSNFMAPFCSQSTQIPLTTFQPTINSEPQIKSSNLRNSVLHLAKSSSIDSLSNIPHQNSNLPSPTNTDRKNSQFFNKIMNQEFNHC 3645
            MKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMF MKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKP QFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKIIRIQIQDIPPQSSTIGPKIQVTGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQVDLNNSNGQTLLQKLPPPHYNLYTYGPFEPSYESSWNQTLNRNDRLCSNVTLDFYENNPLEKPEYVGYESPRMYLSENTLCHVDHIVGKLNGCSCGRGGCVRYSNHGNPNCLSPNPEEQCSDSGRGASDDDMKALNVNGSVASSSRPPLSVYGTYTLGDSRSKSPRPDGFLTMNSNLTDQILDQRRIHMNQSQSNFMAPFCSQSTQIPLTTFQPTINSEPQIKSSNLRNSVLHLAKSSSIDSLSNIPHQNSNLPSPTNTDRKNSQFFNKIMNQEFNHC
Sbjct:    1 MKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFLMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPNQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKIIRIQIQDIPPQSSTIGPKIQVTGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQVDLNNSNGQTLLQKLPPPHYNLYTYGPFEPSYESSWNQTLNRNDRLCSNVTLDFYENNPLEKPEYVGYESPRMYLSENTLCHVDHIVGKLNGCSCGRGGCVRYSNHGNPNCLSPNPEEQCSDSGRGASDDDMKALNVNGSVASSSRPPLSVYGTYTLGDSRSKSPRPDGFLTMNSNLTDQILDQRRIHMNQSQSNFMAPFCSQSTQIPLTTFQPTINSEPQIKSSNLRNSVLHLAKSSSIDSLSNIPHQNSNLPSPTNTDRKNSQFFNKIMNQEFNHC 1128          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000036716.1 (SMESG000036716.1)

HSP 1 Score: 535.798 bits (1379), Expect = 4.925e-172
Identity = 325/862 (37.70%), Postives = 496/862 (57.54%), Query Frame = 1
Query:  268 IYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNK--ASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEA--PTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSI-----LEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINK-SLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGK-SSLRTEKXXXXXXXXXXXXXXXXGPKIQ---VTGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNY 2808
            +Y+   +++  L   F++F+  + Y I+EN P   ++G IS D+     + L + L     + F+ +  YF LD  +S+LKT   IDLE LCP  C    +G L LVVNVW    L+G+I V+I + D NDNVP F   S +K +KE++YGVGK++EL KAID+DV++ ++ V YKL+    SDTF L+++ D+ P L L K +DYE    Y L + AWN+  D  K+ L I I ++++ND EP FK+  +E+ ++EN  I  +II++EA D+D+DS++ Y     +   + + F+V   G++ L + LD E    + I V A+D EF +N+K+ I V DVN+  P +NLNP+   +EE QP NI++GQI + D D+   NG + C EP    N Q + F P         KYD+++RV+ DREE     + + ++C DG     LTST  I+L + D+NDN P+F    Y   I+ENN +  KV++V A DKD   N  + Y I     +    + F I+ +SGW+TA  +LDRE++  YQL I+A +K ++     ++ T+NI + D NDN P+   PKKLEI EN KP   +G +I+ D D G+NGK +F L+ +   ++F L  NGSL S   FDRE  D YCL I +ND G  P+S + T  +C+NILD NDN P +       +   ++  N++    S  I  S+YE+PGF+I    A D D+GENA   F +    D +    +F ID   G +++ R + +++IGDY ++II  D GK S + ++KI+      +  +  +   K +    +    I I++S  SA L  + I  +LC+I+PC     ++ +Y
Sbjct:   11 LYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMIL-RNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQHKYEVSVEENLPINSMIIQVEAVDEDEDSEITY----RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVINVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSDAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETIDDVKKVIIVCDDGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCTINITIIDVNDNSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHT--VCINILDVNDNPPRLIFPDYHPKYTWID--NSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD----IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKRQKSEHWTKSNKFQIAIMISIASAILMLIFISTVLCIIKPCSNRPNNRGDY 859          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000029841.1 (SMESG000029841.1)

HSP 1 Score: 471.47 bits (1212), Expect = 3.141e-146
Identity = 336/977 (34.39%), Postives = 525/977 (53.74%), Query Frame = 1
Query:  319 RFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELK-SYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAE-YPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTN--FFSINPNSGWITAIRRLDREEKINYQLAILAINKS-LKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNS--QNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXXXXXXXXXXXGPKIQVT----GNVLIVIILSTISAFLTALLIGAILCMIRPCCQ---SSLSQSNYQVDLNNSN-GQTLLQKLPPPHYNLYTYGPFEPSYESSWNQTLNRNDRLCSNVTLDFYENNPLEKPEYVGYESPRMYLSENTLCHVDHIVGKLNGCSCGRGGCVRYSNHGNPNCLSPNPEEQCSDSGRGASDDD 3204
            + +  L Y I+EN P+G+ +G IS DI +  N       DS+  F    ++  F L+ +S VLKT + IDLE LCP  C  D  G +NL VN+W  + L+G+  V ++I D NDN P F   +    IKE+LY  GKTI+LP+A+D+DV+  N+ + YKL  +SD F+L++     P L + K +D E  N + L L+AWN+       S L+I I +ID+ND EP F K L+ + + ENT +G ++ K+ A D D DS+L Y   +   S+    F ++  G + L+++LD E +  Y +    TDGEF + +K++  + DVN+  P +NLNP ++++ EN  P   + Q+ V D D+ D+NG ++C EP   +N Q + F+P+    Y  T+K  +   +  D      +   LIC D G+  RLTST  +T+ VLD NDN P+F+ PF +  +KEN+     +    A D D   NA++ YS++   TN     I+ NSG + + +  DRE++  Y+L I+A ++S +    + + +VNI V DEND  P++  P    I+EN     +IG + ++DKD G N   +FSL+    + +F L +NGSL+S+  FDRE K+E+ L++ + D G+  + S    I V ILD NDNAPVI++    K   Q +SKN+   QN     +  S++ +  + I      D D GEN +VT  +       ++  L  +DE+   +  +  ++RD+   Y+  I+A D G+ + R+EK +     + P ++  I  K +V+     N+LIVIIL+  SAFLTALL+ AILCMI+PC +      + S+  +D +N N  ++++  L      L +   F+ S+ +  ++         S+V L+F   N L+                      D+   KL  CS      V        +    + EEQ SDSGRGASD+D
Sbjct:   33 KLDNFLQYNIEENQPAGLVIGKISEDIKRNSNPVWFLTSDSNLRFLLSQESSLFELESKSGVLKTKQVIDLERLCPGNCIKDK-GVVNLTVNIWSPSNLQGIAKVSVIIDDINDNFPYFEQSTVEISIKEMLYTRGKTIKLPRAVDRDVSMKNNEISYKLKDSSDYFDLEMKTKFQPVLVVLKTMDSENINQFHLALLAWNSYFPSFNVSELKIIINVIDINDNEPFFSKPLYLIPVPENTPVGSIVHKISALDLDVDSQLRY-YSADPGSLITSIFKIEIQGSIRLLRSLDYETQPFYHMSAKVTDGEFIAFTKLKFVIIDVNDETPQFNLNPTNISVFENSEPK-EIAQVTVYDRDSEDINGKLKCYEPNYSTNKQIVSFLPNINNPYQFTIK--LIRSLDRDILNGDQQYATLICEDNGIPTRLTSTFTLTINVLDRNDNRPIFTQPFVQIAVKENSPTEIPIYTFGAEDIDRGLNARVIYSVMLNTTNDDCCRIDENSGKLFSFKTFDREQRSFYKLIIIATDQSQIDPKQSTSISVNITVLDENDEKPQLLPPYNFTILENQPQMTYIGLLKAQDKDEGANSGIIFSLVTDINSVFFLLLKNGSLYSRRRFDREEKEEFSLDVNLEDSGLHHTNSVKSRIYVKILDQNDNAPVINLPEFEKVLFQTQSKNSELDQNNYFYRLNVSIHSSVQYPIGQIKVVDRDIGENGKVTLKLIPELQDPKVPNLLSLDEEKNELYTTSSLNRDLKDCYQYTILAMDHGRPNRRSEKKVMFCFVNQPVETPLIPEKERVSSLSKANILIVIILAGTSAFLTALLVSAILCMIQPCKELNRRRYAHSHNVLDSSNQNPNESMMDNL------LKSREEFDESFLNKISE---------SSVDLNFNVQNKLQ----------------------DNWPLKLMACSDLNCQSVIMPQ----STFVTSTEEQRSDSGRGASDED 963          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000036217.1 (SMESG000036217.1)

HSP 1 Score: 458.759 bits (1179), Expect = 1.562e-141
Identity = 334/990 (33.74%), Postives = 498/990 (50.30%), Query Frame = 1
Query:  430 FLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILC---PKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNK-ASDTFELQI-SKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREE-------APTRTIYLICHDGGLHERLTSTSVITLQVL--DVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMEN----LKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPL-----FIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXX------XXXXXXXXXGPK----IQVTGNVLIVIILSTISAFLTALLIGAILCMIRPC--------CQSSLSQSNYQVDLNNSNGQTLLQKLPPPHYNL-YTYGPFEPSYESSW-NQTLNRNDRLCSNVTLDFYENNPLEKPEY---------VGYESPRMYLSE-NTLCHVDHIVGKLNGCS-----------CGRGGCVRYSNHGNPNCLSPNPEEQCSDSGRGASDDDM 3207
            F  +   + F  +N+YF+L  +S  + T   IDLE +C      C  D    +   VNVW EN    +I    +  D+NDNVP+FP K    +  EI     + I LP+AID DVTE N ++LY+L++   + F L I SK   P + + K++D E+++ + + L AWN G  E KS + IK E++D ND EP F +  + + + ENT +   I K+EA D DK ++L Y + +S     R  F V+E G +IL + LD E  Q +   V   DG + +++ I I V D+N+  P+ ++NP+ LT++EN      VGQ+ + D D+ +VNG I C EP G +NLQ   F PDP+    +  +++ SR+  DREE        P RT  LIC DG        T   TL VL  DVNDN PVF+   Y     ENN+I   + QV+A DKD+ +N++I Y ILE  +N F I+  SGWI A++  DREE  +Y + I A +    +L N T  VNI + D NDN P++       + EN    L P   IG + ++D D   NG+  F L+      YFD+  NG++++K++FDRE +D YC+ +R++D G    + +   +C+ ILD NDN+P       L  +D +    N+    +  I+ S+YE PG  + T  A D D  +N +++++++         PL     F ID D G IK+S+ +SR  IG Y++ +IA D G   L   K++ I +       +    S    PK       T NVLIV++LS ISA L  +LI  I CM+ PC         +    +S++     N +    L+ L     NL   YG F P+    + N+TL     +        Y +  L++  +         +G    R  + +     H +   G L   S           C    C+   N+ N   LS   +E  SDSGRG SDDD+
Sbjct:   55 FKSTQLRYKFSKENKYFSLTEKSGTITTKSTIDLEEICDNNEANCKADQPT-MTCTVNVWDENSFLAIITTVFLFEDENDNVPVFPFKFKTHRESEINLLRDRKIYLPQAIDNDVTEKNRKILYELHQNEEEFFRLNIDSKTGKPFVVVLKNLDAESQSNHTVILEAWNEGMKERKSQIVIKFEVLDFNDNEPFFNQSTYVITIPENTPLSTNIYKIEAIDPDKTARLSYRLDNSVKLAIRRLFLVQEEGWIILNRGLDYEIDQMHLFVVEVFDGVYAASTTICIKVTDINDETPNIHINPSKLTIKENLISGTFVGQVKISDRDSVEVNGKICCYEPDGMNNLQPFTFHPDPSITQESNIFEIKSRITFDREEFLNNERIHPIRTALLICSDGHGTNNAQLTITFTLSVLIEDVNDNRPVFTESIYNIFFMENNHIHAHIHQVLATDKDEGQNSRITYDILE--SNDFKIDSVSGWINAMKIFDREEMDHYVVTIKAQDHGNPSL-NTTVKVNITIGDRNDNPPQLISSSDFSVEENRNVSLGP---IGYLKAKDDDIAENGEIRFDLM-WPHKGYFDITPNGTIYAKVSFDREKEDRYCMRLRISDNGKENKQETYVHLCIKILDVNDNSPQFMEPPYLLSRDNIAGPTNAP---TTPIELSIYEIPGQILVTIKAIDLDADKNGKISYSLK--------IPLGVPRYFEIDRDGGEIKVSQTLSRSDIGSYRIHVIASDNGVPPLSDIKVLLINLADIPPGLNNQKGSDINSPKTWQMFGSTNNVLIVVVLSGISAILVVVLITVISCMLNPCRNHNSHIFSRGQRYESSFDNQSKNHDHLNDLELLS----NLDKQYGDFHPNLSDEFENRTLIIPSSIYEQTNYRIYPSPSLKERNFHLWPQNENIIGLNPNRTIVQDTGHRLHPEINYGTLQSFSLNRMPNRSAPLCIHNRCISPYNNNNDTLLSTINDEHQSDSGRGGSDDDI 1021          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000020970.1 (SMESG000020970.1)

HSP 1 Score: 447.588 bits (1150), Expect = 7.006e-137
Identity = 345/987 (34.95%), Postives = 518/987 (52.48%), Query Frame = 1
Query:  328 GNLNYTIQENHPSGIQVGFISSDITQIPNIDLPK-FLDSSFYFTF-RDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGH-DELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREE--APTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSILEGP-TNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKAL-FNATTTVNIEVTDENDNVPEIYLP-KKLEIMENLKPYQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDE--YCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKXXXXXXX----XXXXXXXXXGPKIQVTGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQVDLNNSNGQTLLQKLPPPHYNLYTYGPFEPSYESSWNQTLNRNDRLCSNVTLDFYENNPLEKPEYVGYESPRMYL-SENTLCH-VDHIVGKLNGCSCGRG--GCVRYSNHGNPNCLSPNPEEQCSDSGRGASDDDMKALNVNGSV 3234
            G +NY I+EN P G+ VG +      + N+   + F+   ++F   ++  E+F+L   SS+L T+K IDLE LC      +G     +V  V ++ Q    + + I++ D NDN P F   S+ K IKEI+YG GK+I+LP+A DKD++ IN+++ Y L + S  F   +SKD  P L + K++D ET + + L LIAWN  +     + L I I I D+ND EP F + ++++ + EN ++   I++L+ATDKDK S+L + +V + N    +TFA+ + G + L+K LD E    YEIPV  TDGEF+SN ++ + + DVN+  P + LNP +L + EN     L+G I V D D++ V+  I C+E  G  N   ++F         T K +++   ++DR++     R   +IC+D G++ RLT+T  +TL VLD NDN P F++  Y  ++KEN      ++ V A DKDD  N+QIKY I +     +F I+ NSG I  I+ LDRE++  YQ+ ++A + ++  +   +T TV+I V D ND  P I        + EN      IG +I+ D D G NGK +F+LI S  + YF+L  NGSL +K++FDRE   +  + L I V D+G  I  SS   +C+ ILD+NDN+P ISV           S NN+ +    + K     +P F    +   D D G N QV F+M+    S +   LF ++    +IK+ R   +     + + +IA DKG     T K+I +Q       +  Q+ ++G    V  NVLI+IIL TIS  LT  LIGAI+CM +PC        N +   N  NG          + NL   G     Y+ S+         L ++  +D  EN+  E    V +     Y  SE+   H +D     +N  +       C   ++H          EEQ SDSGRGASD+D    N N  V
Sbjct:   44 GTINYWIKENQPPGLVVGNL------LDNLPYKQYFISPGYHFVLQKESEEFFSLKPGSSMLTTSKLIDLESLCGSSDCYNGTKEFQVVALVMRDKQFIQELRINIIVEDVNDNDPFFKNASYTKNIKEIIYGPGKSIDLPRAFDKDLSLINNQISYSLQETSTYFHFSVSKDGKPILIIIKELDAETIDTHRLILIAWNQNYPSRPTASLSITIVIDDINDNEPRFSQSIYKVPILENVELNHQILQLKATDKDKTSRLQFIIVPTINVEIAKTFAISDQGMIYLIKHLDYETAPKYEIPVRVTDGEFSSNGRVEVVIIDVNDCAPQFTLNPENLVISENTLSKTLLGNIVVYDQDSAYVDSGIECRE--GSPN-DAMRFDITENNSERTKKINIYLNQEIDRDQINGDRRFSVIICNDMGINNRLTATFTVTLTVLDANDNSPQFTLTDYVVRVKENLKPQYPLIDVSATDKDDGVNSQIKYFISDHTHQQYFKIDENSGKIIGIQSLDREKQDYYQVTVVATDLAINEIRHTSTATVHIHVIDVNDCAPRINESLNTFSVYENQPIGTVIGKLIATDCDIGQNGKFIFTLIPSAFSHYFELLTNGSLLTKVSFDRESLSQVKFSLRITVRDIGEEIHLSSKTAVCIKILDENDNSPKISVIPDFIAAYNY-SDNNTTDCSITVSKTESTNSPIFPFTFS---DLDDGPNGQVAFSMKIYPISLKSNQLFYLNVTEKAIKLKRSWQQSDGNRFLVTLIAKDKGSPPRETSKVIMVQFADIPPRLIDQNISMGSFSNVKINVLIIIILVTISTVLTTALIGAIICMWQPC-------GNKRQSANCRNGVMRDNA----NDNLRIKG-----YQDSY---------LVTSSIIDSVENDETEFKTSVSHIQQNDYCKSEHHWTHEIDETGRPINYYTLPPQLLACTTTTSH----------EEQRSDSGRGASDEDNPHYNSNSDV 982          
The following BLAST results are available for this feature:
BLAST of Protocadherin gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y2.251e-6928.70protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.489e-6928.70protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.806e-6928.34protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.806e-6928.34protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.933e-6928.50protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.478e-3826.75FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-13.483e-3826.75FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.862e-3526.06CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-31.341e-3425.60Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
cdh-42.087e-3125.40Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kug4.526e-4928.40gene:FBgn0261574 transcript:FBtr0332722[more]
kug4.601e-4928.40gene:FBgn0261574 transcript:FBtr0346077[more]
kug4.601e-4928.40gene:FBgn0261574 transcript:FBtr0332721[more]
ft1.740e-4726.77gene:FBgn0001075 transcript:FBtr0077478[more]
ds1.609e-4526.87gene:FBgn0284247 transcript:FBtr0078045[more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.489e-6927.99protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a4.161e-6927.99protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh112.288e-6527.86protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.403e-6527.73protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh97.430e-6528.27protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa6.723e-7028.92VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
pcdh178.718e-7028.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.006e-6928.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.823e-6928.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.843e-6928.85protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh92.798e-6828.15protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.168e-6728.15protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.229e-6728.15protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.229e-6728.15protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.415e-6728.15protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG1.869e-7128.70Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q6X862|PC11X_GORGO9.414e-6928.50Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q9BZA8|PC11Y_HUMAN1.081e-6828.70Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WXV7|PC11X_PONPY1.520e-6828.50Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q9BZA7|PC11X_HUMAN2.705e-6828.50Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A2512.140e-13833.47Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7CGZ35.933e-13832.27Protocadherin Fat 4 OS=Clonorchis sinensis OX=7992... [more]
A0A4S2KYT37.907e-13832.21Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0R3TLN61.068e-13531.90Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3UI681.204e-13331.46Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.563e-7227.74protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.153e-7227.74protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh112.669e-6828.03protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.781e-6827.78protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1b5.941e-6829.23protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.333e-5228.30protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.13.516e-4925.67pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.11.612e-4826.82pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000010725.11.772e-4725.16pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.12.313e-4524.71protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461894.769e-5927.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464171.740e-5026.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464841.709e-4926.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404703.772e-4927.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333596.397e-4925.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.632e-6327.80protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.620e-6327.80protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.669e-6327.80protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1a3.737e-6127.02protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a4.731e-6126.93protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046654.10.000e+099.82SMESG000046654.1[more]
SMESG000036716.14.925e-17237.70SMESG000036716.1[more]
SMESG000029841.13.141e-14634.39SMESG000029841.1[more]
SMESG000036217.11.562e-14133.74SMESG000036217.1[more]
SMESG000020970.17.006e-13734.95SMESG000020970.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017265 ID=SMED30017265|Name=Protocadherin gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=3731bp
CGTGTTTGTTTTCCACACTTACTATTATTATCATGATTATTGTTTTGTTA
TATTTCATCTGACTATTTCGACAAAGTTAACTAATACAAATAAACCAATC
AGAATGCTCGTTCAATGAGTAGAATACTGTCAATTCCAAAGAAAGATTAA
AGTGCGATCCTATTCGTCCTTTGAGGAAACTCATTTTCATTTCTATTGTA
TTAAATCCGAATTCATTATTTTAAAACCATGAAGCAATTGAAGCATTGAA
GCAAAAGAAATATGAAAATCTATTTAATTGTTTGGATACTTTCTAATTCG
CTTTCAATTGTTTTTTCGAGATTTGAAGGCAATTTAAATTACACAATTCA
AGAAAATCATCCGTCCGGCATTCAAGTTGGCTTTATTTCCTCTGACATTA
CTCAAATTCCGAATATTGATCTACCGAAATTTCTCGATTCTTCATTCTAT
TTCACGTTTCGTGACAAGAACGAATACTTTACTCTCGATCGGCAGTCAAG
TGTATTAAAAACGGCTAAAAAAATTGACTTGGAAATCCTTTGTCCGAAGT
TCTGCAACGACGATGGAGTAGGATTTCTCAATCTTGTCGTCAATGTTTGG
AAAGAAAACCAACTTCGTGGAGTGATCAATGTGAAAATTGTGATTCACGA
TCAAAACGACAATGTGCCTATGTTTCCGATGAAAAGTTTTGTAAAGAAAA
TCAAAGAAATTCTTTATGGGGTTGGAAAAACAATTGAACTTCCGAAAGCC
ATTGACAAAGACGTGACAGAAATTAATAGCCGGGTGTTATATAAGTTAAA
TAAAGCTTCGGACACCTTTGAATTGCAGATTTCAAAAGACAACACCCCTC
GGTTACGATTGACAAAGGATATAGATTATGAAACTAAAAACTTTTACGAA
TTGACATTGATAGCTTGGAATAACGGGCATGATGAATTAAAATCTTATTT
AGAAATAAAAATCGAGATCATCGACATGAATGACTGTGAGCCAGTGTTCA
AGAAAGGTCTTTTTGAATTGGTACTCGACGAGAACACAAAAATTGGAAAG
TTAATAATTAAACTCGAGGCTACTGACAAAGATAAAGACAGTAAACTGGT
CTATGGAATGGTATCATCAACGAATTCAATAAATAGAGAAACCTTTGCTG
TGAAAGAAACTGGAGAAGTAATTCTAATGAAAACTCTTGATGTCGAATTT
CGTCAGACCTATGAAATCCCTGTCTACGCAACAGATGGGGAGTTCACTTC
TAATTCCAAAATACGAATATTTGTCCGTGATGTAAATAATCATCCACCAT
CTTATAATTTAAACCCGGCCAGTTTGACATTGGAGGAAAATCAACCACCT
AATATTTTAGTGGGACAGATAAATGTTAAAGATGTTGATGCATCCGATGT
TAATGGAGACATCAGATGCCAAGAACCGCTTGGAAAATCAAATTTGCAGG
ACCTGAAATTTGTTCCAGATCCAGCAGAATACCCATTAACTGTAAAATAT
GATATGTTCTCCAGGGTTCAACTTGATCGAGAGGAAGCCCCAACAAGAAC
GATATACCTTATTTGTCATGATGGCGGACTTCATGAAAGACTTACATCAA
CGTCGGTTATCACTCTTCAGGTGCTGGATGTGAATGACAATCCTCCAGTT
TTTTCCATTCCTTTTTACAAAGCTCAAATTAAAGAAAACAATAATATCGG
AGACAAAGTGTTACAAGTTGTAGCTCACGATAAAGACGACAAAGAAAATG
CTCAAATCAAATATTCAATATTAGAAGGTCCAACTAATTTTTTTTCTATT
AATCCGAACTCCGGCTGGATAACAGCTATCAGAAGACTAGATAGAGAAGA
AAAGATTAACTATCAACTCGCCATTTTGGCCATCAACAAGTCTTTAAAAG
CCCTATTCAATGCAACAACAACTGTTAACATTGAAGTTACAGATGAAAAT
GATAATGTTCCTGAAATTTATTTACCAAAAAAGTTAGAAATCATGGAAAA
TTTGAAACCTTATCAATTCATTGGAAATATTATTTCCGAAGATAAGGACT
TTGGAAATAATGGAAAGACCGTTTTCAGTTTGATAAATTCAAAAGAGACA
GATTATTTTGATTTAAAAAGAAACGGGTCACTTTTTTCAAAAATCACTTT
TGACAGAGAATTGAAAGATGAATATTGTTTGAATATTCGCGTAAATGATC
TTGGTGTTCCCATTTCAAGATCCTCAACAAAACCGATTTGTGTAAATATT
CTGGATGATAATGATAACGCTCCAGTCATTTCAGTTCATAGCACTCTAAA
GGAACAAGATCAATTAGAATCAAAAAACAACTCTCAGAATTTAGGCAGTG
AAATAATAAAAGCGTCGGTATATGAAAATCCTGGTTTCAAAATTGCAACT
GCTGTCGCAGACGATGCCGACAAGGGAGAGAATGCACAAGTAACATTTAC
GATGGAGGATATTACGGATTCCAACCAAATTGCCCCTTTATTTATCATTG
ACGAAGACAACGGATCAATTAAAATTAGTAGAATTATGTCTCGCGATGTT
ATTGGGGATTATAAAATGAAAATTATCGCCTGTGACAAAGGAAAATCTTC
TTTAAGAACCGAAAAGATTATCAGAATTCAAATTCAAGACATTCCACCGC
AAAGTTCAACAATTGGACCTAAAATTCAAGTAACTGGAAACGTTTTAATT
GTCATAATCCTTTCTACAATATCAGCATTTCTTACTGCACTTTTGATTGG
AGCTATTCTATGCATGATACGTCCTTGCTGCCAGTCTTCCCTTTCTCAAT
CCAACTATCAAGTAGATTTAAATAATTCAAACGGACAGACATTGCTACAA
AAGTTACCGCCGCCCCATTATAATTTATACACATATGGTCCTTTTGAACC
GTCTTATGAATCATCATGGAATCAAACATTAAATCGAAATGATAGGCTAT
GCAGCAATGTCACTTTAGATTTTTATGAAAATAATCCTCTTGAAAAGCCT
GAATATGTTGGATATGAATCTCCTCGAATGTATTTGTCAGAAAATACTTT
ATGTCATGTTGACCACATAGTTGGTAAACTCAACGGATGCTCCTGTGGTC
GAGGAGGATGTGTAAGGTATTCAAATCATGGCAATCCGAATTGCTTATCC
CCAAATCCAGAAGAGCAGTGTTCAGACAGTGGTAGAGGAGCTAGTGATGA
CGATATGAAAGCCTTAAATGTGAATGGAAGCGTTGCTTCTTCATCTAGAC
CCCCTCTTTCAGTTTACGGGACATATACTTTAGGTGATTCAAGATCCAAA
TCTCCTAGACCTGACGGATTCCTAACTATGAATTCAAACCTGACGGATCA
AATATTAGATCAACGAAGGATTCATATGAATCAGTCTCAATCGAATTTTA
TGGCGCCTTTCTGTAGTCAATCCACTCAAATACCTTTAACAACATTCCAA
CCGACTATCAACTCGGAACCACAAATCAAATCCTCAAACCTTAGAAATAG
CGTTCTTCATTTAGCGAAATCCTCCTCCATAGATTCATTATCAAACATTC
CCCACCAAAACTCCAACCTTCCTTCCCCGACAAATACCGATCGTAAAAAT
TCTCAATTTTTCAACAAAATCATGAATCAAGAATTTAATCATTGTTAATT
ATTTTTTTATAAATCTTATCTTTTCCTCTTTATATCTTACAATCCATTCT
TAAATCATGTATTTTTTTTTATTTTTATTCC
back to top

protein sequence of SMED30017265-orf-1

>SMED30017265-orf-1 ID=SMED30017265-orf-1|Name=SMED30017265-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1129bp
MKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIP
NIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCND
DGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFPMKSFVKKIKEI
LYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRL
TKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGL
FELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKET
GEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNL
NPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKF
VPDPAEYPLTVKYDMFSRVQLDREEAPTRTIYLICHDGGLHERLTSTSVI
TLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIK
YSILEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFN
ATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPYQFIGNIISEDKDFGNN
GKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVP
ISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIK
ASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDN
GSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKIIRIQIQDIPPQSST
IGPKIQVTGNVLIVIILSTISAFLTALLIGAILCMIRPCCQSSLSQSNYQ
VDLNNSNGQTLLQKLPPPHYNLYTYGPFEPSYESSWNQTLNRNDRLCSNV
TLDFYENNPLEKPEYVGYESPRMYLSENTLCHVDHIVGKLNGCSCGRGGC
VRYSNHGNPNCLSPNPEEQCSDSGRGASDDDMKALNVNGSVASSSRPPLS
VYGTYTLGDSRSKSPRPDGFLTMNSNLTDQILDQRRIHMNQSQSNFMAPF
CSQSTQIPLTTFQPTINSEPQIKSSNLRNSVLHLAKSSSIDSLSNIPHQN
SNLPSPTNTDRKNSQFFNKIMNQEFNHC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 516..542
score: 30.19
coord: 71..90
score: 25.49
coord: 246..275
score: 29.59
coord: 462..475
score: 34.98
coord: 316..328
score: 35.46
coord: 443..462
score: 44.46
coord: 551..568
score: 44.04
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 714..796
e-value: 2.1E-9
score: 47.2
coord: 49..136
e-value: 1.2
score: 2.8
coord: 372..462
e-value: 1.1E-4
score: 31.5
coord: 590..671
e-value: 2.1E-12
score: 57.2
coord: 161..244
e-value: 6.9E-9
score: 45.5
coord: 486..567
e-value: 2.5E-24
score: 96.8
coord: 268..346
e-value: 7.6E-12
score: 55.4
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 575..663
e-value: 2.5E-9
score: 37.5
coord: 700..792
e-value: 1.2E-8
score: 35.3
coord: 254..326
e-value: 1.3E-8
score: 35.1
coord: 156..236
e-value: 6.7E-8
score: 32.9
coord: 469..560
e-value: 1.2E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 671..799
e-value: 2.0E-14
score: 55.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 567..670
e-value: 5.0E-18
score: 67.6
coord: 132..241
e-value: 7.0E-16
score: 60.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 242..343
e-value: 4.1E-18
score: 67.9
coord: 344..459
e-value: 2.7E-13
score: 52.3
coord: 460..566
e-value: 3.3E-30
score: 106.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 24..130
e-value: 4.3E-10
score: 41.6
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 419..795
coord: 21..569
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 569..673
score: 20.788
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 349..464
score: 16.359
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 21..138
score: 13.137
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 465..569
score: 26.86
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 707..805
score: 15.526
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 163..246
score: 16.907
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 247..348
score: 20.525
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 154..241
e-value: 2.21327E-11
score: 59.2493
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 469..565
e-value: 1.59546E-28
score: 108.17
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 701..794
e-value: 1.31992E-15
score: 71.1905
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 575..669
e-value: 1.30215E-19
score: 82.7465
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 251..344
e-value: 1.22104E-15
score: 71.5757
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 26..134
e-value: 1.45608E-4
score: 39.9894
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 352..460
e-value: 2.12869E-11
score: 59.2493
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.587
NoneNo IPR availableTMHMMTMhelixcoord: 811..833
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 25..96
e-value: 1.7E-5
score: 24.5
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 661..671
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 452..462
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 557..677
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 27..138
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 702..794
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 341..457
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 453..570
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 132..238
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 234..330