Pre mRNA processing factor 6

Overview
NamePre mRNA processing factor 6
Smed IDSMED30017260
Length (bp)2895
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre mRNA processing factor 6 (SMED30017260) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre mRNA processing factor 6 (SMED30017260) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre mRNA processing factor 6 (SMED30017260) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre mRNA processing factor 6 (SMED30017260) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017260

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017260SMESG000011657.1 dd_Smed_v4_1153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017260SMESG000011657.1 dd_Smed_v4_1153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017260SMESG000011657.1 dd_Smed_v4_1153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017260SMESG000011657.1 dd_Smed_v4_1153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017260SMESG000011657.1 dd_Smed_v4_1153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017260SMESG000011657.1 dd_Smed_v4_1153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre mRNA processing factor 6 vs. Ensembl Human
Match: PRPF6 (pre-mRNA processing factor 6 [Source:HGNC Symbol;Acc:HGNC:15860])

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 502/950 (52.84%), Postives = 655/950 (68.95%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESEN+E++RA RLL +AR +  T RV+MKS +LEW   N+ +A+ L  EA   +  +PKLWMM GQ+ EQK+  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E+I +  +  R  KS DAL KCEH  HVLLA AK+FW Q +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC +SKD+ANW+ K  DIL LVA +I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRI 937          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Human
Match: CRNKL1 (crooked neck pre-mRNA splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:15762])

HSP 1 Score: 87.4261 bits (215), Expect = 6.744e-17
Identity = 124/500 (24.80%), Postives = 196/500 (39.20%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLK---TKRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQ 2444
            ++ K+    DNI + ++V           +S W+  A  EE+LK     R +Y+RAL     ++ LW    E+E        A+ + + A+   P   + W         L N   AR V     +  P + Q W +    E      ++   + +R +      +V  +   WIK A   EK      A+K+ +R V    DE   +  ++A A+  E     E  R IY  A+  +SK+    ++K    FEK+ G R   E I+          EV         W    +      + E+ R V  RA A  P  +E       I L    A+  E E  + +R  ++ Q +            ++W+  A+ E    NL  A   L  +  K PK  KL+ +  ++  Q +EF      Y+      PE+   W   A LE  LG +  AR   E A ++  + +PE LW + I  E+     E   NL  R LQ
Sbjct:  212 KLRKRKTFEDNIRKNRTV-----------ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARTIYERFV------LVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPK-NKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQ 692          

HSP 2 Score: 67.781 bits (164), Expect = 9.386e-11
Identity = 87/430 (20.23%), Postives = 183/430 (42.56%), Query Frame = 3
Query:  930 VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPN---DRQIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLS--KKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRV--WMKSARLEWCLGNLDSAETL 2120
            +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK       ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  V   P  V+ W+  A+          AR V   A +   +   D  +++   K EE +   E++  + + A++ + K +  E+ ++  I + +  ++ G  + + +++  Q    +  +  +    W       E     E  R +Y  AI+++   ++K  WKR        A +E+        TR+ Y+  L        T   +W++ A+ +    ++  AR  L  +    P + ++    ++LE +  EFDR  +L ++  +  G +    W+K A LE  LG++D A  +
Sbjct:  230 ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----NRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARTIYERFVLVHP-DVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKN-KLFKVYIELELQLREFDRCRKLYEKF-LEFGPENCTSWIKFAELETILGDIDRARAI 650          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Human
Match: CRNKL1 (crooked neck pre-mRNA splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:15762])

HSP 1 Score: 87.0409 bits (214), Expect = 7.245e-17
Identity = 125/507 (24.65%), Postives = 197/507 (38.86%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQHCPDSGV 2465
            ++ K+    DNI + ++V           +S W+  A  EE+LK     R +Y+RAL     ++ LW    E+E        A+ + + A+   P   + W         L N   AR V     +  P + Q W +    E      ++   + +R +      +V  +   WIK A   EK      A+K+ +R V    DE   +  ++A A+  E     E  R IY  A+  +SK+    ++K    FEK+ G R   E I+          EV         W    +      + E+ R V  RA A  P  +E       I L    A+  E E  + +R  ++ Q +            ++W+  A+ E    NL  A   L  +  K PK  KL+ +  ++  Q +EF      Y+      PE+   W   A LE  LG +  AR   E A ++  + +PE LW + I  E+     E   NL  R LQ      V
Sbjct:   63 KLRKRKTFEDNIRKNRTV-----------ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARTIYERFV------LVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPK-NKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKV 550          

HSP 2 Score: 67.781 bits (164), Expect = 8.459e-11
Identity = 94/463 (20.30%), Postives = 194/463 (41.90%), Query Frame = 3
Query:  834 PQMSMNPSGSEVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPN---DRQIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLS--KKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRV--WMKSARLEWCLGNLDSAETL 2120
            PQ  +     E+ D K + R   +     N   +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK       ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  V   P  V+ W+  A+          AR V   A +   +   D  +++   K EE +   E++  + + A++ + K +  E+ ++  I + +  ++ G  + + +++  Q    +  +  +    W       E     E  R +Y  AI+++   ++K  WKR        A +E+        TR+ Y+  L        T   +W++ A+ +    ++  AR  L  +    P + ++    ++LE +  EFDR  +L ++  +  G +    W+K A LE  LG++D A  +
Sbjct:   49 PQQKIT-DEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----NRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARTIYERFVLVHP-DVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKN-KLFKVYIELELQLREFDRCRKLYEKF-LEFGPENCTSWIKFAELETILGDIDRARAI 501          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Human
Match: CRNKL1 (crooked neck pre-mRNA splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:15762])

HSP 1 Score: 87.4261 bits (215), Expect = 8.093e-17
Identity = 124/500 (24.80%), Postives = 196/500 (39.20%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLK---TKRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQ 2444
            ++ K+    DNI + ++V           +S W+  A  EE+LK     R +Y+RAL     ++ LW    E+E        A+ + + A+   P   + W         L N   AR V     +  P + Q W +    E      ++   + +R +      +V  +   WIK A   EK      A+K+ +R V    DE   +  ++A A+  E     E  R IY  A+  +SK+    ++K    FEK+ G R   E I+          EV         W    +      + E+ R V  RA A  P  +E       I L    A+  E E  + +R  ++ Q +            ++W+  A+ E    NL  A   L  +  K PK  KL+ +  ++  Q +EF      Y+      PE+   W   A LE  LG +  AR   E A ++  + +PE LW + I  E+     E   NL  R LQ
Sbjct:  224 KLRKRKTFEDNIRKNRTV-----------ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARTIYERFV------LVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPK-NKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQ 704          

HSP 2 Score: 67.3958 bits (163), Expect = 9.863e-11
Identity = 87/430 (20.23%), Postives = 183/430 (42.56%), Query Frame = 3
Query:  930 VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPN---DRQIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLS--KKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRV--WMKSARLEWCLGNLDSAETL 2120
            +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK       ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  V   P  V+ W+  A+          AR V   A +   +   D  +++   K EE +   E++  + + A++ + K +  E+ ++  I + +  ++ G  + + +++  Q    +  +  +    W       E     E  R +Y  AI+++   ++K  WKR        A +E+        TR+ Y+  L        T   +W++ A+ +    ++  AR  L  +    P + ++    ++LE +  EFDR  +L ++  +  G +    W+K A LE  LG++D A  +
Sbjct:  242 ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----NRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARTIYERFVLVHP-DVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKN-KLFKVYIELELQLREFDRCRKLYEKF-LEFGPENCTSWIKFAELETILGDIDRARAI 662          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Human
Match: PDCD11 (programmed cell death 11 [Source:HGNC Symbol;Acc:HGNC:13408])

HSP 1 Score: 55.0694 bits (131), Expect = 7.467e-7
Identity = 68/254 (26.77%), Postives = 115/254 (45.28%), Query Frame = 3
Query: 1134 PNSVSLWV--AAANLEET-LKTKRVVYKRALAEIP-----DSVKLWKLIVELED---DPEEAKQLLEGAVQCC-PTSVELWLA--LAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAIS-SLSKK--KGIWKRAAAFEKEHGTRENYEKILSQAVEHCD 1844
            PNS  LW+   A +L+ T ++  R V +RAL  I      + + +W  ++ LE+     E   ++ E AVQ   P  V L LA   AK     EA  + N   ++   ++ +WI                R++QRA+E L S     + D   K A+   + G+   A+ I +  +S       R   W    +   +HG  +  R I+   I  SL+ K  K  +KR   +EK+HGT ++ + + ++A+E+ +
Sbjct: 1616 PNSSILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQESLTKVFERAVQYNEPLKVFLHLADIYAKSEKFQEAGELYNRMLKRFRQEKAVWIKYGAFLLRRSQAAASHRVLQRALECLPSKE---HVDVIAKFAQLEFQLGDAERAKAIFENTLST---YPKRTDVWSVYIDMTIKHGSQKDVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVE 1863          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Celegans
Match: prp-6 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q9GRZ2])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 429/973 (44.09%), Postives = 609/973 (62.59%), Query Frame = 3
Query:   81 NLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQ-------------HKRARXXXXXXXX-XXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQM-NVIDPRLSTTT-----------------------GLQTP-----------MDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPN-SEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLP 2849
            +L+ K +K F+G+PAP+GYV G+GRGATGFTTRSDIGPARD T++P+   +               KRAR+D+ +    N++NYDEFSGY G++ SKDPY+++D +AD IY  +D  +D+R K  RE + ++ +E + + RPKIQQ F DLKR+L  V+ DEW+ IPEVGD RN+ +RN R + + P PDS+IA   +  QM + ID     TT                       G+ TP             ++D+ +IG+AR  +MD QL++VSDSV GQTV+DPKGYLTD+QS++PQM     G ++ DIKK+R+LLKS+ +TNP     W++    EE   K+  A+  +M+GCE    SEE+W+ AIR+     G       +S+ + A++  P+SV LW  A++LE+ LK K+ V ++AL +IP SVKLWK  VELED PE+A+ LL  AV+CC +S E+WLALA+L     AR VLN AR+ IP DR IW++A +LEE  G  + +++++ +A+  LK N VEINRD+W+KDA +AE +   +T Q II+ V+ +GV+++D++ TWLADAE  E+     C R +Y+IA+   S+K+ IW  A  FE+EHG+ + +E IL +A E    VE  WLM AK ++    V  AR+ L  AF  + + SE+I LAA K+E E ++FD A  L  +AR    + RVWMK+A  EWCLGN++ A+ L  E  +K+  + K++++LGQV EQ  +   A  +Y  G  K P  +PLW L   LEEK G +  AR  LEKA+ +N K  +LWL S+R E R    E A   MSRALQ C  SG LWAE+I +     R  KS DAL KCEH+ HVL+AAA++FW + +I  AR W ++ + ++   GDA+ +    E I+G E  R+ V  +CV +EPR+G+ W  +SKD  NW+  T++IL L   KI +P
Sbjct:    8 SLVNKTKKFFMGMPAPTGYVPGVGRGATGFTTRSDIGPARDPTELPEAGPVGPSPQGASSSSAPPAKRARDDDGDGEDLNEANYDEFSGYSGSLFSKDPYDQEDEDADRIYNEVDDRLDERHKERREKKYKELVELFHKDRPKIQQGFQDLKRQLAEVTEDEWQAIPEVGDMRNKAKRNARAEKFTPVPDSIIAMNMNYGQMSHSIDSGNGLTTPFASGFMSTLGGGGGAAAAGAKSGIMTPGWKSDIPSSGTSTDLDLVKIGQARNKIMDMQLTQVSDSVTGQTVVDPKGYLTDMQSIIPQM-----GGDLQDIKKARMLLKSVRETNPRHPPAWVASAVLEEQAGKLQTARNFIMEGCEKIKNSEELWLHAIRLHPPELG-------RSIVANAVRSCPHSVRLWCKASDLEQDLKDKKKVLRKALEQIPSSVKLWKAAVELED-PEDARILLTRAVECCSSSTEMWLALARLETYENARKVLNKAREHIPTDRHIWLSAARLEETRGQKDMVDKIVAKAMSSLKVNQVEINRDQWLKDAVDAEMAKCPITCQAIIRNVIGLGVEDEDKRTTWLADAENFEKEEAFTCVRTVYAIALKEFSRKRSIWDAAIHFEREHGSLDEHEAILLKACETVPEVEDYWLMLAKLRFVNKRVGEARDTLMSAFEKHGHQSEKIWLAATKIEIETDQFDTARGLFGKARAKAPSARVWMKNAHFEWCLGNVEEAKRLCEECIQKYDDFHKIYLVLGQVLEQMNDVHGARLAYTQGIRKCPGVIPLWILLVRLEEKAGQIVKARVDLEKARLRNPKNDDLWLESVRFEQRVGCPEMAKERMSRALQECEGSGKLWAEAIWMEGPHGRRAKSIDALKKCEHNPHVLIAAARLFWSERKIKKAREWFVRAVNLDPDNGDAFANFLAFEQIHGKEEDRKSVFKKCVTSEPRYGDLWQSVSKDPINWRRTTEEILQLATQKIKVP 967          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Celegans
Match: M03F8.3 (pep chromosome:WBcel235:V:5940024:5943362:1 gene:WBGene00019762.1 transcript:M03F8.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M03F8.3)

HSP 1 Score: 70.0922 bits (170), Expect = 6.135e-12
Identity = 105/531 (19.77%), Postives = 211/531 (39.74%), Query Frame = 3
Query:  879 KKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPT----EARAVLNTARQKIPND---RQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKS-GNKVTAQKIIQRVVSIGVDEQDRKQTWLADA-----------EACEEHGCLECARAIYSIAISSLSKKKGIWKR---------------AAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRA-RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEK----FPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKA 2336
            +K R   +     N  +++ WI   ++EE   +I  A+ +  +  +    S  +W++   +  +      I+ A++V  +AI  +P ++  W+  + +EE ++     R +++R +   P   + W+  +  E    + + A+ + +  +     +V+ W+  AK          ARA    A +    +     + +     EE +   E+   + +  ++ L SN  E    E  K   + EK  G +V  + +I        ++   +  +  DA           E   E       RAI +I   S  ++K  W+R               A  F++    R+ Y+  +        T   +W+M A  +    D+ +AR ++  A    P  +++  A + LE +  EFDR  +L ++    +  + + W+K A LE  LG+ D +  +   A ++     P+   LW          +E + A   Y +  L+    + +W   A  E+ +G    AR   E+A
Sbjct:   69 RKKRKEFEDGIRKNRMQLANWIKYGKWEESIGEIQRARSVFERALDVDHRSISIWLQYAEMEMR---CKQINHARNVFDRAITIMPRAMQFWLKYSYMEEVIENIPGARQIFERWIEWEPPE-QAWQTYINFELRYKEIDRARSVYQRFLHVHGINVQNWIKYAKFEERNGYIGNARAAYEKAMEYFGEEDINETVLVAFALFEERQKEHERARGIFKYGLDNLPSNRTE----EIFKHYTQHEKKFGERVGIEDVIISKRKTQYEKMVEENGYNYDAWFDYLRLLENEETDREEVEDVYERAIANIPPHSYFQEKRYWRRYIYLWINYALYEELVAKDFDR---ARQVYKACIDIIPHKTFTFAKVWIMFAHFEIRQLDLNAARKIMGVAIGKCP-KDKLFRAYIDLELQLREFDRCRKLYEKFLESSPESSQTWIKFAELETLLGDTDRSRAVFTIAVQQPALDMPEL--LWKAYIDFEIACEEHEKARDLY-ETLLQRTNHIKVWISMAEFEQTIGNFEGARKAFERA 584          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Celegans
Match: M03F8.3 (pep chromosome:WBcel235:V:5940024:5943362:1 gene:WBGene00019762.1 transcript:M03F8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M03F8.3)

HSP 1 Score: 67.3958 bits (163), Expect = 4.122e-11
Identity = 105/531 (19.77%), Postives = 212/531 (39.92%), Query Frame = 3
Query:  879 KKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPT----EARAVLNTARQKIPND---RQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKS-GNKVTAQKII--------QRVVSIGVDEQDRKQTWLADAEACE-EHGCLECARAIYSIAISSL--SKKKGIWKR---------------AAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRA-RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEK----FPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKA 2336
            +K R   +     N  +++ WI   ++EE   +I  A+ +  +  +    S  +W++   +  +      I+ A++V  +AI  +P ++  W+  + +EE ++     R +++R +   P   + W+  +  E    + + A+ + +  +     +V+ W+  AK          ARA    A +    +     + +     EE +   E+   + +  ++ L SN  E    E  K   + EK  G +V  + +I        +++V       D    W       E E    E    +Y  AI+++    +K  W+R               A  F++    R+ Y+  +        T   +W+M A  +    D+ +AR ++  A    P  +++  A + LE +  EFDR  +L ++    +  + + W+K A LE  LG+ D +  +   A ++     P+   LW          +E + A   Y +  L+    + +W   A  E+ +G    AR   E+A
Sbjct:   69 RKKRKEFEDGIRKNRMQLANWIKYGKWEESIGEIQRARSVFERALDVDHRSISIWLQYAEMEMR---CKQINHARNVFDRAITIMPRAMQFWLKYSYMEEVIENIPGARQIFERWIEWEPPE-QAWQTYINFELRYKEIDRARSVYQRFLHVHGINVQNWIKYAKFEERNGYIGNARAAYEKAMEYFGEEDINETVLVAFALFEERQKEHERARGIFKYGLDNLPSNRTE----EIFKHYTQHEKKFGERVGIEDVIISKRKTQYEKMVEENGYNYD---AWFDYLRLLENEETDREEVEDVYERAIANIPPHSEKRYWRRYIYLWINYALYEELVAKDFDR---ARQVYKACIDIIPHKTFTFAKVWIMFAHFEIRQLDLNAARKIMGVAIGKCP-KDKLFRAYIDLELQLREFDRCRKLYEKFLESSPESSQTWIKFAELETLLGDTDRSRAVFTIAVQQPALDMPEL--LWKAYIDFEIACEEHEKARDLY-ETLLQRTNHIKVWISMAEFEQTIGNFEGARKAFERA 581          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Fly
Match: CG6841 (gene:FBgn0036828 transcript:FBtr0346816)

HSP 1 Score: 981.474 bits (2536), Expect = 0.000e+0
Identity = 492/936 (52.56%), Postives = 654/936 (69.87%), Query Frame = 3
Query:   84 LITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQHKRARXXXXXXXXXX-----XXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLS--------TTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI 2852
            +  + +K FLG+PAP GYVAG+GRGATGFTTRSDIGPARD  DV D+RH      R+ +D E   D     SNYDEFSGY G++ SKDPY++DD EAD IY++IDK MD++RK YR+ R ++++E+YR++RPKIQQ F DLKR L +V+ +EW  IPEVGDSRNRKQRNPR + + P PDSLI++       + +DP            T G+ TP  ++D+++IG+AR  LM+ +LS+VSDSV GQTV+DPKGYLTDLQSM+P       G ++ DIKK+RLLLKS+ +TNP+    WI+  R EE   K+  A+ L+M+GCE   +SE++W+EA R+            AK+V ++A + +P SV +W+ AA+LE   K KR V+++AL  IP+SV+LWK  VELE+ P++A+ LL  AV+CC TSVELWLALA+L     AR VLN AR+ IP DRQIW TA KLEEA GN   +E++I R++  L  N VEINRD+W ++A EAEKSG     Q I++ V+ IGV+E+DRKQTW+ DAE C +    ECARA+Y+ A+     KK IW RAA FEK HGTRE+ E +L +AV HC   E+LWLM AKSKW AGDV +AR +LS AF ANPNSE+I LAAVKLESEN+E++RA RLL +AR +  T RV MKSARLEW L   D A  LL EA E FP +PKLWMM GQ+ EQ++    A ++Y  G  K P S+PLW L ANLEE+ G ++ AR+ LE+ + +N K+  LWL +IR+ELRA   E A+ +M+RALQ CP++G LWAE+I +  K  R  KS DAL KCEH  HVLLA +K+FW + + +  R+W  +T+K++   GDAW + YK E ++GTE+Q++EV+ RC+ AEP  GE WC +SK++ NW+ KT ++L  V  ++ +PI
Sbjct:    9 IANRNKKHFLGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAPPATKRKKKDEEEEEDEDLNDSNYDEFSGYSGSLFSKDPYDKDDEEADAIYDSIDKRMDEKRKEYRDRRLREDLERYRQERPKIQQQFSDLKRSLASVTSEEWSTIPEVGDSRNRKQRNPRAEKFTPLPDSLISRNLGGESSSTLDPSSGLASMVPGVATPGMLTPTGDLDLRKIGQARNTLMNVKLSQVSDSVTGQTVVDPKGYLTDLQSMIPTY-----GGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQMARNLIMRGCEMNIQSEDLWLEAARLQPP-------DTAKAVIAQAARHIPTSVRIWIKAADLESETKAKRRVFRKALEHIPNSVRLWKAAVELEN-PDDARILLSRAVECCNTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEANGNIHMVEKIIDRSLTSLTVNGVEINRDQWFQEAIEAEKSGAVNCCQSIVKAVIGIGVEEEDRKQTWIDDAEFCAKENAFECARAVYAHALQIFPSKKSIWLRAAYFEKNHGTRESLEALLQRAVAHCPKSEILWLMGAKSKWMAGDVPAARGILSLAFQANPNSEDIWLAAVKLESENSEYERARRLLAKARGSAPTPRVMMKSARLEWALEKFDEALRLLEEAVEVFPDFPKLWMMKGQIEEQQRRTDDAAATYTLGLKKCPTSIPLWILSANLEERKGVLTKARSILERGRLRNPKVAVLWLEAIRVELRAGLKEIASTMMARALQECPNAGELWAEAIFMETKPQRKTKSVDALKKCEHDPHVLLAVSKLFWSEHKFSKCRDWFNRTVKIDPDLGDAWAYFYKFELLHGTEAQQQEVLDRCISAEPTHGESWCRVSKNIQNWQFKTPEVLRAVVRELSIPI 931          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Fly
Match: CG6841 (gene:FBgn0036828 transcript:FBtr0075068)

HSP 1 Score: 981.474 bits (2536), Expect = 0.000e+0
Identity = 492/936 (52.56%), Postives = 654/936 (69.87%), Query Frame = 3
Query:   84 LITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQHKRARXXXXXXXXXX-----XXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLS--------TTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI 2852
            +  + +K FLG+PAP GYVAG+GRGATGFTTRSDIGPARD  DV D+RH      R+ +D E   D     SNYDEFSGY G++ SKDPY++DD EAD IY++IDK MD++RK YR+ R ++++E+YR++RPKIQQ F DLKR L +V+ +EW  IPEVGDSRNRKQRNPR + + P PDSLI++       + +DP            T G+ TP  ++D+++IG+AR  LM+ +LS+VSDSV GQTV+DPKGYLTDLQSM+P       G ++ DIKK+RLLLKS+ +TNP+    WI+  R EE   K+  A+ L+M+GCE   +SE++W+EA R+            AK+V ++A + +P SV +W+ AA+LE   K KR V+++AL  IP+SV+LWK  VELE+ P++A+ LL  AV+CC TSVELWLALA+L     AR VLN AR+ IP DRQIW TA KLEEA GN   +E++I R++  L  N VEINRD+W ++A EAEKSG     Q I++ V+ IGV+E+DRKQTW+ DAE C +    ECARA+Y+ A+     KK IW RAA FEK HGTRE+ E +L +AV HC   E+LWLM AKSKW AGDV +AR +LS AF ANPNSE+I LAAVKLESEN+E++RA RLL +AR +  T RV MKSARLEW L   D A  LL EA E FP +PKLWMM GQ+ EQ++    A ++Y  G  K P S+PLW L ANLEE+ G ++ AR+ LE+ + +N K+  LWL +IR+ELRA   E A+ +M+RALQ CP++G LWAE+I +  K  R  KS DAL KCEH  HVLLA +K+FW + + +  R+W  +T+K++   GDAW + YK E ++GTE+Q++EV+ RC+ AEP  GE WC +SK++ NW+ KT ++L  V  ++ +PI
Sbjct:    9 IANRNKKHFLGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAPPATKRKKKDEEEEEDEDLNDSNYDEFSGYSGSLFSKDPYDKDDEEADAIYDSIDKRMDEKRKEYRDRRLREDLERYRQERPKIQQQFSDLKRSLASVTSEEWSTIPEVGDSRNRKQRNPRAEKFTPLPDSLISRNLGGESSSTLDPSSGLASMVPGVATPGMLTPTGDLDLRKIGQARNTLMNVKLSQVSDSVTGQTVVDPKGYLTDLQSMIPTY-----GGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQMARNLIMRGCEMNIQSEDLWLEAARLQPP-------DTAKAVIAQAARHIPTSVRIWIKAADLESETKAKRRVFRKALEHIPNSVRLWKAAVELEN-PDDARILLSRAVECCNTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEANGNIHMVEKIIDRSLTSLTVNGVEINRDQWFQEAIEAEKSGAVNCCQSIVKAVIGIGVEEEDRKQTWIDDAEFCAKENAFECARAVYAHALQIFPSKKSIWLRAAYFEKNHGTRESLEALLQRAVAHCPKSEILWLMGAKSKWMAGDVPAARGILSLAFQANPNSEDIWLAAVKLESENSEYERARRLLAKARGSAPTPRVMMKSARLEWALEKFDEALRLLEEAVEVFPDFPKLWMMKGQIEEQQRRTDDAAATYTLGLKKCPTSIPLWILSANLEERKGVLTKARSILERGRLRNPKVAVLWLEAIRVELRAGLKEIASTMMARALQECPNAGELWAEAIFMETKPQRKTKSVDALKKCEHDPHVLLAVSKLFWSEHKFSKCRDWFNRTVKIDPDLGDAWAYFYKFELLHGTEAQQQEVLDRCISAEPTHGESWCRVSKNIQNWQFKTPEVLRAVVRELSIPI 931          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Fly
Match: crn (gene:FBgn0000377 transcript:FBtr0070418)

HSP 1 Score: 65.4698 bits (158), Expect = 1.887e-10
Identity = 115/561 (20.50%), Postives = 226/561 (40.29%), Query Frame = 3
Query:  816 DLQSMLPQMSMNPSG-SEVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPND---RQIWITACKLEEAEGNDEKIERLIQRAIEVL-KSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSL--SKKKGIWKRAAAF------------EKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDR--VWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLEL 2393
            DL+ + P      S  +E+AD + + R   +     N   VS WI   ++EE   +I  A+ +  +  +N   +  +W++   + MK       ++ A+++  +A+  +P     W     +EE L+     R V++R +   P+  + W+  V  E    + + A+++ E  V   P  V+ W+  A+          +R V   A +   +D    +++I   + EE +   ++   + + A++ L K    E+ +     + +  +++G  + + +++  Q    +  +  +    W       E  G  +  R  Y  AIS++  + +K  W+R                E    TR+ Y+  L        T   LWL+ A+ +    +++ AR  L  A    P  +++    + LE +  EF+R  R+L    +  G +    WMK A LE  LG+ D A  +                           F+LA+   +   L  PE   LW    + E  LG   +AR   E+   +   + ++W++  + E+
Sbjct:   36 DLEILPPPPKQKISDPAELADYQQRKRKTFEDNLRKNRMVVSHWIKYAQWEEQQQEIQRARSIWERALDNEHRNVTLWLKYAEMEMK----NKQVNHARNLWDRAVTIMPRVNQFWYKYTYMEEMLENVAGARQVFERWMEWQPEE-QAWQTYVNFELRYKEIDRAREIYERFVYVHP-DVKNWIKFARFEESHGFIHGSRRVFERAVEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKKYGDRAGIEDVIVSKRKYQYEQEVAANPTN-YDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYIYLWINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPR-DKLFRGYIDLEIQLREFERC-RMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAI---------------------------FELAV---QQPRLDMPEL--LWKAYIDFEVALGETELARQLYERLLERTQHV-KVWMSFAKFEM 554          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Zebrafish
Match: prpf6 (PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-2575])

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 496/948 (52.32%), Postives = 654/948 (68.99%), Query Frame = 3
Query:   75 IMNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL---------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN----------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            +M  + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH          Q K++++D+D +  + +  + F+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE+RE++EIEKYR +RPKIQQ F DLKR+L  V+ DEW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DP      GL TP                   +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G +++DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +  SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +K+G+ VT Q +I+ V+ IG++E+D K TW+ DA++C  HG LECARAIY+ A+     KK +W RAA FEK +GTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS RLEW LGN+++A  L  EA + +  +PKLWMM GQ+ EQ +    A  +Y  G  K P S+ LW L + LEEK+G ++ AR  LEKA+ KN + PELWL S+RLE RA     A  LM++ALQ CP+SG+LW+E++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W ++T+K+E   GDAWG  YK E  +GTE Q+ EV  RC  AEPR GE WC  SK + NW+    +IL LVA+KI
Sbjct:   37 LMGGLNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKSQDDDDEDLNDTNYDE-FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERRELREKEEIEKYRMERPKIQQQFSDLKRKLSEVTEDEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPLQGQFGGLNTPFPGGLNTPYPGGMTPDAGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTY-----GGDISDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALENVSKSVRLWKTAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARRVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDKAGSVVTCQSVIRAVIGIGIEEEDCKHTWMEDADSCVSHGALECARAIYAHALQVFPSKKSVWLRAAYFEKNNGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVRLEWVLGNIEAAHELCTEALKHYEDFPKLWMMRGQIEEQSESIDRAREAYNQGLKKCPHSMSLWLLLSRLEEKVGQLTRARAILEKARLKNPQSPELWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWGFFYKFELQHGTEEQQHEVKKRCENAEPRHGELWCAESKHILNWQKNIGEILVLVASKI 970          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Zebrafish
Match: prpf6 (PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-2575])

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 496/948 (52.32%), Postives = 654/948 (68.99%), Query Frame = 3
Query:   75 IMNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL---------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN----------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            +M  + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH          Q K++++D+D +  + +  + F+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE+RE++EIEKYR +RPKIQQ F DLKR+L  V+ DEW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DP      GL TP                   +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G +++DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +  SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +K+G+ VT Q +I+ V+ IG++E+D K TW+ DA++C  HG LECARAIY+ A+     KK +W RAA FEK +GTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS RLEW LGN+++A  L  EA + +  +PKLWMM GQ+ EQ +    A  +Y  G  K P S+ LW L + LEEK+G ++ AR  LEKA+ KN + PELWL S+RLE RA     A  LM++ALQ CP+SG+LW+E++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W ++T+K+E   GDAWG  YK E  +GTE Q+ EV  RC  AEPR GE WC  SK + NW+    +IL LVA+KI
Sbjct:    7 LMGGLNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKSQDDDDEDLNDTNYDE-FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERRELREKEEIEKYRMERPKIQQQFSDLKRKLSEVTEDEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPLQGQFGGLNTPFPGGLNTPYPGGMTPDAGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTY-----GGDISDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALENVSKSVRLWKTAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARRVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDKAGSVVTCQSVIRAVIGIGIEEEDCKHTWMEDADSCVSHGALECARAIYAHALQVFPSKKSVWLRAAYFEKNNGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVRLEWVLGNIEAAHELCTEALKHYEDFPKLWMMRGQIEEQSESIDRAREAYNQGLKKCPHSMSLWLLLSRLEEKVGQLTRARAILEKARLKNPQSPELWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWGFFYKFELQHGTEEQQHEVKKRCENAEPRHGELWCAESKHILNWQKNIGEILVLVASKI 940          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Zebrafish
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-040426-694])

HSP 1 Score: 80.1073 bits (196), Expect = 7.677e-15
Identity = 118/500 (23.60%), Postives = 190/500 (38.00%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQ 2444
            ++ K+ G  DNI + ++V           +S W+  A  EE+L+     R +Y+RAL     ++ LW    E+E        A+ + + A+   P   + W         L N    R V     +  P + Q W +    E      +K   + +  +      MV      WIK A   EK G     +K+ +R V    +EQ  +  ++A A   E+    E  R IY  A+  + K++   ++K    FEK  G R   E ++          EV         W    +      D ++ R V  RA A  P  +E       I L    A+  E E  + +R  ++ +              ++W+   + E    NL +A   L  A  K PK  KL+    ++  Q +EF      Y+     +PE+   W   A LE  LG    +R   E A  +  + +PE LW + I  E+     +    L  R LQ
Sbjct:   62 KLKKRKGFEDNIRKNRTV-----------ISNWIKYAQWEESLQEVQRSRSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNIAGCRQVFERWMEWEPEE-QAWHSYINFELRYKEVDKARSIYENFV------MVHPEVKNWIKYAHFEEKHGYVARGRKVFERAVEFFGEEQVSENLYVAFARFEEKQKEFERVRVIYKYALDRIPKQQAQELFKNYTVFEKRFGDRRGIEDVIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDADADTVREVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYKACLELIPHKKFTFAKIWLLYGQFEIRQKNLQNARRGLGTAIGKCPK-NKLFKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDTDRSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEYDNTRGLYKRLLQ 542          

HSP 2 Score: 57.3806 bits (137), Expect = 8.312e-8
Identity = 84/453 (18.54%), Postives = 186/453 (41.06%), Query Frame = 3
Query:  864 EVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTK---RVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPNDR---QIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLS--KKKGIWKR-------AAAFEK-----EHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRA-RMNVGTDRVWMKSARLEWCLGNLDSAETLL 2123
            E+ D K K R   +     N   +S WI   ++EE   ++  ++ +  +  +    +  +W++   + MK       ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + ++A+ + E  V   P  V+ W+  A            R V   A +    ++    +++   + EE +   E++  + + A++ + K    E+ ++  + +    ++ G  + + +++  Q    +  +  +    W       E     +  R +Y  AI+++   ++K  W+R        A +E+        TR+ Y+  L        T   +WL+  + +    ++++AR  L  A    P + ++    ++LE +  EFDR  +L ++    +      W+K A LE  LG+ D +  + 
Sbjct:   57 ELNDYKLKKRKGFEDNIRKNRTVISNWIKYAQWEESLQEVQRSRSIYERALDVDHRNITLWLKYAEMEMK----NRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNIAGCRQVFERWMEWEPEE-QAWHSYINFELRYKEVDKARSIYENFVMVHP-EVKNWIKYAHFEEKHGYVARGRKVFERAVEFFGEEQVSENLYVAFARFEEKQKEFERVRVIYKYALDRIPKQQAQELFKNYTVFEKRFGDRRGIEDVIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDADADTVREVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYKACLELIPHKKFTFAKIWLLYGQFEIRQKNLQNARRGLGTAIGKCPKN-KLFKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDTDRSRAIF 501          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Zebrafish
Match: pdcd11 (programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE-030131-4076])

HSP 1 Score: 51.6026 bits (122), Expect = 6.680e-6
Identity = 40/162 (24.69%), Postives = 79/162 (48.77%), Query Frame = 3
Query: 1707 RAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMA---AKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDR---VWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMML 2174
            RA+ +I+     +K  IW      E  +GT ++ +K+  +A+++C+ + V   +A   AKS+ +  + ES    + + F  +   + + L+         + D AN LLQRA  ++ +     +  + ARLE+  GN + A+++  +    +PK   LW + 
Sbjct: 1589 RALKTISFREEQEKLNIWVAMLNLENMYGTPDSLQKVFERAIQYCEPLLVYQQLADIYAKSE-KIKEAESLYKSMVKRFRQD---KAVYLSYGTFLLRQRQSDAANALLQRALQSLSSKEHVDLIARFARLEFQFGNSEKAKSMFDKVLTTYPKRTDLWSVF 1746          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Xenopus
Match: cpz (carboxypeptidase Z [Source:Xenbase;Acc:XB-GENE-994183])

HSP 1 Score: 921.383 bits (2380), Expect = 0.000e+0
Identity = 488/925 (52.76%), Postives = 643/925 (69.51%), Query Frame = 3
Query:  159 ATGFTTRSDIGPARDDTDVPDERHL---------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEF-SDNQMNVIDPRLSTTTGLQTPM---------------------DNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            ATGFTTRSDIGPARD  D  D+RH          Q K+ + D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK   + +  + +DPR +   GL TP                       ++DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  L+ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPT+VELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +K+G+  T Q II+ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ ++     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+++A+ L  EA   +  +PKLWMM GQ+ EQ ++ + A  +Y  G  K   S PLW L + LEEK+G ++ AR  LEK++ KN K PELWL S+RLE RA     A  LM++ALQ CP+SG+LWAE++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EE+  RC  AEPR GE WC +SKD+ NW+ K  +IL LVAA+I
Sbjct:    2 ATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRHEKLTPVPDSFFAKHLQTGDSHSSVDPRQTQFGGLNTPFPGGLNTPYPGGMTPGLMTPGTGDLDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDLRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTNVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDKAGSVATCQAIIKDVIGIGIEEEDRKHTWMEDADSCVAHSALECARAIYAHSLQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAAQDLCEEALRHYEDFPKLWMMKGQIEEQGEQIEKARDAYNQGLKKCLHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKTPELWLESVRLEFRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWATFYKFELQHGTEEQQEEIRKRCENAEPRHGELWCAVSKDIKNWQQKIGEILVLVAAQI 913          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Xenopus
Match: serpinb1 (serpin family B member 1 [Source:Xenbase;Acc:XB-GENE-1217264])

HSP 1 Score: 65.4698 bits (158), Expect = 3.434e-10
Identity = 100/490 (20.41%), Postives = 206/490 (42.04%), Query Frame = 3
Query:  930 VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPNDR---QIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSL--SKKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRL----LQRARMNVGTDRVWMKSARLEWCLGNLDSAETLL-LEATEKFPKYPK-LWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLE 2288
            +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK    +  ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  V   P  V+ W+  A+          AR V   + +    D     ++++  K EE +   E++  + + A++ + K    E+ ++  I + +  ++ G  + +  ++  Q    +  +  +    W       E     +  R +Y  AI+++  +K+K  WKR        A +E+        TR+ Y+  L        T   +WLM ++ +    ++  AR  L  +   +P + ++    ++LE +  EFDR  +L    L+ A  N  T   W+K + LE  LG+ + A  +  L   +     P+ LW        +++EF+   + Y+   L+  + V +W   A  E
Sbjct:   80 ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----SRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGTRQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARSIYERFVIVHP-DVKNWIKYARFEEKHGYIAHARKVYERSVEFFGEDHMDENLYVSFAKFEEHQKEFERVRVIYKYALDRISKQQAQELFKNYTIFEKKYGDRRGIEDIIVNKRRFQYEEEVKANPHN-YDAWFDYLRLVESDADPDTVREVYERAIANVPPTKEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQACLELIPHKKFTFAKIWLMYSQFEVRQKNLPFARRALGTSIGKSPKN-KLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTT---WIKFSELETILGDAERARAIYELAIGQPRLDMPEVLWKSYIDFEIEQEEFEKTRTLYR-RLLQRTQHVKVWISFAQFE 557          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Xenopus
Match: serpinb1 (serpin family B member 1 [Source:Xenbase;Acc:XB-GENE-1217264])

HSP 1 Score: 63.929 bits (154), Expect = 1.031e-9
Identity = 98/490 (20.00%), Postives = 204/490 (41.63%), Query Frame = 3
Query:  930 VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPNDR---QIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSL--SKKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRL----LQRARMNVGTDRVWMKSARLEWCLGNLDSAETLL-LEATEKFPKYPK-LWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLE 2288
            +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK    +  ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  + C       W+  A+          AR V   + +    D     ++++  K EE +   E++  + + A++ + K    E+ ++  I + +  ++ G  + +  ++  Q    +  +  +    W       E     +  R +Y  AI+++  +K+K  WKR        A +E+        TR+ Y+  L        T   +WLM ++ +    ++  AR  L  +   +P + ++    ++LE +  EFDR  +L    L+ A  N  T   W+K + LE  LG+ + A  +  L   +     P+ LW        +++EF+   + Y+   L+  + V +W   A  E
Sbjct:   70 ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----SRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGTRQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARSIYERYILCN------WIKYARFEEKHGYIAHARKVYERSVEFFGEDHMDENLYVSFAKFEEHQKEFERVRVIYKYALDRISKQQAQELFKNYTIFEKKYGDRRGIEDIIVNKRRFQYEEEVKANPHN-YDAWFDYLRLVESDADPDTVREVYERAIANVPPTKEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQACLELIPHKKFTFAKIWLMYSQFEVRQKNLPFARRALGTSIGKSPKN-KLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTT---WIKFSELETILGDAERARAIYELAIGQPRLDMPEVLWKSYIDFEIEQEEFEKTRTLYR-RLLQRTQHVKVWISFAQFE 542          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Xenopus
Match: serpinb1 (serpin family B member 1 [Source:Xenbase;Acc:XB-GENE-1217264])

HSP 1 Score: 63.929 bits (154), Expect = 1.138e-9
Identity = 98/490 (20.00%), Postives = 204/490 (41.63%), Query Frame = 3
Query:  930 VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPNDR---QIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSL--SKKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRL----LQRARMNVGTDRVWMKSARLEWCLGNLDSAETLL-LEATEKFPKYPK-LWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLE 2288
            +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK    +  ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  + C       W+  A+          AR V   + +    D     ++++  K EE +   E++  + + A++ + K    E+ ++  I + +  ++ G  + +  ++  Q    +  +  +    W       E     +  R +Y  AI+++  +K+K  WKR        A +E+        TR+ Y+  L        T   +WLM ++ +    ++  AR  L  +   +P + ++    ++LE +  EFDR  +L    L+ A  N  T   W+K + LE  LG+ + A  +  L   +     P+ LW        +++EF+   + Y+   L+  + V +W   A  E
Sbjct:   69 ISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----SRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGTRQVFERWMEWQPEE-QAWHSYINFELRYKEVDRARSIYERYILCN------WIKYARFEEKHGYIAHARKVYERSVEFFGEDHMDENLYVSFAKFEEHQKEFERVRVIYKYALDRISKQQAQELFKNYTIFEKKYGDRRGIEDIIVNKRRFQYEEEVKANPHN-YDAWFDYLRLVESDADPDTVREVYERAIANVPPTKEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQACLELIPHKKFTFAKIWLMYSQFEVRQKNLPFARRALGTSIGKSPKN-KLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTT---WIKFSELETILGDAERARAIYELAIGQPRLDMPEVLWKSYIDFEIEQEEFEKTRTLYR-RLLQRTQHVKVWISFAQFE 541          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Xenopus
Match: ttc37 (tetratricopeptide repeat domain 37 [Source:NCBI gene;Acc:100158547])

HSP 1 Score: 53.9138 bits (128), Expect = 1.700e-6
Identity = 58/210 (27.62%), Postives = 90/210 (42.86%), Query Frame = 3
Query: 1893 GDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRA--RMNVGTDR-VWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMK-IP--------ELWLA----SIRLELRANNN-EFATNLMSRALQHCPDSGVLW 2471
            GD   AR    +AF  + +  E   AAV L  E  + D A  +L     R N G+ +  W++       +G    + + L  A    PK    W  LG+    +  +  AL S+   S  NP+S+      A++++ LG    A N  ++   K+   +P         L LA    S  L+L+A +  E A   ++RA+QH PD   LW
Sbjct:  388 GDKSRARGCYKKAFEIDGSDGEAGAAAVDLSMELGDMDVALAILTSVTERANAGSAKWAWLRRGLFYLRVGQHSKSVSDLHAALRADPKDSNCWECLGEAYLSRGGYTTALKSFMKASELNPDSIYSLYKIASIKQILGTYKEAINEYQQIIRKSGDYVPALKGLGECHLMLAKSAFSDFLDLKAVDAIEKALEFLARAIQHRPDLLCLW 597          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Mouse
Match: Prpf6 (pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:MGI:1922946])

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 501/950 (52.74%), Postives = 656/950 (69.05%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+ +A+ L  EA   +  +PKLWMM GQ+ EQ +  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC +SKD+ NW+ K  +IL LVAA+I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHYEDFPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAARI 937          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Mouse
Match: Prpf6 (pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:MGI:1922946])

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 501/950 (52.74%), Postives = 656/950 (69.05%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+ +A+ L  EA   +  +PKLWMM GQ+ EQ +  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC +SKD+ NW+ K  +IL LVAA+I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHYEDFPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAARI 937          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Mouse
Match: Crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:MGI Symbol;Acc:MGI:1914127])

HSP 1 Score: 66.2402 bits (160), Expect = 1.547e-10
Identity = 94/464 (20.26%), Postives = 193/464 (41.59%), Query Frame = 3
Query:  834 PQMSMNPSGSEVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPN---DRQIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLS--KKKGIWKR-------AAAFEKEHG-----TRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRV--WMKSARLEWCLGNLDSAETLL 2123
            PQ  +     E+ D K + R   +     N   +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK       ++ A+++  +AI  +P     W     +EE L      R V++R +   P+  + W   +  E    + E A+ + E  V   P +V+ W+  A+          AR V   A +   +   D  +++   K EE +   E++  + + A++ + K    E+ ++  I + +  ++ G  + + +++  Q    +  +  +    W       E     +  R +Y  AI+++   ++K  WKR        A +E+        TR+ Y+  L        T   +WL  A+ +    ++  AR  L  +    P + ++    ++LE +  EFDR  +L ++  +  G +    W+K A LE  LG+++ A  + 
Sbjct:   49 PQQKIT-DEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMK----NRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEE-QAWHSYINFELRYKEVERARTIYERFVLVHP-AVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDAEADTVREVYERAIANVPPIQEKRHWKRYIYLWVNYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWLYYAQFEIRQKNLPFARRALGTSIGKCPKN-KLFKGYIELELQLREFDRCRKLYEKF-LEFGPENCTSWIKFAELETILGDIERARAIY 502          

HSP 2 Score: 55.0694 bits (131), Expect = 3.979e-7
Identity = 86/376 (22.87%), Postives = 150/376 (39.89%), Query Frame = 3
Query:  939 WISIVRFEEHFSKIHEAKQLVMKGCENCP--ESEEMWMEAIRIMKQYG---GTDNI--SQAKSVASKAIKQVPNSVSLWVAAANLEET---LKTKRVVYKRALAEIPD---------SVKLW---KLIVELE-DDPEEAKQLLEGAVQCCP----TSVELWLALAKL----NNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISS--LSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAK---SKWEAGDVESARNVLSRAFAANPNSEE 1958
            +++  +FEE+  +    + +     +     E++E++       K++G   G ++I  S+ +    + +K  P++   W     L E+     T R VY+RA+A +P           + LW    L  ELE  DPE  +Q+ + +++  P    T  ++WL  A+      N   AR  L T+  K P ++                     L +  IE L+  + E +R                   +K+ ++ +  G +      +W+  AE     G +E ARAIY +AIS   L   + +WK    FE E    E    +  Q ++    V+V W+  A+   S  + G V   R +   A     N EE
Sbjct:  255 YVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEADTVREVYERAIANVPPIQEKRHWKRYIYLWVNYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWLYYAQFEIRQKNLPFARRALGTSIGKCPKNK---------------------LFKGYIE-LELQLREFDR------------------CRKLYEKFLEFGPENCT---SWIKFAELETILGDIERARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRQLLQRTQHVKV-WISFAQFELSSGKEGSVAKCRQIYEEANKTMRNCEE 586          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Mouse
Match: Pdcd11 (programmed cell death 11 [Source:MGI Symbol;Acc:MGI:1341788])

HSP 1 Score: 55.4546 bits (132), Expect = 4.112e-7
Identity = 66/254 (25.98%), Postives = 114/254 (44.88%), Query Frame = 3
Query: 1134 PNSVSLWV--AAANLEET-LKTKRVVYKRALAEIP-----DSVKLWKLIVELED---DPEEAKQLLEGAVQCC-PTSVELWLA--LAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAIS-SLSKK--KGIWKRAAAFEKEHGTRENYEKILSQAVEHCD 1844
            PNS  LW+   A +L+ T ++  R V +RAL  I      + + +W  ++ LE+     E   ++ E AVQ   P  V L LA    K     EA  + N   ++   ++ +WI                R++QRA+E L +     + D  +K A+   + G+   A+ I +  +S       R   W    +   +HG     R I+   I  SL+ K  K  +KR   +EK+HGT ++ + + ++A+E+ +
Sbjct: 1607 PNSSILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQESLTKVFERAVQYNEPLKVFLHLADIYTKSEKYKEAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQRALECLPAKE---HVDVIVKFAQLEFQLGDVERAKAIFENTLST---YPKRTDVWSVYIDMTIKHGSQTAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVE 1854          
BLAST of Pre mRNA processing factor 6 vs. UniProt/SwissProt
Match: sp|A1A5S1|PRP6_RAT (Pre-mRNA-processing factor 6 OS=Rattus norvegicus OX=10116 GN=Prpf6 PE=1 SV=1)

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 501/950 (52.74%), Postives = 656/950 (69.05%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+ +A+ L  EA   +  +PKLWMM GQ+ EQ +  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC +SKD+ NW+ K  +IL LVAA+I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYEDFPKLWMMKGQIEEQGELMERAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAARI 937          
BLAST of Pre mRNA processing factor 6 vs. UniProt/SwissProt
Match: sp|Q91YR7|PRP6_MOUSE (Pre-mRNA-processing factor 6 OS=Mus musculus OX=10090 GN=Prpf6 PE=1 SV=1)

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 501/950 (52.74%), Postives = 656/950 (69.05%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+ +A+ L  EA   +  +PKLWMM GQ+ EQ +  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC +SKD+ NW+ K  +IL LVAA+I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHYEDFPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAARI 937          
BLAST of Pre mRNA processing factor 6 vs. UniProt/SwissProt
Match: sp|O94906|PRP6_HUMAN (Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1)

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 502/950 (52.84%), Postives = 655/950 (68.95%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESEN+E++RA RLL +AR +  T RV+MKS +LEW   N+ +A+ L  EA   +  +PKLWMM GQ+ EQK+  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E+I +  +  R  KS DAL KCEH  HVLLA AK+FW Q +I  AR W  +T+K++   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC +SKD+ANW+ K  DIL LVA +I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRI 937          
BLAST of Pre mRNA processing factor 6 vs. UniProt/SwissProt
Match: sp|Q5RCC2|PRP6_PONAB (Pre-mRNA-processing factor 6 OS=Pongo abelii OX=9601 GN=PRPF6 PE=2 SV=1)

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 496/950 (52.21%), Postives = 651/950 (68.53%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL----------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH             K    D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P  V +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +++G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA F K HGTRE+ E +L +AV HC   EVLWLM AKSKW  GDV +AR++L+ AF ANPNSEEI LAAVKLESEN+E++RA RLL +AR +  T RV+MKS +LEW   N+ +A+ L  EA   +  +PKLWMM GQ+ EQK+  + A  +Y  G  K P S PLW L + LEEK+G ++  R  LEK++ KN K P LWL S+RLE RA     A  LM++ALQ CP+SG+LW+E+I +  +  R  KS DAL KCEH  HVLLA AK+FW Q +I  AR W  +T+K++   GDAW   YK E  +GTE ++EEV  RC  AEPR GE WC +S+D+ANW+ K  DIL LVA +I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQFVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFGKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLTGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRTRAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEERQEEVRKRCESAEPRHGELWCAVSEDIANWQKKIGDILRLVAGRI 937          
BLAST of Pre mRNA processing factor 6 vs. UniProt/SwissProt
Match: sp|Q2KJJ0|PRP6_BOVIN (Pre-mRNA-processing factor 6 OS=Bos taurus OX=9913 GN=PRPF6 PE=2 SV=1)

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 500/950 (52.63%), Postives = 655/950 (68.95%), Query Frame = 3
Query:   87 ITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL---------QHKRARXXXXXXXXXXXXXX-XFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPRLSTTTGLQTPMDN---------------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            + KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH          Q K+++  +D++   +     EF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  V+ +EW +IPEVGD+RN++QRNPR +   P PDS  AK     + +  +DPR +   GL TP                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +P+SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +K+G+  T Q +++ V+ IG++E+DRK TW+ DA++C  H  LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGNL +A+ L  EA + +  +PKLWMM GQ+ EQ++  + A  +Y  G  K P S PLW L + LEEK+G ++ AR  LEK++ KN K P LWL S+RLE RA     A+ LM++ALQ CP+SGVLW+E+I +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W  +T+K++   GDAW   YK E  +GTE QREEV  RC  AEPR GE WC  SKD+ANW+ K  +IL LVAA+I
Sbjct:    1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKSQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDKAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNLVAAQELCEEALKHYEDFPKLWMMKGQIEEQEELVEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIASTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQREEVRRRCENAEPRHGELWCATSKDIANWQRKIGEILVLVAARI 937          
BLAST of Pre mRNA processing factor 6 vs. TrEMBL
Match: A0A564YAN1 (PRP1_N domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4363 PE=4 SV=1)

HSP 1 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 525/948 (55.38%), Postives = 693/948 (73.10%), Query Frame = 3
Query:   78 MNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL-----QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-IDPR------LSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQV------------REQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLP 2849
            M +++KKR+EF+G+ AP GYVAG+GRGATGFTTRSDIGPAR+ TDV DERH+     + ++ +E+E  E+ N+SNYDEF+GYGG+ICSKDPYE+DD EAD IY++ID+ MD+RRK YRE RE  EIE+YRR+RPKIQQ F+DLKREL  VS  EW N+PEVGDSRN++QRNPRP+++ P PDS+IAK   D+QMN  +D        L+T  G QTP  +IDM++IG+ART LMD +L++VSDSV GQTV+DPKGYLTDLQSM+PQ +      ++ D+KK+RLLLKS+ +TNP    GWI+  R EE   K+  A+ L+M+GCE CP SE++W+EA R+         + QAKS+ ++AI  +P SV LWV AA+LE  +K KR V+K+AL  +P+SV+LWKL VELE++ E+A+ +L  AV+CCPTS ELWLAL++L    +AR VLN A + IP +RQIW  A +LEEA    E++ R+I   ++ LK+NMVEINRDEWIK+AEE EK+ + +TAQ II+ ++  G+DEQD+K TWLADAE C   G +ECARAIY++A++   KKK IW RAA FE+ HGTRE  E++L QAV HC   E+LWLM+AKSKW AGDV +AR+ L+ AF AN NSEEI LAAVKLESEN+E+ RA RLL++AR +  T RVWMKSARLEWCLG+L ++  +L E   K+P  PKL MM GQ+             E++   + A  ++K+G+   P++  LW L + LEE+ G ++ AR+ LEK ++KN K P LWL SIRLE+R N    A +L+S+ALQ CPDSG LWAE+I +  +  R MKS DAL KCEH   VLLA AK+FW +   + AR+W M+T+K+E   GDAW + YK E ++GTE Q++EV++RCV AEPR GE WC +SKDV NW+L+  D+LP+VA  +P+P
Sbjct:    1 MPVVSKKRREFIGLSAPLGYVAGVGRGATGFTTRSDIGPAREATDVSDERHMAPSKRKKEQEKEEEPEEDFNESNYDEFTGYGGSICSKDPYEKDDEEADEIYKSIDERMDERRKTYREKREAAEIERYRRERPKIQQQFIDLKRELAFVSESEWFNLPEVGDSRNKRQRNPRPEVFTPVPDSIIAKGLQDSQMNTKLDSAEQLLGGLTTPFGAQTPTGDIDMKKIGQARTSLMDIKLNQVSDSVTGQTVVDPKGYLTDLQSMIPQYA-----GDINDMKKARLLLKSVRETNPKHPPGWIASARLEEIAGKLQVARNLIMRGCEKCPNSEDVWLEAARLCP-------LDQAKSIVAQAITHLPQSVRLWVKAADLETEIKAKRTVFKKALENVPNSVRLWKLAVELEEE-EDARVMLALAVECCPTSAELWLALSRLETYEQARVVLNKAHEAIPTERQIWFAAARLEEANDQKERVARIIDAGVQSLKANMVEINRDEWIKEAEECEKAKSILTAQAIIKAIIGHGIDEQDKKHTWLADAETCASSGAIECARAIYAVALNQFPKKKSIWLRAAYFERNHGTRETLEELLDQAVIHCPHAEILWLMSAKSKWMAGDVPAARSTLAHAFEANSNSEEIWLAAVKLESENSEYARARRLLEKARASAPTARVWMKSARLEWCLGDLHTSSVMLEEGCLKYPNAPKLHMMRGQLAQVLAEKEKPESAEREALLEKAREAFKEGTRHVPQNTILWVLLSRLEEESGNMTKARSILEKGRSKNPKEPSLWLESIRLEIRVNLKPVADSLLSKALQQCPDSGCLWAEAILMAARPQRKMKSVDALKKCEHDPLVLLAVAKMFWAERLTSKARSWFMRTVKLESDLGDAWAYFYKFEMLHGTEDQQKEVLSRCVAAEPRHGEAWCRVSKDVVNWRLRAADLLPIVAESLPVP 935          
BLAST of Pre mRNA processing factor 6 vs. TrEMBL
Match: A0A0X3PI83 (PRP1_N domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR127644 PE=4 SV=1)

HSP 1 Score: 1036.94 bits (2680), Expect = 0.000e+0
Identity = 521/949 (54.90%), Postives = 690/949 (72.71%), Query Frame = 3
Query:   81 NLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQHKRARXXXXXXXXXX-----XXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-------IDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQK--------------QEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLP 2849
            +LI+KKR+EFLG+ AP GYVAG+GRGATGFTTRSDIGPAR+  DV DERH+   + ++++D +   +     SNYDEFSGYGG+ICSKDPYE+DD EAD IY +ID  MD+RR+ YRE R Q+EIE+YR++RPKIQQ F+DLKR+L +V+  EW N+PEVGD+RN+KQRNPR + + P PDS+IAK   D+Q+N        +   L+T  G QTP  +IDM++IG+ART LMD +L++VSDSV+GQTV+DPKGYLTDLQSM+PQ S      ++ DIKK+RLLLKS+ +TNP    GWI+  R EE   K+  A+ L+M+GCE CP SE++W+EA R+           QAKS+ ++AI+ +P SV +WV AA LE  +K KR VYK+AL  +P+SV+LWKL VELED+ E+A+ +L  AV+CCPTS ELWLALA+L     AR VLN A + IP DRQIW  A +LEEA  N   + ++I+  +  LK+NMVE+NRDEWIK+AEE EK+ + +TAQ II+ ++  G++EQD+K TWLADAE+C  +G +ECARAIY++A+++   KK IW RAA FE+ +G+RE  E++L QAV HC   E+LWLMAAKSKW AGDV +AR+ L+RAF ANPNSEEI LAAVKLESEN+E+ RA RLL +AR +  T RVWMKSARLEWCLG L  AE +L  A +++P+ PKLWMM GQ+ E +              +  + A ++Y++G+  NP+S PLWTL + LEE  G ++ +R+ LEK ++KN     LWL SIRLE+RAN    A +L+S+ALQ CP++G LWAE+I + P+  R MKS DAL KCEH   VLLA AK+FW +   + AR+W  +T+K+E   GDAW +LYK E  +GTE Q+++V+ RC+ AEPR GEYWC  SKDV NW+L+  ++LP+VA  +PLP
Sbjct:    4 SLISKKRREFLGLAAPLGYVAGIGRGATGFTTRSDIGPAREANDVSDERHMAPSKRKKEQDGQEEAEEDLNESNYDEFSGYGGSICSKDPYEKDDAEADEIYSSIDDRMDERRRTYRERRLQEEIEQYRKERPKIQQQFIDLKRDLASVTESEWLNLPEVGDARNKKQRNPRAERFTPVPDSIIAKNIQDSQINSKLDAVEQLHGGLTTPFGAQTPTGDIDMKKIGQARTSLMDIKLNQVSDSVSGQTVVDPKGYLTDLQSMIPQHS-----GDINDIKKARLLLKSVRETNPKHPPGWIASARLEEIAGKLQIARNLIMRGCEECPTSEDIWLEAARLSPP-------EQAKSIVAQAIRHLPQSVRIWVKAAELETEVKAKRTVYKKALEHVPNSVRLWKLAVELEDE-EDARVMLSLAVECCPTSSELWLALARLETYERARIVLNKAHENIPTDRQIWFAAARLEEAHQNPAMVSKIIELGVYALKANMVEVNRDEWIKEAEECEKAKSVLTAQAIIKAIIGHGIEEQDKKHTWLADAESCSNNGAVECARAIYAVALAAFPTKKSIWLRAAYFERNYGSRETLEELLEQAVMHCPQAEILWLMAAKSKWLAGDVPAARSTLARAFEANPNSEEIWLAAVKLESENSEYARARRLLAKARASAPTARVWMKSARLEWCLGELGEAEEMLRTACQRYPQAPKLWMMTGQLAEYRIAEADPSLPEEKRNELLETARNAYREGAKNNPQSTPLWTLLSRLEETSGNLTKSRSILEKGRSKNPTDAILWLESIRLEIRANLKPVAESLLSKALQQCPNAGCLWAEAIFMAPRPQRKMKSVDALKKCEHDPIVLLAVAKMFWAERLTSKARSWFTRTVKLESGLGDAWAYLYKFELSHGTEDQQQDVLKRCIAAEPRHGEYWCRTSKDVRNWRLRIGELLPIVADLVPLP 939          
BLAST of Pre mRNA processing factor 6 vs. TrEMBL
Match: A0A5K3EGJ4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 534/945 (56.51%), Postives = 695/945 (73.54%), Query Frame = 3
Query:   81 NLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL-----QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-------IDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQE---------FKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI 2852
            +LI+KKRKEFLG+ AP GYVAG+GRGATGFTTRSDIGPAR+ TDV DERH+     + ++ +E+E  E+LN+SNYDEF+GYGG+ICSKDPYE+DD EAD IY +ID+ MD+RRK YRE RE +EIE+YRR+RPKIQQ F+DLKREL  VS  EW ++PEVGDSRNR+QRNPR +++ P PDS+IAK   D+Q+N        +   L+T  G QTP  +IDM++IG+ART LMD +L++VSDSV+GQTV+DPKGYLTDLQSM+PQ +      ++ D+KK+RLLLKS+ +TNP    GWI+  R EE   K+  A+ L+M+GCE CP SE++W+EA R+           QAKSV ++AI  +P +V LWV AA+LE   K KR V+K+AL  +P+SV+LWKL VELED+ E+A+ +L  AV+CCPTS ELWLALA+L    +AR VLN A ++IP +RQIW  A +LEEA     ++ ++I   ++ LK+NMVEINR+EWIK+AEE EK+ + +TAQ II+ ++  G++EQD+K TWLADAE+C  +G +ECARAIY++A++   KKK IW RAA FE+ HGTRE  E++L QAV HC   E+LWLM+AKSKW AGDV +AR+ L+ AF ANPNSEEI LAAVKLESEN+E+ RA RLL +AR +  T RVWMKSARLEWCLG L +AE +L E   K+P+ PKL MM GQ+ E   E            A ++Y+ G+ + P S  LWTL + LEEK G ++ AR+ LEK ++KN K P LWL SIRLE+RAN    A +L+S+ALQ CPDSG LWAE+I +  +  R MKS DAL KCEH   VLLA +K+FW +  I+ AR+W  +T+K+E  FGDAW + YK E ++GTE Q+++V+ RCV AEPR GE WC ISKD  NW+L+T D+LPLVA  +PLP+
Sbjct:    4 SLISKKRKEFLGLSAPLGYVAGVGRGATGFTTRSDIGPAREATDVSDERHMAPSKRKKEQEKEEEAEEDLNESNYDEFTGYGGSICSKDPYEKDDEEADEIYASIDERMDERRKTYREKREAEEIERYRRERPKIQQQFIDLKRELATVSESEWLSLPEVGDSRNRRQRNPRAEVFTPVPDSIIAKGLQDSQINTQLDSAEQLFGGLTTPFGAQTPTGDIDMKKIGQARTSLMDIKLNQVSDSVSGQTVVDPKGYLTDLQSMIPQYA-----GDINDMKKARLLLKSVRETNPKHSPGWIASARLEEIAGKLQVARNLIMRGCEKCPTSEDVWLEAARLCPP-------DQAKSVVAQAITHLPQAVRLWVKAADLETEPKAKRTVFKKALENVPNSVRLWKLAVELEDE-EDARVMLSLAVECCPTSAELWLALARLETYEQARVVLNKAHEQIPTERQIWFAAARLEEANDQCARVGKIIDAGVQSLKANMVEINREEWIKEAEECEKAKSILTAQAIIKAIIGHGIEEQDKKHTWLADAESCAANGAIECARAIYAVALAQFPKKKSIWLRAAYFERNHGTRETLEELLEQAVMHCPHAEILWLMSAKSKWLAGDVPAARSTLANAFQANPNSEEIWLAAVKLESENSEYARARRLLAKARASAPTARVWMKSARLEWCLGELAAAEEMLCEGCTKYPQAPKLHMMKGQLAELMAENHPEERDKFIGDARNAYQAGTKQIPTSAVLWTLLSRLEEKTGNMTKARSILEKGRSKNPKEPNLWLESIRLEMRANLKPVADSLLSKALQECPDSGCLWAEAIFMATRPQRKMKSVDALKKCEHDPVVLLAVSKMFWAERLISKARSWFTRTVKLESDFGDAWAYFYKFELLHGTEDQQKDVLRRCVAAEPRHGEAWCRISKDFRNWRLRTVDLLPLVAESLPLPV 935          
BLAST of Pre mRNA processing factor 6 vs. TrEMBL
Match: A0A0R3UEG6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5396 PE=4 SV=2)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 533/945 (56.40%), Postives = 695/945 (73.54%), Query Frame = 3
Query:   81 NLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL-----QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-------IDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQE---------FKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI 2852
            +LI+KKRKEFLG+ AP GYVAG+GRGATGFTTRSDIGPAR+ TDV DERH+     + ++ +E+E  E+LN+SNYDEF+GYGG+ICSKDPYE+DD EAD IY +ID+ MD+RRK YRE RE +EIE+YRR+RPKIQQ F+DLKREL  VS  EW ++PEVGDSRNR+QRNPR +++ P PDS+IAK   D+Q+N        +   L+T  G QTP  +IDM++IG+ART LMD +L++VSDSV+GQTV+DPKGYLTDLQSM+PQ +      ++ D+KK+RLLLKS+ +TNP    GWI+  R EE   K+  A+ L+M+GCE CP SE++W+EA R+           QAKSV ++AI  +P +V LWV AA+LE   K KR V+K+AL  +P+SV+LWKL VELED+ E+A+ +L  AV+CCPTS ELWLALA+L    +AR VLN A ++IP +RQIW  A +LEEA     ++ ++I   ++ LK+NMVEINR+EWIK+AEE EK+ + +TAQ II+ ++  G++EQD+K TWLADAE+C  +G +ECARAIY++A++   KKK IW RAA FE+ HGTR+  E++L QAV HC   E+LWLM+AKSKW AGDV +AR+ L+ AF ANPNSEEI LAAVKLESEN+E+ RA RLL +AR +  T RVWMKSARLEWCLG L +AE +L E   K+P+ PKL MM GQ+ E   E            A ++Y+ G+ + P S  LWTL + LEEK G ++ AR+ LEK ++KN K P LWL SIRLE+RAN    A +L+S+ALQ CPDSG LWAE+I +  +  R MKS DAL KCEH   VLLA +K+FW +  I+ AR+W  +T+K+E  FGDAW + YK E ++GTE Q+++V+ RCV AEPR GE WC ISKD  NW+L+T D+LPLVA  +PLP+
Sbjct:    4 SLISKKRKEFLGLSAPLGYVAGVGRGATGFTTRSDIGPAREATDVSDERHMAPSKRKKEQEKEEEAEEDLNESNYDEFTGYGGSICSKDPYEKDDEEADEIYASIDERMDERRKTYREKREAEEIERYRRERPKIQQQFIDLKRELATVSESEWLSLPEVGDSRNRRQRNPRAEVFTPVPDSIIAKGLQDSQINTQLDSAEQLFGGLTTPFGAQTPTGDIDMKKIGQARTSLMDIKLNQVSDSVSGQTVVDPKGYLTDLQSMIPQYA-----GDINDMKKARLLLKSVRETNPKHSPGWIASARLEEIAGKLQVARNLIMRGCEKCPTSEDVWLEAARLCPP-------DQAKSVVAQAITHLPQAVRLWVKAADLETEPKAKRTVFKKALENVPNSVRLWKLAVELEDE-EDARVMLSLAVECCPTSAELWLALARLETYEQARVVLNKAHEQIPTERQIWFAAARLEEANDQCARVGKIIDAGVQSLKANMVEINREEWIKEAEECEKAKSILTAQAIIKAIIGHGIEEQDKKHTWLADAESCAANGAIECARAIYAVALAQFPKKKSIWLRAAYFERNHGTRQTLEELLEQAVMHCPHAEILWLMSAKSKWLAGDVPAARSTLANAFQANPNSEEIWLAAVKLESENSEYARARRLLAKARASAPTARVWMKSARLEWCLGELAAAEEMLCEGCTKYPQAPKLHMMKGQLAELMAENHPEERDKFIGDARNAYQAGTKQIPTSAVLWTLLSRLEEKTGNMTKARSILEKGRSKNPKEPNLWLESIRLEMRANLKPVADSLLSKALQECPDSGCLWAEAIFMATRPQRKMKSVDALKKCEHDPVVLLAVSKMFWAERLISKARSWFTRTVKLESDFGDAWAYFYKFELLHGTEDQQKDVLRRCVAAEPRHGEAWCRISKDFRNWRLRTVDLLPLVAESLPLPV 935          
BLAST of Pre mRNA processing factor 6 vs. TrEMBL
Match: A0A0L8GKA6 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22032179mg PE=4 SV=1)

HSP 1 Score: 1028.47 bits (2658), Expect = 0.000e+0
Identity = 512/943 (54.29%), Postives = 685/943 (72.64%), Query Frame = 3
Query:   72 AIMNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERH----LQHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNV-----------IDPRLS--TTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLP 2849
            A+ +L++KK+K F+G+PAP GYV G+GRGATGFTTRSDIGPARD  D+ D+RH     + K  ++D+D+E+LND+NYDEF+GYGG++CSKDPY++DD EAD IY+ IDK MD++RK  RE + + E+E+YR++RPKIQQ F DLKREL +VS+D+W N+PEVGD+RN++QRNPR D + P PDSL+A   S    N            +D   S   + G  TP  +IDM++IG+AR  LMD +L++VSDSV+GQTV+DPKGYLTDLQSMLP       G ++ D+KK+RLLLKS+ +TNP     WI+  R EE   K+  A+ L+MKGCE CP+SE++W+EA R+M          QAK+V ++A++Q+P SV L++ A++LE  LK K+ V+++AL +IP+SV+LWK  VELED  ++A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DRQIWITA KLEEA+GN+  +E+++ RA+  LK+NMVEINR++WIKDAE+ EK+ +  T Q I++ V+ + V+E+DRK TW+ DAE+C  H   ECARAIYS A++    KK IW RAA FEK HG+RE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLLQ+AR +  T RV MKS +LEWCLG +D+A+ LL EA + +P + KLWMM GQ+ EQ+    +A  +Y  G  K P ++PLW L + LEEK G +  AR+ LEKA+ KN   P+LWL +IR+E RA+    A  LM++A Q C  +G+LWAESI + P+  R   S DAL +CEH  HVLLA +K+FW + +I  AR W  +T+K++   GDAW + YK ESI+GTE Q+E+V  RC+ AEPR GE WC +SKD+ANW+LKT ++L L +A IP+P
Sbjct:    2 AVQSLVSKKKKSFIGLPAPLGYVPGLGRGATGFTTRSDIGPARDADDISDDRHAPPNKKKKDDKDDDDDEDLNDANYDEFAGYGGSLCSKDPYDKDDEEADAIYDAIDKRMDEKRKERREQKLRAELERYRQERPKIQQQFSDLKRELASVSYDDWMNLPEVGDARNKRQRNPRADKFTPLPDSLLADAASSTTSNTSVDAMQQQYAGLDTPFSDAMSPGFSTPSGDIDMKKIGQARNTLMDIKLTQVSDSVSGQTVVDPKGYLTDLQSMLPS-----HGGDINDVKKARLLLKSVRETNPKHPPAWIASARLEEVTGKVQAARNLIMKGCEECPKSEDVWLEAARLMPG-------DQAKAVVAQAVRQLPLSVRLFIKASDLETELKAKKRVFRKALEQIPNSVRLWKAAVELED-VDDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWITAAKLEEAQGNEHMVEKIVDRALHSLKANMVEINREQWIKDAEDCEKANSIHTCQAIVRAVIGVNVEEEDRKHTWMEDAESCALHNAYECARAIYSHALAVFPSKKSIWLRAAYFEKNHGSRESLEVLLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLQKARASAPTPRVMMKSVKLEWCLGEIDNAKLLLEEAVKHYPDFAKLWMMKGQIEEQRSNISIAREAYNQGLKKCPNAIPLWLLLSRLEEKAGQLIKARSILEKARLKNSHSPDLWLEAIRVENRASLKNIAQTLMAKAKQDCTSAGILWAESIFMEPRPQRKTNSVDALKRCEHDPHVLLAVSKLFWTERRITKAREWFNRTVKIDPDLGDAWAYFYKFESIHGTEDQKEDVKKRCINAEPRHGEQWCKVSKDIANWRLKTSEVLLLTSAAIPIP 931          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Cavefish
Match: prpf6 (pre-mRNA processing factor 6 [Source:NCBI gene;Acc:103027632])

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 507/942 (53.82%), Postives = 658/942 (69.85%), Query Frame = 3
Query:   93 KKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL--------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEF--SDNQMNVIDPRLSTTTGLQTPMDN----------------IDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH            +  +D+D+E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE+RE++EIEKYR +RPKIQQ F DLKR+L  VS +EW +IP+VGD+RN++QRNPR +   P PDS  AK     DN  +V DP L    GL TP                   +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G +++DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +  SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINR++WI+DAEE +K+G+  T Q +I+ V+ IG++E+D K TW+ DAE+C  HG LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+D+A+ L  EA   +  +PKLWMM GQ+ EQ +   LA  +Y  G  K P S+PLW L + LEE++G ++ AR  LEK++ KN + PELWL S+RLE RA     +  LM++ALQ CP+SGVLWAE++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  AR W ++T+K+E   GDAW   YK E  +GTE Q+EEV  RC  AEPR GE WC  SK + NW+ K  +IL LVAAK+
Sbjct:   44 KKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQDDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERRELREKEEIEKYRMERPKIQQQFSDLKRKLSEVSEEEWLSIPDVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGDNHTSV-DP-LQQFGGLNTPFPGGLNTPYPGGMTPGAGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPT-----HGGDISDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALENVSKSVRLWKTAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARRVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDKAGSVATCQAVIRAVIGIGIEEEDCKHTWMEDAESCVSHGALECARAIYAHALQVFPSKKSVWLRAAYFEKSHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAATARVFMKSIKLEWVLGNIDAAQELCTEALRLYENFPKLWMMKGQIEEQSENMDLAREAYNQGLKKCPHSMPLWLLLSRLEERVGQLTRARAILEKSRLKNPQAPELWLESVRLEYRAGLKNISNTLMAKALQECPNSGVLWAEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVKKRCENAEPRHGELWCAESKHILNWQKKIGEILVLVAAKL 970          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Cavefish
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:103034616])

HSP 1 Score: 84.7297 bits (208), Expect = 2.186e-16
Identity = 130/549 (23.68%), Postives = 212/549 (38.62%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLK---TKRVVYKRALAEIPDSVKLWKLIVELEDDPEE---AKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQHCPDSGVL--WAESINIVPKKNRMMKSRD-------ALLKCEHSEHVLL 2564
            ++ K+ G  D+I + ++V           +S W+  A  EE+LK     R +Y+RAL     +V LW    E+E    +   A+ + + A+   P   + W   +     L N    R V     +  P + Q W +    E      +K   + +R +      +V      WIK A   +K G    A+K+ +R V    +E   +  ++A A   E+    E  R IY  A+  + K++   ++K    FEK+ G R   E ++          EV         W    +      DV++ R V  RA A  P  +E       I L    A+  E E  + +R  ++ Q              ++W+   + E    NL +A   +  A  K PK  KL+    ++  Q +EF      Y+      PE+   W   A LE  LG    AR   E A  +  + +PE LW + I  E+     +    L  R LQ      V   +A+    V  ++R+ + R        +L  CE  E  L+
Sbjct:   62 KLRKRKGFEDHIRKNRTV-----------ISNWIKYAQWEESLKEIQRARSIYERALDVDHRNVTLWLKYAEMEMKSRQVNHARNIWDRAITILPRVNQFWYKYSYMEEMLGNVAGCRQVFERWMEWEPEE-QAWHSYINFELRYKEVDKARTIYERFV------IVHPEIKNWIKYARFEDKHGYIAHARKVFERAVEFFGEEHIDENLFVAFARFEEKQKEFERVRVIYKYALDKIPKQQAQELFKNYTVFEKKFGDRRGIEDVIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDADVDTVREVYERAIANMPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLELIPHKKFTFAKIWLLYGQFEIRQKNLQNARRGMGSAIGKCPK-NKLFKGYIELELQLREFDRCRKLYEKYLEFGPENCTTWIKFAELETILGDTERARAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEYDKTRELYKRLLQRTQHVKVWISYAQFELSVDSEDRLQRCRQVYEESNKSLRNCEEKEERLM 591          

HSP 2 Score: 64.6994 bits (156), Expect = 4.058e-10
Identity = 81/431 (18.79%), Postives = 186/431 (43.16%), Query Frame = 3
Query:  930 VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTK---RVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNNP----TEARAVLNTARQKIPN---DRQIWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLS--KKKGIWKR-------AAAFEK-----EHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDR--VWMKSARLEWCLGNLDSAETLL 2123
            +S WI   ++EE   +I  A+ +  +  +    +  +W++   + MK    +  ++ A+++  +AI  +P     W   + +EE L      R V++R +   P+  + W   +  E    + ++A+ + E  V   P  ++ W+  A+  +       AR V   A +       D  +++   + EE +   E++  + + A++ + K    E+ ++  + + +  ++ G  + + +++  Q    +  +  +    W       E    ++  R +Y  AI+++   ++K  W+R        A +E+        TR+ Y+  L        T   +WL+  + +    ++++AR  +  A    P + ++    ++LE +  EFDR  +L ++  +  G +    W+K A LE  LG+ + A  + 
Sbjct:   80 ISNWIKYAQWEESLKEIQRARSIYERALDVDHRNVTLWLKYAEMEMK----SRQVNHARNIWDRAITILPRVNQFWYKYSYMEEMLGNVAGCRQVFERWMEWEPEE-QAWHSYINFELRYKEVDKARTIYERFVIVHP-EIKNWIKYARFEDKHGYIAHARKVFERAVEFFGEEHIDENLFVAFARFEEKQKEFERVRVIYKYALDKIPKQQAQELFKNYTVFEKKFGDRRGIEDVIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDADVDTVREVYERAIANMPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLELIPHKKFTFAKIWLLYGQFEIRQKNLQNARRGMGSAIGKCPKN-KLFKGYIELELQLREFDRCRKLYEKY-LEFGPENCTTWIKFAELETILGDTERARAIF 501          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Cavefish
Match: pdcd11 (programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE-030131-4076])

HSP 1 Score: 53.9138 bits (128), Expect = 1.078e-6
Identity = 63/263 (23.95%), Postives = 111/263 (42.21%), Query Frame = 3
Query: 1089 ISQAKSVASKAIKQVP----NSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCC---PTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLE----CARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCD 1844
            I QA++VA +AIK +       +++WVA  NLE    T+                            E  +++ E AVQ C   P   +L    AK N   EA ++     ++   ++ +W +       +G  +    L+QRA++ L +  V    D   K A    + G+K   + ++ +V+S       R   W    +   +HG  +      R I+  A  S+ K K  +KR   +EK+HGT E+ + +  +A+E+ +
Sbjct: 1292 IEQARAVAERAIKTISFEEQEKLNVWVALLNLENMYGTE----------------------------ESLQKVFERAVQYCEPMPVYQQLADIYAKSNKMKEAESLYKNMVKRFKQEKAVWQSYGSFLLQQGQSDAANALLQRALQSLSNKDV----DLITKFARLEFQYGSKDRGKAMLDKVLS---SYPKRTDLWSVFIDLMVKHGSQKEVDLFDRVIHLSA--SVKKIKFFFKRYLDYEKQHGTPESIQAVKQKALEYVE 1517          

HSP 2 Score: 50.8322 bits (120), Expect = 7.369e-6
Identity = 47/177 (26.55%), Postives = 80/177 (45.20%), Query Frame = 3
Query: 1695 LECARAIYSIAISSLS----KKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLES-----------ENNEFDRANRLLQRARMNVGTDRVWM--KSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMML 2174
            +E ARA+   AI ++S    +K  +W      E  +GT E+ +K+  +AV++C+ + V   +A        D+ +  N +  A +   N    M+   K E            +  + D AN LLQRA  ++    V +  K ARLE+  G+ D  + +L +    +PK   LW + 
Sbjct: 1292 IEQARAVAERAIKTISFEEQEKLNVWVALLNLENMYGTEESLQKVFERAVQYCEPMPVYQQLA--------DIYAKSNKMKEAESLYKN----MVKRFKQEKAVWQSYGSFLLQQGQSDAANALLQRALQSLSNKDVDLITKFARLEFQYGSKDRGKAMLDKVLSSYPKRTDLWSVF 1456          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Sea Lamprey
Match: prpf6 (PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-2575])

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 496/948 (52.32%), Postives = 650/948 (68.57%), Query Frame = 3
Query:   93 KKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL---------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEF--SDNQMNVIDPRLSTTTGLQTP---------------------MDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            +K+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH          Q K+++EDE+ +  + +  + F+GY G++ S  PYE+DD EAD IY  +DK +D+RRK  RE RE++EIEKYR +RPKIQQ F DLKR+L  VS DEW +IPEVGD+RN++QRNPR D   P PDS ++K    + +Q N +DPR  T TGL  P                        +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G ++ DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ ++MK  E CP+SE++W+EA R+  Q G +     AK+V + A++ +P SV  W+ AA+LE  LK K+ V ++AL ++P+SV+LWK  VELE+ P++A+ LL  AV+CCPTSVELWLALA+L +   AR VLN AR+ IP DR IWITA KLEEA GN   +E+++ RAI  L++N VEINR+ WI+DAEE +K+G+  T Q +I+ V+ IGV+E+DRK TW+ DA++C  HG  ECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE +RA RLL +AR +  T RV+MKS +LEW LG +  A+ L  EA   +  +PKLWMM GQ+ EQ Q    A  +Y  G  K P SV LW L + LEE +G ++ AR  LEKA+ KN + PELWL S+RLE RA     A+ LM++A+Q CP SG+LWAE+I +  +  R  KS DAL KCEH  HVLLA AK+FW + +I+ AR W  +T+K++   GDAW   YK E  +G++ Q+E+V  RC  AEPR GE WC +SKD+ +W+ KT +IL  VA+ I
Sbjct:   12 RKKKHFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKSQEDEEEDLNDSNYDE-FNGYAGSLFSSGPYEKDDEEADAIYCMVDKRLDERRKDRREQREREEIEKYRMERPKIQQQFSDLKRKLAEVSEDEWLSIPEVGDARNKRQRNPRHDKLTPVPDSFLSKHMQNASDQHNSVDPRQLTLTGLFLPHMEGLHPYPGSMTPSGLMTPGAGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTY-----GGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKVQVARNIIMKATEMCPKSEDVWLEAARL--QPGDS-----AKAVVANAVRHLPQSVRTWIRAADLETDLKAKKRVLRKALEQVPNSVRLWKAAVELEE-PDDARILLSRAVECCPTSVELWLALARLESYENARKVLNKARENIPTDRHIWITAAKLEEANGNTAMVEKIVDRAITSLRANGVEINREHWIQDAEECDKAGSVTTCQAVIRAVIGIGVEEEDRKHTWMEDADSCVSHGACECARAIYAFALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWMAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEDERARRLLAKARSSAPTARVFMKSVKLEWVLGEIPRAKELSEEALRHYEDFPKLWMMKGQIEEQLQLNDKARDAYSQGLKKCPHSVALWLLLSRLEEHVGQLTRARAILEKARLKNPQNPELWLESVRLEYRAGLKNIASTLMAKAMQECPSSGILWAEAIFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKISKAREWFHRTVKIDPDLGDAWAVFYKFELQHGSKEQQEDVRKRCENAEPRHGELWCAVSKDILHWRKKTGEILAQVASSI 945          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Sea Lamprey
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-040426-694])

HSP 1 Score: 75.0998 bits (183), Expect = 4.118e-14
Identity = 125/513 (24.37%), Postives = 197/513 (38.40%), Query Frame = 3
Query: 1029 SEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLK---TKRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLE----EAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQ 2444
            S+E  +   ++ K+    DNI + ++V           V+ W+  A  EE+LK     R +Y+RAL     +V LW    E+E        A+ + + AV   P     W         L+N    R V     +  P + Q W +    E    E +      E+ I      +K+         WIK A   ++ G    A+++ +R V    +E  ++  ++A A   E     +  R IY  A+  + K+    ++K    FEK++G R   E ++          EV         W    +      +VES R V  RA A  P   E       I L    A+  E E  + DR  ++ Q              ++W+  A+ E    NL +A  +L  +  K PK  KL+    ++  Q +EF      Y+      PE+   W   A LE  LG V  +R   E A  +  + +PE LW + I  E+         NL  R LQ
Sbjct:   54 SDEEELADYKLRKRKTFEDNIRKNRTV-----------VTNWIKYAQWEESLKEIQRARSLYERALDVDHRNVTLWLKYAEMEMKNRQVNHARNIWDRAVTILPRINAFWYKYTYMEEMLSNVAGCRQVFERWMEWEPEE-QAWHSYINFELRYKEVDAARAVYEKYILGVHPEIKN---------WIKYARFEDRHGYTAHARRVYERAVEFYGEEHMKEPLFVAFARFEEAQKEFDRVRVIYKYALDRIPKQSSQELFKNYTMFEKKYGDRRGIEDVIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDCEVESVREVYERAIANVPLLPEKRHWRRYIYLWINFALFEELEMKDPDRTRQVYQGCLELIPHKKFTFSKIWLLFAQFEIRQKNLTAARKILGMSIGKCPK-NKLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTTWMKFAELETILGDVERSRAIYELAVGQPRLDMPEVLWKSYIDFEIEQEECSRTRNLYRRLLQ 544          

HSP 2 Score: 66.6254 bits (161), Expect = 1.975e-11
Identity = 91/455 (20.00%), Postives = 195/455 (42.86%), Query Frame = 3
Query:  864 EVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRI-MKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTK---RVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKLNN----PTEARAVLNTARQKIPNDRQ---IWITACKLEEAEGNDEKIERLIQRAIE-VLKSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISS--LSKKKGIWKRA-------AAFEK-----EHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRL----LQRARMNVGTDRVWMKSARLEWCLGNLDSAETL 2120
            E+AD K + R   +     N   V+ WI   ++EE   +I  A+ L  +  +    +  +W++   + MK       ++ A+++  +A+  +P   + W     +EE L      R V++R +   P+  + W   +  E    + + A+ + E  +      ++ W+  A+  +       AR V   A +    +     +++   + EEA+   +++  + + A++ + K +  E+ ++  + + +  ++ G  + + +++  Q    +  +  +    W       E    +E  R +Y  AI++  L  +K  W+R        A FE+        TR+ Y+  L        T   +WL+ A+ +    ++ +AR +L  +    P + ++    ++LE +  EFDR  +L    L+ A  N  T   WMK A LE  LG+++ +  +
Sbjct:   58 ELADYKLRKRKTFEDNIRKNRTVVTNWIKYAQWEESLKEIQRARSLYERALDVDHRNVTLWLKYAEMEMK----NRQVNHARNIWDRAVTILPRINAFWYKYTYMEEMLSNVAGCRQVFERWMEWEPEE-QAWHSYINFELRYKEVDAARAVYEKYILGVHPEIKNWIKYARFEDRHGYTAHARRVYERAVEFYGEEHMKEPLFVAFARFEEAQKEFDRVRVIYKYALDRIPKQSSQELFKNYTMFEKKYGDRRGIEDVIVSKRRFQYEEEVKANPHN-YDAWFDYLRLVESDCEVESVREVYERAIANVPLLPEKRHWRRYIYLWINFALFEELEMKDPDRTRQVYQGCLELIPHKKFTFSKIWLLFAQFEIRQKNLTAARKILGMSIGKCPKN-KLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTT---WMKFAELETILGDVERSRAI 502          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Sea Lamprey
Match: prpf39 (PRP39 pre-mRNA processing factor 39 homolog (yeast) [Source:NCBI gene;Acc:368864])

HSP 1 Score: 59.3066 bits (142), Expect = 3.593e-9
Identity = 97/407 (23.83%), Postives = 158/407 (38.82%), Query Frame = 3
Query: 1005 KGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEE---TLKTKRVVYKRALAEIPDSVKLWKLIVELE------DDPEEA---KQLLEGAVQCCPTSV------ELWLALAKLN-NPTEARAVLNTARQKIPNDRQIWITAC-KLEEAEGNDEKIERLIQRAIEVLKSNMVE--INRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVD-----EQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAAN-PNSEEIMLAAVKLESENNEFDRANRLLQRARMNV-GTDRVWMKSARLEWCLGNLDSAETLLLEATE 2138
            K  E  P+    W   ++ ++Q    +++  A+    +   + P     W   A+LE+    +K    V++R L  IP SV LW   +  E      D PE     + L E AV    T        E++++  + N    E  AV +     IP   Q++     K +E   N +  + L       L++ +V   +   E      E +        +K+ +R++    D     EQ+  + W        E G     R  + +     ++ K  WK    FE ++GT E    +  + V  C   E  W+  AK   E   +E  +NV  RA   + P    I L     E +    D A R+L+    ++ G   V ++   LE   GN  +AETLL EA E
Sbjct:   45 KAVEENPQDFTGWTYLLQYIEQ---ENHVWAARKAFDEFFMRYPYCYGYWKKYADLEKRFGNVKQAEEVFRRGLQAIPLSVDLWIHYINFEIELLDPDCPETVSKIRSLFELAVAAAGTDFRSDKLWEMFISWERENIRLREVTAVYDMVL-NIPT--QLYSHHFDKFKEHVNNHQPKDILSTDEFLKLRAQLVSSRLEAGEQGVGGVEEDDEDVDAETEKLRERIIGTRQDIFFQNEQEVSKRWTF------EEGI---KRPYFHVKPLERAQLKN-WKEYLDFEIDNGTHERVVVLFERCVIACALYEEFWIKYAKYM-EEHSLEGVQNVFRRACMIHLPKKHNIHLLWAAFEEQQGNLDEARRVLRSLEESLPGLAMVRLRRVSLERRQGNFSAAETLLREAME 434          

HSP 2 Score: 48.521 bits (114), Expect = 7.519e-6
Identity = 88/448 (19.64%), Postives = 188/448 (41.96%), Query Frame = 3
Query:  909 TDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLE---------ETLKTKRVVYKRALAEIPD---SVKLWKLIVELEDDPEEAKQL--LEGAVQCCPTSV--ELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRA---IEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQR-VVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQA-VEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGT-DRVWMKSARLEWCLG----NLDSAETLLLEATEKFPKYPKLWMML 2174
             + NP   +GW  ++++ E  + +  A++   +     P     W +   + K++G   N+ QA+ V  + ++ +P SV LW+   N E         ET+   R +++ A+A       S KLW++ +  E +    +++  +   V   PT +    +    +  N  + + +L+T         +  + + +LE  E     +E   +      E L+  ++   +D + ++ +E  K   + T ++ I+R    +   E+ + + W    +   ++G  E    ++   + + +  +  W + A + +EH   E  + +  +A + H      + L+ A  + + G+++ AR VL     + P    + L  V LE     F  A  LL+ A     T +     + +L   L      ++ A  +LL+A EK     K+++ L
Sbjct:   47 VEENPQDFTGWTYLLQYIEQENHVWAARKAFDEFFMRYPYCYGYWKKYADLEKRFG---NVKQAEEVFRRGLQAIPLSVDLWIHYINFEIELLDPDCPETVSKIRSLFELAVAAAGTDFRSDKLWEMFISWERENIRLREVTAVYDMVLNIPTQLYSHHFDKFKEHVNNHQPKDILSTDEFL---KLRAQLVSSRLEAGEQGVGGVEEDDEDVDAETEKLRERIIGTRQDIFFQNEQEVSK---RWTFEEGIKRPYFHVKPLERAQLKNWKEYLDFEIDNGTHERVVVLFERCVIACALYEEFWIKYAKYMEEHSL-EGVQNVFRRACMIHLPKKHNIHLLWAAFEEQQGNLDEARRVLRSLEESLPGLAMVRLRRVSLERRQGNFSAAETLLREAMEGAKTPEMASFYAIKLTRMLAKVEKTVEKARKVLLDAIEKDSMNTKIYLNL 484          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Yeast
Match: PRP6 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000000259])

HSP 1 Score: 256.529 bits (654), Expect = 1.285e-72
Identity = 240/960 (25.00%), Postives = 426/960 (44.38%), Query Frame = 3
Query:   99 RKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTD--VPDERHLQHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGD-----SRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQ----LSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNP----SGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRD-------EWIKDAEEAEKSGN-KVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEE---HGCLECARAIYSIAISSLSKKKGIWKR-AAAFEKEHGTRE---NYEKILSQAVEHCDTVEV--------LWLMAAKSKWEA--GDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNV------GTDRVWMKSAR-LEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEE-KLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNR--MMKS--RDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTES-QREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDIL 2819
            R  FL    P+GYV G+GRGATGF+T+     + DD    +P       KR RE+                   N     P +++D EA  +++ ++  +  ++K     R  ++ +        +++ F DLK  L  V+  EW +IP+  D      RNR Q       Y   PDSLI                           N+D+ ++ + R  L+ SQ    L++++ + +    ++     TD  S L  +  +     S + + D++K R +LKS    +P    GWI+  R EE   K   AK+++  GC+ CP S ++W+E IR+ +      ++   K++ + AI   P S  LW  A +LE T   K  V ++AL EIP    LWKL V  E D  +  ++LE A Q  P S++L  A   L +   A+  LN+ R+ +P + +IWI +  LEE    D  +++L    + +LK  ++E++++        W+K AE    + N  +T Q I+  ++   + E    ++ L + +   E   H  ++   A+    I        +W R   A E  H   E    ++++L Q  ++ D +          L +M     W+A  GD      ++ +     P++ ++    +KL   + + D      Q+   ++      GT+R++ K    L +   N ++ + L     + FP   K ++ LGQ+       +++  +Y  G+   P    LW   + ++E  L     AR+ L++   KN      ++A I++E+R  N + A  L+++ALQ  P + +LW E I +    N+  + K+  +DAL + ++   VLL     F+ + Q   +  WL + +K    +GD W  L++  +  G ++     +  +C   EP +G  W   SK+V       ++IL
Sbjct:    3 RPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIP-------KRYRENL-----------------NNHLQSQPKDDEDDEAANVFKTLELKLAQKKKK----RANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWMDIPDATDFTRRNKRNRIQEQLNRKTYAA-PDSLIP-------------------------GNVDLNKLTEEREKLLQSQIDENLAQLTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTNPQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHES-----DVHYCKTLVATAINFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEKATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDKL----VSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILE-WLRESGEYESELNNVDQILEKMPHSKVQI--AVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELLFQ-TKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFKIKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERCLKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPVRARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKLFKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGDTWVWLFRTYARLGKDTVDLYNMFDQC---EPTYGPEWIAASKNVKMQYCTPREIL 892          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Nematostella
Match: EDO33185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX5])

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 491/941 (52.18%), Postives = 657/941 (69.82%), Query Frame = 3
Query:   78 MNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERH-----LQHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLI-AKEFSDNQMNVIDPRL-----------------STTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVA 2831
            M+L+ KKRK FLG+ AP GYV G+GRGATGFTTRSDIGPAR+ TD+ DERH     LQ K+   D+D+ +LN++NYDEFSGYGG++ S  PY++DD EAD+IYE+IDK MDDRRK  RE + ++E+E+YR++RPKIQQ F DLKR+L  VS D+W NIP+VGD R +KQRNPR + + P PDS+I +   +    N +  R                  + T G  TP  ++D+ +IG+AR  L+  +L + SDSV GQTV+DPKGYLTDLQS+ P      SG ++ DIKK+RLLLKS+  TNP    GWI+  R EE   ++  A+  +MKG E C ++E++W+EA+R+             K+V ++A++Q+P SV LW+ AA +E  +  K+ VY++AL  IP+SV++WK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA  N   +E++I+RA+  LKSN VEINRD+WIKDAEE EK+ +  T Q II+ V+ +GV+E+DRK TW+ DA++C  +   EC+RAIY+ A++    KK +W RAA FEK +GTRE+ E +L  AV+HC   EVLWLM AKSKW A D+ SAR++L+ AF ANPNSEEI LAAVKLESENNE  RA +LLQRARMN  T RV MKS +LEW LGN+  A  LL EA +K+P + KLWMM GQ++EQ++    A  +YK G  K P S+PLW L + LEEK G  + AR+ LE+ + +N K PELWL ++R+E R    +FA  LM++A+Q CP +GVLW+E+I + P+  R  +S DAL +CEH  HVLLA AK+FW + +++ AR+W  + +K++  FGDAW + Y+ E  +GTE+Q+E V  +CV  EP  GE WC +SK + NW+LKTKD+LPL A
Sbjct:    1 MSLLNKKRKPFLGVSAPLGYVPGLGRGATGFTTRSDIGPAREATDISDERHGKPAHLQQKQD--DDDDVDLNETNYDEFSGYGGSLFSSGPYDKDDEEADSIYESIDKRMDDRRKERREQKLKEEMERYRQERPKIQQQFSDLKRKLNEVSEDDWVNIPDVGDYRTKKQRNPRTEKFTPVPDSVINSALLAGGTENALSGRQQVRKGTVLGGFQTPFPGAMTPGYATPSADLDLIKIGEARKSLVGVKLDQASDSVTGQTVVDPKGYLTDLQSLTPA-----SGGDIGDIKKARLLLKSVITTNPQHAPGWIAAARLEEVTGRMQAARNTIMKGTEVCEKNEDIWLEAVRLQPP-------DAMKAVVAQAVRQLPQSVRLWIKAAAVETEIVAKKRVYRKALEHIPNSVRIWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRLIWITAAKLEEANNNMPMVEKIIERAVASLKSNGVEINRDQWIKDAEECEKAQSVETCQAIIRTVIGVGVEEEDRKHTWMDDADSCVANSAYECSRAIYAHALTVFPSKKSVWLRAAYFEKNYGTRESLESLLQSAVKHCPKAEVLWLMGAKSKWMANDIPSARSILALAFQANPNSEEIWLAAVKLESENNEDQRARKLLQRARMNACTARVMMKSIKLEWVLGNIPEANKLLDEAVQKYPDFAKLWMMKGQLQEQEKNLPEAREAYKTGVKKCPTSIPLWLLLSRLEEKTGQATKARSVLEQGRQRNPKSPELWLEAVRIETRGGRKDFARTLMAKAMQECPTAGVLWSEAIFMEPRPQRKTRSVDALKRCEHDAHVLLAVAKLFWSERKVSKARDWFNRAVKLDPDFGDAWAYFYRFELQHGTEAQQESVSHKCVQVEPHHGEVWCAVSKAIPNWRLKTKDVLPLAA 926          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Nematostella
Match: EDO28792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5H1])

HSP 1 Score: 152.91 bits (385), Expect = 3.072e-41
Identity = 88/256 (34.38%), Postives = 135/256 (52.73%), Query Frame = 3
Query:  738 LMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIE 1505
            L ++     SDSV GQTV+DPKGYLTDLQS+ P      SG ++ DIKK+RLLLKS+  TNP    GWI+  R EE   ++  A+  +MKG E C ++E++W+EA+R+             K+V ++A++Q+P SV LW+ AA +E  +  K+ VY++      DS   ++  V     P     +  GA +C                   +RA+   A    P+ + +W+ A   E+  G  E +E L+Q A++
Sbjct:   48 LNETNYDEASDSVTGQTVVDPKGYLTDLQSLTPA-----SGGDIGDIKKARLLLKSVITTNPQHAPGWIAAARLEEVTGRMQAARNTIMKGTEVCEKNEDIWLEAVRLQPP-------DAMKAVVAQAVRQLPQSVRLWIKAAAVETEIVAKKRVYRKGNQ---DSAVRYRSRVTY---PPLGSCVANGAYEC-------------------SRAIYAHALTVFPSKKSVWLRAAYFEKNYGTRESLESLLQSAVK 266          

HSP 2 Score: 102.064 bits (253), Expect = 7.835e-24
Identity = 75/273 (27.47%), Postives = 115/273 (42.12%), Query Frame = 3
Query: 1074 GGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEA 1892
            G   +I +A+ +    I   P     W+AAA LEE   T R+                          + A+  +    + C  + ++WL   +L  P   +AV+  A +++P   ++WI A  +E                 E++    V               + GN+ +A +   RV    +              +C  +G  EC+RAIY+ A++    KK +W RAA FEK +GTRE+ E +L  AV+HC   EVLWLM AKSKW A
Sbjct:   84 GDIGDIKKARLLLKSVITTNPQHAPGWIAAARLEEV--TGRM--------------------------QAARNTIMKGTEVCEKNEDIWLEAVRLQPPDAMKAVVAQAVRQLPQSVRLWIKAAAVE----------------TEIVAKKRVY--------------RKGNQDSAVRYRSRVTYPPLG-------------SCVANGAYECSRAIYAHALTVFPSKKSVWLRAAYFEKNYGTRESLESLLQSAVKHCPKAEVLWLMGAKSKWMA 285          

HSP 3 Score: 49.6766 bits (117), Expect = 2.375e-6
Identity = 44/198 (22.22%), Postives = 84/198 (42.42%), Query Frame = 3
Query: 1893 GDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRA-NRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVR-EQKQEFKLALSSYKDGSLKNPESV---PLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLW 2471
            GD++ AR +L      NP      +AA +LE        A N +++   +    + +W+++ RL+      D+ + ++ +A  + P+  +LW+    V  E   + ++     +D +++    V   PL +  AN     G    +R     A         +WL +   E      E   +L+  A++HCP + VLW
Sbjct:   87 GDIKKARLLLKSVITTNPQHAPGWIAAARLEEVTGRMQAARNTIMKGTEVCEKNEDIWLEAVRLQ----PPDAMKAVVAQAVRQLPQSVRLWIKAAAVETEIVAKKRVYRKGNQDSAVRYRSRVTYPPLGSCVAN-----GAYECSRAIYAHALTVFPSKKSVWLRAAYFEKNYGTRESLESLLQSAVKHCPKAEVLW 275          

HSP 4 Score: 48.9062 bits (115), Expect = 5.222e-6
Identity = 20/24 (83.33%), Postives = 22/24 (91.67%), Query Frame = 3
Query:  159 ATGFTTRSDIGPARDDTDVPDERH 230
            ATGFTTRSDIGPAR+ TD+ DERH
Sbjct:    7 ATGFTTRSDIGPAREATDISDERH 30          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Nematostella
Match: EDO45828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV5])

HSP 1 Score: 84.3445 bits (207), Expect = 9.410e-17
Identity = 123/504 (24.40%), Postives = 204/504 (40.48%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEET---LKTKRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADA---EACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEV--------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIML----------AAVKLESENNEFDRANRLLQRARMNV------GTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKN-MKIPE-LWLASIRLELRANNNEFATNLMSRALQ 2444
            ++ K+    DNI + +SV           V+ W+  A  EE+   ++  R VY+R+L     ++ +W    E+E        A+ + + AV   P   + W         L N   AR +     +  P + Q W +   +E      E    + +R +      +V  +   W+K A+  E+ GN V A+ + +R V    +E   ++ +LA     E C+EH   +  R IY  A+ +L K++   ++K     EK++G +   E ++    +     EV         W    +      DV + R +  R+ A  P + E  L           A+  E    + +R  RL+ RA ++V         ++W+  A+ E    NL  A   L  A  K PK  KL+     +  Q +EF      Y+     NP +   W   A LE  LG V  AR   E A A+  + +PE LW A I  E+     +   +L  R L+
Sbjct:   64 KLRKRKAFEDNIRKNRSV-----------VANWLKYAQWEESQQEIQRARSVYERSLDVDHRNITIWLKYAEMEMRHRQINHARNIWDRAVTILPRVNQFWYKYTYMEEMLGNIAGARQIFERWMEWEPEE-QAWHSYINMELRYKEVEHARTIYERFV------LVHPDVKNWVKFAKFEERQGNIVGARGVYERAVEFYGEEHMDEKLFLAFGKFEEGCKEH---DRVRTIYKYALDNLPKEQCQELYKSFTQHEKKYGDKGGIENVIVSKRKFQYEEEVKANPNNYDAWFDYLRLMEAEADVSTVRELYERSIANVPLAAEKTLWRRYIYLWINYALYEELMAKDIER-TRLVYRACLDVIPHGKFTFAKIWLLYAQFEIRQKNLADARKALGTAIGKCPK-DKLFREYIGLELQLREFDRCRKIYEKFLTFNPANCTTWVKYAELESVLGDVDRARALFELAVAQPLLDMPEVLWKAYIDFEINQEEFDHTRDLYERLLK 544          

HSP 2 Score: 72.0182 bits (175), Expect = 8.138e-13
Identity = 109/560 (19.46%), Postives = 226/560 (40.36%), Query Frame = 3
Query:  750 QLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVAD---IKKSRLLLKSMTDTNPHK----VSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKT---KRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAKL----NNPTEARAVLNTARQKIPN---DRQIWITACKLEEAEGNDEKIERLIQRAIEVL-KSNMVEINRDEWIKDAEEAEKSG--NKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIY--SIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCD---------------TVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRA-RMNVGTDRVWMKSARLEWCLGNLDSAETLL-LEATEKFPKYPK-LWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLG 2300
            ++++V +       I  +  L + +    ++S+ P   +++D   + + +L  +   + N  K    V+ W+   ++EE   +I  A+ +  +  +    +  +W++   +  ++     I+ A+++  +A+  +P     W     +EE L      R +++R +   P+  + W   + +E    + E A+ + E  V   P  V+ W+  AK      N   AR V   A +       D ++++   K EE     +++  + + A++ L K    E+ +     + +  +K G  N + +++  Q    +  +  +    W       E    +   R +Y  SIA   L+ +K +W+R       +     YE+++++ +E                  T   +WL+ A+ +    ++  AR  L  A    P  +++    + LE +  EFDR  ++ ++    N      W+K A LE  LG++D A  L  L   +     P+ LW         ++EF      Y +  LK    V +W   A  E   G
Sbjct:   15 KVAKVKNKAPAPVQITAEQLLREAKERQLELSLPPPKQKISDPDELAEYKLRKRKAFEDNIRKNRSVVANWLKYAQWEESQQEIQRARSVYERSLDVDHRNITIWLKYAEMEMRHR---QINHARNIWDRAVTILPRVNQFWYKYTYMEEMLGNIAGARQIFERWMEWEPEE-QAWHSYINMELRYKEVEHARTIYERFVLVHP-DVKNWVKFAKFEERQGNIVGARGVYERAVEFYGEEHMDEKLFLAFGKFEEGCKEHDRVRTIYKYALDNLPKEQCQELYKSFTQHEKKYGDKGGIENVIVSKRKFQYEEEVKANPNNY-DAWFDYLRLMEAEADVSTVRELYERSIANVPLAAEKTLWRRYIYLWINYAL---YEELMAKDIERTRLVYRACLDVIPHGKFTFAKIWLLYAQFEIRQKNLADARKALGTAIGKCP-KDKLFREYIGLELQLREFDRCRKIYEKFLTFNPANCTTWVKYAELESVLGDVDRARALFELAVAQPLLDMPEVLWKAYIDFEINQEEFDHTRDLY-ERLLKRTNHVKVWISYAQFELTTG 563          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Nematostella
Match: EDO29782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2N5])

HSP 1 Score: 51.6026 bits (122), Expect = 6.258e-7
Identity = 59/288 (20.49%), Postives = 118/288 (40.97%), Query Frame = 3
Query: 1017 NCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVP-----NSVSLWVAAANLEETLKTKRV---VYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAIS---SLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDT 1847
            + P +   W++    M  +  T  I +A++VA +A++ +        +++WVA  NLE    T+     V++RAL                     E K++    +     S +  LA            + +T  ++    + +WI   +     G  +   +L+QR    LKS     + +  ++ A    K+G+    Q +++ V+S   +   R   W    +   + G  +  R I+   I    S  K K ++K+   FE+EHG   + E + ++A+E+ ++
Sbjct:   19 SSPNNSVTWLQ---YMAFHLHTTEIDKARAVAERALRTISFREEREKLNIWVALMNLENLYGTQESLIKVFERALQH------------------NEPKKVFFHLITIYTQSEKTELA----------EKLFHTMTKRFSQSKTVWIEFGRFFMKTGKPDSARKLLQRG---LKSLPTRKHVETIVQFALMEFKNGDPQRGQTVLESVLS---NYPKRTDIWSVYIDMMSKQGHPDTVRQIFERVIHMNLSSRKMKFLFKKYLDFEREHGDEMSVEAVKTKAMEYVES 269          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Medaka
Match: prpf6 (pre-mRNA processing factor 6 [Source:NCBI gene;Acc:101162926])

HSP 1 Score: 945.266 bits (2442), Expect = 0.000e+0
Identity = 503/940 (53.51%), Postives = 658/940 (70.00%), Query Frame = 3
Query:   84 LITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHL--------QHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEF-SDNQMNVIDPRL-----------STTTGLQTP-MDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKI 2840
            L+ KK+K FLG+PAP GYV G+GRGATGFTTRSDIGPARD  D  D+RH            +  ++ED E+LND+NYDEF+GY G++ S  PYE+DD EAD IY  +DK MD+RRK  RE+RE++EIEKYR +RPKIQQ F DLKR+L  VS +EW +IPEVGD+RN++QRNPR +   P PDS  +K   S    + +DP             S T GL TP    +DM++IG+AR  LMD +LS+VSDSV+GQTV+DPKGYLTDL SM+P       G +++DIKK+RLLLKS+ +TNPH    WI+  R EE   K+  A+ L+MKG E CP+SE++W+EA R+  Q G T     AK+V ++A++ +P SV +++ AA LE  ++ K+ V ++AL  +  SV+LWK  VELE+ PE+A+ +L  AV+CCPTSVELWLALA+L     AR VLN AR+ IP DR IWITA KLEEA GN + +E++I RAI  L++N VEINRD+WI+DAEE +K+G+  T Q +I+ V+ IG++E+DRK TW+ DA++C  HG LECARAIY+ A+     KK +W RAA FEK HGTRE+ E +L +AV HC   EVLWLM AKSKW AGDV +AR++L+ AF ANPNSEEI LAAVKLESENNE++RA RLL +AR +  T RV+MKS +LEW LGN+++A+ L  EA + +  +PKLWMM GQ+ EQ +    A  +Y  G  K P SV LW L + LEE++G ++ AR  LEK++ KN +  +LWL S+RLE RA     A  LM++ALQ CP+SG+LWAE++ +  +  R  KS DAL KCEH  HVLLA AK+FW + +I  +R W ++T+K+E   GDAW   YK E  +GT+ Q+EEV  RC  AEPR GE WC  SK V NW+ KT +IL  VA+KI
Sbjct:   39 LMGKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQEEDEEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERRELREKEEIEKYRMERPKIQQQFSDLKRKLAEVSEEEWLSIPEVGDARNKRQRNPRHEKLTPVPDSFFSKHLQSGENHSSVDPLQGLGGLNTPYPGSMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTY-----GGDISDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARL--QPGDT-----AKAVVAQAVRHMPQSVRVYIRAAELETDIRAKKRVLRKALENVSKSVRLWKAAVELEE-PEDARIMLSRAVECCPTSVELWLALARLETYENARRVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINRDQWIQDAEECDKAGSVATCQAVIRAVIGIGIEEEDRKHTWMEDADSCVAHGALECARAIYAHALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAAQDLCTEALKHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVALWFLLSRLEERVGQLTRARAILEKSRLKNPQCADLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWALFYKFELQHGTQEQQEEVRKRCENAEPRHGELWCAESKHVLNWQKKTGEILEQVASKI 965          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Medaka
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:101164119])

HSP 1 Score: 80.4925 bits (197), Expect = 4.683e-15
Identity = 128/549 (23.32%), Postives = 213/549 (38.80%), Query Frame = 3
Query: 1056 RIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLK---TKRVVYKRALAEIPDSVKLWKLIVELE---DDPEEAKQLLEGAVQCCPTSVELWLALAK----LNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKIL--SQAVEHCDTVEV------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRA-----RMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQHCPDSGVL--WAESINIVPKKNRMMKSRD-------ALLKCEHSEHVLL 2564
            ++ K+    DNI + +++           +S W+  A  EE+ K     R +Y+RAL     ++ LW    E+E        A+ + + A+   P   + W         L N    R       +  P D Q W +    E      +K   + +R +      MV      WIK A   EK G    ++K+ +R      ++   +  ++A A+  E     E  R IY  A+  + K +   ++K    FEK+ G R   E ++   +  ++ + V+        W    +     GD ++ R+V  RA A  P  +E       I L    A+  E E  + +R  ++ Q              ++W+  A+ E    NL +A  ++  A  K PK  KL     ++  Q +EF      Y+     +PE+   W   A LE  LG V  +R   E A  +  + +PE LW + I  E+     E   NL  R LQ      V   +A+    V   +R+ K R        ++  CE  E  L+
Sbjct:   62 KLRKRKAFEDNIRKNRTI-----------ISNWIKYAQWEESQKEVQRARSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEEMLGNVAGCRQAFERWMEWEP-DEQAWHSYINFELRYKEVDKARTIYERFV------MVHPEVKNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDGDPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLDLMPHKKFTFAKIWLLFAQFEIRQKNLQAARKIMGTAIGKCPK-NKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDVERSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFELSVDGPDRLAKCRQIFEEANKSMRNCEEKEERLM 591          

HSP 2 Score: 56.225 bits (134), Expect = 1.370e-7
Identity = 93/426 (21.83%), Postives = 159/426 (37.32%), Query Frame = 3
Query:  936 GWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLK---TKRVVYKRALAEIP--DSVKLWKLIVELEDDPEEAKQL-----------LEGAVQCCPTSVELWLALAKL----NNPTEARAVLNTARQKIPNDRQ---------IWITACKLEEAEGND-EKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKK---GIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPN---SEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLD 2105
             W S + FE  + ++ +A+ +  +     PE +  W++  R  +++G   +  +    A++   +   + +L+VA A  EE  K     RV+YK AL +IP   + +L+K     E    + + +            E  V+  P + + W    +L     +P   R V   A   IP  ++         +WI     EE E  D E+  ++ Q  ++++                        K T  KI                 WL  A+       L+ AR I   AI    K K   G  +      +    R+ YEK L  + E+C T    W+  A+ +   GDVE +R +   A    P     E +  + +  E E  EF+    L +R        +VW+  A+ E  +   D
Sbjct:  183 AWHSYINFELRYKEVDKARTIYERFVMVHPEVKN-WIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDGDPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQACLDLM---------------------PHKKFTFAKI-----------------WLLFAQFEIRQKNLQAARKIMGTAIGKCPKNKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTT----WIKFAELETILGDVERSRAIFELAIG-QPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFELSVDGPD 564          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Medaka
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:101164119])

HSP 1 Score: 71.2478 bits (173), Expect = 3.486e-12
Identity = 116/561 (20.68%), Postives = 201/561 (35.83%), Query Frame = 3
Query:  855 SGSEVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLE---ETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLK-SNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKIL--SQAVEHCDTVEV------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQHCPDSGV 2465
            +  E+ D K + R   +     N   +S WI   ++EE                                         + +A+S+  +A+     +++LW+  A +E     +   R ++ RA+  +P   + W     +E+        + G V  C  + E W+                        D Q W +    E      +K   + +R I +    +  ++    WIK A   EK G    ++K+ +R      ++   +  ++A A+  E     E  R IY  A+  + K +   ++K    FEK+ G R   E ++   +  ++ + V+        W    +     GD ++ R+V  RA A  P  +E       I L       E  E    +             ++W+  A+ E    NL +A  ++  A  K PK  KL     ++  Q +EF      Y+     +PE+   W   A LE  LG V  +R   E A  +  + +PE LW + I  E+     E   NL  R LQ      V
Sbjct:   55 NAEELNDYKLRKRKAFEDNIRKNRTIISNWIKYAQWEE-------------------------------------SQKEVQRARSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEE--------MLGNVAGCRQAFERWMEWEP--------------------DEQAWHSYINFELRYKEVDKARTIYERYILLHHLFDHFDLTETNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDGDPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKVGSSFTSCLLSKFTFAKIWLLFAQFEIRQKNLQAARKIMGTAIGKCPK-NKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDVERSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKV 549          

HSP 2 Score: 50.447 bits (119), Expect = 9.641e-6
Identity = 91/418 (21.77%), Postives = 164/418 (39.23%), Query Frame = 3
Query:  936 GWISIVRFEEHFSKIHEAKQ------LVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTK---RVVYKRALAEIP--DSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDE--------WIKDA--EEAE-KSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKK---GIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPN---SEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLD 2105
             W S + FE  + ++ +A+       L+    ++   +E  W++  R  +++G   +  +    A++   +   + +L+VA A  EE  K     RV+YK AL +IP   + +L+K     E    + + + +  +              +     E +A         P +   W    +L E++G+ + +  + +RAI    +N+  I            WI  A  EE E K G+  T+  + +   +         + WL  A+       L+ AR I   AI    K K   G  +      +    R+ YEK L  + E+C T    W+  A+ +   GDVE +R +   A    P     E +  + +  E E  EF+    L +R        +VW+  A+ E  +   D
Sbjct:  184 AWHSYINFELRYKEVDKARTIYERYILLHHLFDHFDLTETNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINK-----------RRFQYEEEVKAN--------PLNYDAWFDYLRLVESDGDPDTVRDVYERAI----ANIPPIQEKRHWRRYIYLWINYALYEELEVKVGSSFTSCLLSKFTFA---------KIWLLFAQFEIRQKNLQAARKIMGTAIGKCPKNKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTT----WIKFAELETILGDVERSRAIFELAIG-QPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFELSVDGPD 564          
BLAST of Pre mRNA processing factor 6 vs. Ensembl Medaka
Match: crnkl1 (crooked neck pre-mRNA splicing factor 1 [Source:NCBI gene;Acc:101164119])

HSP 1 Score: 56.6102 bits (135), Expect = 1.117e-7
Identity = 125/605 (20.66%), Postives = 213/605 (35.21%), Query Frame = 3
Query:  855 SGSEVADIK-KSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLE---ETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKG--IWKRAAAFEKEHGTRENYEKIL--SQAVEHCDTVEV------LWLMAAKSKWEAGDVESARNVLSRAFAANPNSEE-------IML---AAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAK-NMKIPE-LWLASIRLELRANNNEFATNLMSRALQHCPDSGVL--WAESINIVPKKNRMMKSRD-------ALLKCEHSEHVLL 2564
            +  E+ D K + R   +     N   +S WI   ++EE                                         + +A+S+  +A+     +++LW+  A +E     +   R ++ RA+  +P   + W     +E+        + G V  C  + E W+                        D Q W +    E      +K   + +R +      MV      WIK A   EK G    ++K+ +R      ++   +  ++A A+  E     E  R IY  A+  + K +   ++K    FEK+ G R   E ++   +  ++ + V+        W    +     GD ++ R+V  RA A  P  +E       I L    A+  E E  + +R  ++ Q                    CL  +   +     A  K PK  KL     ++  Q +EF      Y+     +PE+   W   A LE  LG V  +R   E A  +  + +PE LW + I  E+     E   NL  R LQ      V   +A+    V   +R+ K R        ++  CE  E  L+
Sbjct:   54 NAEELNDYKLRKRKAFEDNIRKNRTIISNWIKYAQWEE-------------------------------------SQKEVQRARSIYERALDVDHRNITLWLKYAEMEMKNRQVNHARNIWDRAITILPRVNQFWYKYTYMEE--------MLGNVAGCRQAFERWMEWEP--------------------DEQAWHSYINFELRYKEVDKARTIYERFV------MVHPEVKNWIKYARFEEKHGYIAHSRKVYERAAEFYGEDHVNENLFVAFAKFEEMQKEFERVRVIYKYALDKIPKNQAQELFKNYTMFEKKFGDRRGIEDVIINKRRFQYEEEVKANPLNYDAWFDYLRLVESDGDPDTVRDVYERAIANIPPIQEKRHWRRYIYLWINYALYEELEVKDPERTRQVYQA-------------------CLDLMPHKKGT---AIGKCPK-NKLLKGYIELELQLREFDRCRKLYEKYLEFSPENCTTWIKFAELETILGDVERSRAIFELAIGQPRLDMPEVLWKSYIDFEIEQEEFENTRNLYKRLLQRTQHVKVWISYAKFELSVDGPDRLAKCRQIFEEANKSMRNCEEKEERLM 564          
BLAST of Pre mRNA processing factor 6 vs. Planmine SMEST
Match: SMESG000011657.1 (SMESG000011657.1)

HSP 1 Score: 1872.83 bits (4850), Expect = 0.000e+0
Identity = 924/925 (99.89%), Postives = 925/925 (100.00%), Query Frame = 3
Query:   78 MNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQHKRARXXXXXXXXXXXXXXXFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI 2852
            MNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQHKRAREDEDNENLNDSNYDEFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLAL+SYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI
Sbjct:    1 MNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDERHLQHKRAREDEDNENLNDSNYDEFSGYGGNICSKDPYEEDDIEADTIYENIDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEWKNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLSTTTGLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQSMLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLGQVREQKQEFKLALASYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTLEKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAESINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMKTIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPISKDVANWKLKTKDILPLVAAKIPLPI 925          
BLAST of Pre mRNA processing factor 6 vs. Planmine SMEST
Match: SMESG000006174.1 (SMESG000006174.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.780e-8
Identity = 97/458 (21.18%), Postives = 190/458 (41.48%), Query Frame = 3
Query:  846 MNPSGSEVA--DIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSKIHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIKQVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDPEEAKQLLEGAVQCCPTSVELWLALAKL---NNPTE-ARAVLNTARQKIPNDR---QIWITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKSGNKVTAQKII--------QRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIAISS--LSKKKGIWK-------RAAAFEK-EHGTRENYEKILSQAVEHCD----TVEVLWLMAAKSKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQRARMNVGT-DRVWMKSARLEWCLGNLDSAETLL 2123
            M  +  E++  +I ++R + +   + +  +VS W+     E    ++  A+ L  +     P + ++W + + + ++     NI  A+ +  + +   P   + W +  NLE           +   EI  +  ++K  V++  D +                   W+  AK    NN T  AR+VL TA     +D     I     K EE +   E+++ + + A++ L   + E   D +    E  +K G+K+T Q+ I        ++V+S    + D   +++   E  EE+  ++  R IY  AI++  L +KK  W+       R A FE+   G  +   ++ SQ + H      T   +W+  A+      D+ +AR  L  A        ++    +K+E++  EFDR   L  +  +   T ++ W++ A  E+ L   +    + 
Sbjct:   86 MKYASFEISQNEILRARNVFERAINIHYKEVSIWLKYAEMELQCKQVQHARNLYERALCILPRANQLWYKYVYMEEK---LKNIDSARKIFKRWMAWEPPEQA-WHSFINLE-----------KKYGEIEKAHAIYKKFVQVHPDEKN------------------WIKWAKFEESNNRTSVARSVLTTALIFYGSDNPPPHILKEFAKFEERQREHERVKEIYKYALDNLPKYLSE---DIYQAYCEYEKKFGDKMTIQETIVMKRQHHYEKVLSENTHDYDEWFSYIKMME--EENQNIDDIREIYERAIANKPLIEKKYYWRRYIYLWIRYAIFEELTCGNIDRAIEVYSQCLLHTPHKKFTFAKIWIYKAEIHIRQKDLATARKTLGNAI-GRCGKNKLYRYYIKMETDLLEFDRVRTLYNKFIVFYPTYEQAWIEFANFEYRLKQFERVRYIY 504          
The following BLAST results are available for this feature:
BLAST of Pre mRNA processing factor 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPF60.000e+052.84pre-mRNA processing factor 6 [Source:HGNC Symbol;A... [more]
CRNKL16.744e-1724.80crooked neck pre-mRNA splicing factor 1 [Source:HG... [more]
CRNKL17.245e-1724.65crooked neck pre-mRNA splicing factor 1 [Source:HG... [more]
CRNKL18.093e-1724.80crooked neck pre-mRNA splicing factor 1 [Source:HG... [more]
PDCD117.467e-726.77programmed cell death 11 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prp-60.000e+044.09Yeast PRP (Splicing factor) related [Source:UniPr... [more]
M03F8.36.135e-1219.77pep chromosome:WBcel235:V:5940024:5943362:1 gene:W... [more]
M03F8.34.122e-1119.77pep chromosome:WBcel235:V:5940024:5943362:1 gene:W... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG68410.000e+052.56gene:FBgn0036828 transcript:FBtr0346816[more]
CG68410.000e+052.56gene:FBgn0036828 transcript:FBtr0075068[more]
crn1.887e-1020.50gene:FBgn0000377 transcript:FBtr0070418[more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prpf60.000e+052.32PRP6 pre-mRNA processing factor 6 homolog (S. cere... [more]
prpf60.000e+052.32PRP6 pre-mRNA processing factor 6 homolog (S. cere... [more]
crnkl17.677e-1523.60crooked neck pre-mRNA splicing factor 1 [Source:ZF... [more]
pdcd116.680e-624.69programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpz0.000e+052.76carboxypeptidase Z [Source:Xenbase;Acc:XB-GENE-994... [more]
serpinb13.434e-1020.41serpin family B member 1 [Source:Xenbase;Acc:XB-GE... [more]
serpinb11.031e-920.00serpin family B member 1 [Source:Xenbase;Acc:XB-GE... [more]
serpinb11.138e-920.00serpin family B member 1 [Source:Xenbase;Acc:XB-GE... [more]
ttc371.700e-627.62tetratricopeptide repeat domain 37 [Source:NCBI ge... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Prpf60.000e+052.74pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:... [more]
Prpf60.000e+052.74pre-mRNA splicing factor 6 [Source:MGI Symbol;Acc:... [more]
Crnkl11.547e-1020.26crooked neck pre-mRNA splicing factor 1 [Source:MG... [more]
Pdcd114.112e-725.98programmed cell death 11 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1A5S1|PRP6_RAT0.000e+052.74Pre-mRNA-processing factor 6 OS=Rattus norvegicus ... [more]
sp|Q91YR7|PRP6_MOUSE0.000e+052.74Pre-mRNA-processing factor 6 OS=Mus musculus OX=10... [more]
sp|O94906|PRP6_HUMAN0.000e+052.84Pre-mRNA-processing factor 6 OS=Homo sapiens OX=96... [more]
sp|Q5RCC2|PRP6_PONAB0.000e+052.21Pre-mRNA-processing factor 6 OS=Pongo abelii OX=96... [more]
sp|Q2KJJ0|PRP6_BOVIN0.000e+052.63Pre-mRNA-processing factor 6 OS=Bos taurus OX=9913... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YAN10.000e+055.38PRP1_N domain-containing protein OS=Hymenolepis di... [more]
A0A0X3PI830.000e+054.90PRP1_N domain-containing protein OS=Schistocephalu... [more]
A0A5K3EGJ40.000e+056.51Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UEG60.000e+056.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0L8GKA60.000e+054.29Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prpf60.000e+053.82pre-mRNA processing factor 6 [Source:NCBI gene;Acc... [more]
crnkl12.186e-1623.68crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
pdcd111.078e-623.95programmed cell death 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prpf60.000e+052.32PRP6 pre-mRNA processing factor 6 homolog (S. cere... [more]
crnkl14.118e-1424.37crooked neck pre-mRNA splicing factor 1 [Source:ZF... [more]
prpf393.593e-923.83PRP39 pre-mRNA processing factor 39 homolog (yeast... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRP61.285e-7225.00Splicing factor; component of the U4/U6-U5 snRNP c... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO331850.000e+052.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287923.072e-4134.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458289.410e-1724.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297826.258e-720.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prpf60.000e+053.51pre-mRNA processing factor 6 [Source:NCBI gene;Acc... [more]
crnkl14.683e-1523.32crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
crnkl13.486e-1220.68crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
crnkl11.117e-720.66crooked neck pre-mRNA splicing factor 1 [Source:NC... [more]
back to top
BLAST of Pre mRNA processing factor 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000011657.10.000e+099.89SMESG000011657.1[more]
SMESG000006174.11.780e-821.18SMESG000006174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017260 ID=SMED30017260|Name=Pre mRNA processing factor 6|organism=Schmidtea mediterranea sexual|type=transcript|length=2895bp
ACATTTCTTAAATTTCTAATTATTTTCAGTGATTTAAAATTGAATAAAAG
TTAGTAACTTTAAGTTTTTGTGCTATAATGAATCTTATTACAAAAAAACG
CAAGGAATTTTTAGGTATTCCAGCTCCATCTGGCTATGTTGCTGGTATGG
GTAGAGGAGCAACTGGTTTTACTACTAGATCTGATATTGGCCCAGCAAGA
GATGATACTGATGTACCAGACGAAAGACATCTTCAGCATAAACGTGCAAG
AGAAGATGAAGATAATGAAAATCTGAATGACTCAAACTATGATGAATTTA
GTGGTTATGGTGGTAATATATGCTCTAAGGATCCTTATGAAGAAGACGAT
ATTGAAGCAGATACAATTTACGAAAATATAGATAAGCACATGGATGATAG
ACGGAAAGCATATCGAGAAATTCGAGAACAGAAAGAAATTGAAAAATATC
GTCGGAAACGTCCAAAAATTCAACAAAATTTCGTTGATTTAAAGCGAGAA
TTAAAAAATGTTTCATTTGATGAATGGAAAAATATTCCAGAAGTTGGAGA
TTCTCGTAATCGAAAACAACGTAATCCACGACCAGATTTGTATGTTCCAA
AGCCTGATAGTTTAATTGCTAAAGAGTTCAGTGATAATCAAATGAATGTC
ATAGATCCAAGACTGTCAACAACAACTGGATTACAAACTCCAATGGATAA
TATTGATATGCAACGTATTGGAAAAGCAAGAACATTATTAATGGACAGTC
AACTAAGCCGAGTATCTGATAGTGTTAACGGTCAAACCGTTATTGATCCA
AAAGGATATTTGACCGATTTACAATCAATGCTGCCTCAAATGAGTATGAA
TCCAAGTGGGAGTGAAGTAGCTGATATTAAAAAGAGTCGATTGTTGTTGA
AATCAATGACAGATACAAATCCCCACAAAGTCAGCGGTTGGATATCTATC
GTTAGATTTGAGGAACATTTCTCGAAAATCCATGAAGCGAAACAATTGGT
CATGAAGGGCTGTGAAAATTGCCCAGAAAGTGAAGAAATGTGGATGGAAG
CGATTCGTATAATGAAACAATACGGCGGAACTGACAACATATCTCAAGCG
AAAAGCGTTGCATCAAAAGCCATCAAACAAGTTCCTAATTCGGTTTCCCT
ATGGGTAGCGGCTGCAAATTTAGAGGAAACTCTAAAAACGAAACGAGTTG
TGTATAAGAGAGCACTAGCAGAGATTCCGGATTCGGTGAAACTGTGGAAA
TTGATCGTGGAACTCGAAGACGATCCGGAAGAAGCGAAACAATTACTGGA
AGGCGCCGTCCAATGTTGTCCAACAAGTGTCGAATTATGGCTTGCATTAG
CAAAACTCAACAACCCAACTGAAGCTCGAGCGGTTCTCAACACAGCACGA
CAAAAGATCCCTAACGATCGACAGATCTGGATTACAGCTTGTAAACTGGA
GGAAGCTGAAGGAAACGACGAGAAAATCGAGCGGCTTATCCAAAGGGCGA
TAGAAGTGCTGAAATCGAACATGGTAGAAATAAATCGGGACGAATGGATC
AAGGACGCCGAAGAAGCGGAAAAGTCCGGCAACAAAGTGACGGCGCAAAA
AATCATCCAGCGAGTCGTCAGCATTGGTGTCGATGAGCAAGATCGCAAGC
AGACTTGGCTTGCCGATGCAGAAGCTTGTGAAGAGCATGGATGCTTGGAG
TGCGCCCGGGCGATTTATTCAATCGCTATTTCGAGTCTATCGAAAAAGAA
AGGGATTTGGAAACGAGCTGCTGCATTCGAAAAAGAACACGGAACCCGGG
AGAACTATGAGAAAATCCTCAGTCAGGCCGTGGAACATTGCGATACCGTT
GAGGTGTTGTGGCTGATGGCGGCAAAATCGAAATGGGAAGCTGGAGATGT
CGAGAGTGCACGAAATGTTCTCAGTCGGGCATTCGCAGCCAATCCAAACT
CAGAAGAAATCATGTTAGCCGCAGTGAAATTGGAATCGGAAAACAACGAG
TTCGATCGGGCGAATCGACTGCTACAACGAGCAAGAATGAATGTCGGCAC
CGATCGGGTCTGGATGAAATCTGCTCGACTTGAATGGTGCTTAGGAAATT
TGGATTCAGCGGAAACTCTGCTGCTGGAAGCGACAGAGAAATTCCCAAAA
TACCCAAAGCTCTGGATGATGCTTGGTCAGGTTCGGGAACAAAAGCAGGA
ATTCAAACTCGCATTGTCATCGTACAAAGACGGCTCGTTGAAGAATCCGG
AGTCGGTGCCGCTTTGGACGCTGCAGGCGAATCTCGAAGAGAAATTGGGG
TTCGTTTCGATGGCGAGAAATACACTGGAAAAAGCAAAGGCGAAAAATAT
GAAAATCCCTGAACTGTGGCTGGCATCGATCCGGTTGGAGTTGCGGGCAA
ATAACAATGAATTCGCGACGAATTTGATGTCTAGAGCGCTGCAACATTGC
CCGGATTCAGGAGTTTTGTGGGCTGAAAGCATCAATATTGTGCCGAAAAA
GAACCGTATGATGAAGTCGCGGGATGCTCTGTTGAAATGCGAGCACAGTG
AACATGTTCTGCTTGCTGCTGCGAAGGTGTTTTGGGAACAAGGGCAAATT
GCTAATGCCAGGAATTGGTTGATGAAAACTATCAAGGTCGAGAAACTGTT
CGGTGATGCCTGGGGACATCTGTATAAGCTGGAGAGTATTTATGGAACAG
AAAGCCAAAGGGAAGAAGTGATGACTCGATGCGTGATGGCTGAACCAAGA
TTCGGTGAATATTGGTGTCCGATTAGCAAGGATGTTGCAAATTGGAAATT
GAAAACCAAGGATATATTACCCCTAGTAGCAGCCAAGATACCATTACCGA
TTTGACTTTGCTGTTGATATAATAAACTGTTTGTTTCGAAAAAAA
back to top

protein sequence of SMED30017260-orf-1

>SMED30017260-orf-1 ID=SMED30017260-orf-1|Name=SMED30017260-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=926bp
MNLITKKRKEFLGIPAPSGYVAGMGRGATGFTTRSDIGPARDDTDVPDER
HLQHKRAREDEDNENLNDSNYDEFSGYGGNICSKDPYEEDDIEADTIYEN
IDKHMDDRRKAYREIREQKEIEKYRRKRPKIQQNFVDLKRELKNVSFDEW
KNIPEVGDSRNRKQRNPRPDLYVPKPDSLIAKEFSDNQMNVIDPRLSTTT
GLQTPMDNIDMQRIGKARTLLMDSQLSRVSDSVNGQTVIDPKGYLTDLQS
MLPQMSMNPSGSEVADIKKSRLLLKSMTDTNPHKVSGWISIVRFEEHFSK
IHEAKQLVMKGCENCPESEEMWMEAIRIMKQYGGTDNISQAKSVASKAIK
QVPNSVSLWVAAANLEETLKTKRVVYKRALAEIPDSVKLWKLIVELEDDP
EEAKQLLEGAVQCCPTSVELWLALAKLNNPTEARAVLNTARQKIPNDRQI
WITACKLEEAEGNDEKIERLIQRAIEVLKSNMVEINRDEWIKDAEEAEKS
GNKVTAQKIIQRVVSIGVDEQDRKQTWLADAEACEEHGCLECARAIYSIA
ISSLSKKKGIWKRAAAFEKEHGTRENYEKILSQAVEHCDTVEVLWLMAAK
SKWEAGDVESARNVLSRAFAANPNSEEIMLAAVKLESENNEFDRANRLLQ
RARMNVGTDRVWMKSARLEWCLGNLDSAETLLLEATEKFPKYPKLWMMLG
QVREQKQEFKLALSSYKDGSLKNPESVPLWTLQANLEEKLGFVSMARNTL
EKAKAKNMKIPELWLASIRLELRANNNEFATNLMSRALQHCPDSGVLWAE
SINIVPKKNRMMKSRDALLKCEHSEHVLLAAAKVFWEQGQIANARNWLMK
TIKVEKLFGDAWGHLYKLESIYGTESQREEVMTRCVMAEPRFGEYWCPIS
KDVANWKLKTKDILPLVAAKIPLPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027108Prp6/Prp1/STA1
IPR003107HAT
IPR011990TPR-like_helical_dom_sf
IPR010491PRP1_N
IPR013026TPR-contain_dom
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0000398mRNA splicing, via spliceosome
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 457..477
NoneNo IPR availableCOILSCoilCoilcoord: 632..655
NoneNo IPR availableCOILSCoilCoilcoord: 121..141
NoneNo IPR availablePFAMPF14559TPR_19coord: 603..666
e-value: 1.8E-6
score: 28.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 31..69
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 38..64
NoneNo IPR availablePANTHERPTHR11246PRE-MRNA SPLICING FACTORcoord: 8..921
IPR003107HAT (Half-A-TPR) repeatSMARTSM00386hat_new_1coord: 673..705
e-value: 17.0
score: 13.7
coord: 428..460
e-value: 0.0026
score: 27.0
coord: 640..671
e-value: 15.0
score: 14.2
coord: 299..331
e-value: 40.0
score: 11.0
coord: 336..368
e-value: 2.3
score: 17.2
coord: 265..297
e-value: 49.0
score: 10.4
coord: 707..739
e-value: 130.0
score: 7.3
coord: 741..773
e-value: 0.65
score: 19.0
coord: 398..427
e-value: 49.0
score: 10.4
coord: 572..604
e-value: 52.0
score: 10.2
coord: 606..638
e-value: 6.0
score: 15.8
coord: 775..807
e-value: 140.0
score: 7.1
coord: 538..570
e-value: 6.4
score: 15.7
IPR010491PRP1 splicing factor, N-terminalPFAMPF06424PRP1_Ncoord: 16..162
e-value: 2.0E-53
score: 180.8
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 276..372
e-value: 3.6E-10
score: 42.0
coord: 721..907
e-value: 3.8E-8
score: 35.4
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 373..581
e-value: 6.7E-29
score: 103.0
coord: 582..712
e-value: 5.6E-19
score: 70.4
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 268..398
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 694..894
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 385..520
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 521..701
IPR027108Pre-mRNA-processing factor 6/Prp1/STA1PANTHERPTHR11246:SF1PRE-MRNA-PROCESSING FACTOR 6coord: 8..921
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 592..659
score: 6.633
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 659..794
score: 10.979