Low-density lipoprotein receptor

Overview
NameLow-density lipoprotein receptor
Smed IDSMED30017256
Length (bp)2316
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low-density lipoprotein receptor (SMED30017256) t-SNE clustered cells

Violin plots show distribution of expression levels for Low-density lipoprotein receptor (SMED30017256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low-density lipoprotein receptor (SMED30017256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low-density lipoprotein receptor (SMED30017256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017256h1SMcG0004439 dd_Smed_v4_5596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017256h1SMcG0004439 dd_Smed_v4_5596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017256h1SMcG0004439 dd_Smed_v4_5596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017256h1SMcG0004439 dd_Smed_v4_5596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017256h1SMcG0004439 dd_Smed_v4_5596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017256h1SMcG0004439 dd_Smed_v4_5596_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low-density lipoprotein receptor vs. Ensembl Human
Match: LRP8 (LDL receptor related protein 8 [Source:HGNC Symbol;Acc:HGNC:6700])

HSP 1 Score: 239.965 bits (611), Expect = 1.708e-67
Identity = 174/545 (31.93%), Postives = 263/545 (48.26%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSD--ERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP-GNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK--LLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFA 1891
            CI   W CD + DC    DE +CP K C D++F C +G  CI +   CDG   C D SD  E  CTK    +     +  C      C+P S  CD + +C    DE      ++ C  N      NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C CY GY  +   ++ C    G    LI  N      IDL   +  Y  L    +++V +DV++  +   ++W   S  K+  + +D   +  E+   ++ +  S +        ++ DW+   ++WT S  K I V          L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+  +  N KT+IS+   L +PF IAVFE+ +FWTD     I S +++     ++LA+ +  P  I + +++ QP+    D    +   N   GC ++CLP P  S   +  PKY C CP    L  D   C+ A
Sbjct:   59 CIPSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNG-HCIHERWKCDGEEECPDGSDESEATCTKQVCPA----EKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATWLNECLHN------NGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECK-DPDACSQICVNYKGYFKCECYPGYEMDLL-TKNCKAAAGKSPSLIFTNRHEVRRIDLVKRN--YSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQA---KIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDF-SGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRA--PDACELSVQPN--GGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRA 567          
BLAST of Low-density lipoprotein receptor vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 234.187 bits (596), Expect = 3.919e-65
Identity = 171/545 (31.38%), Postives = 267/545 (48.99%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIH---ESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN 1894
            CI K W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   CVD SDE NC    +  C    +F C + GE CI IS+VC+++ +C R+  +EP   +  C  N+C L+ NGGCSH C +     +C C  G++L  D +TC DIDEC  +P  C+QIC N  G Y+C C  GY+ +      C     + S++ T    R+ +  +      Y  L     + V +D D+  + Q +FW   S   +  + ID KV          H  + D+        ++ DW+   ++WT +  K I V          L N  L  P SIAVDP++  VYW D G      +IE   MN  +RR LV+ +++ P  + +DL + +LYW D     ++ ++L+  +    + S + L +P ++ +FE+ ++W D     +   +K T S+  T++  +     I V ++++QP      E D+ +         GC ++CLP P   IN +  PKY C CP    ++ +   C   N
Sbjct:  251 CIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKN--VNQCLGPGKFKC-RSGE-CIDISKVCNQEQDC-RDWSDEP---LKECHINEC-LVNNGGCSHICKDLVIGYECDCAAGFEL-IDRKTCGDIDECQ-NPGICSQICINLKGGYKCECSRGYQMDLATG-VCKAVGKEPSLIFT---NRRDIRKIGLERKEYIQLVEQLRNTVALDADI--AAQKLFWADLSQKAIFSASIDDKVG--------RHVKMIDNVYNP--AAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWG---EPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMEN--------GGCEYLCLPAP--QIN-DHSPKYTCSCPSGYNVEENGRDCQRIN 753          

HSP 2 Score: 78.9518 bits (193), Expect = 2.079e-14
Identity = 46/113 (40.71%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE-------RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI+  W CDG++DC  G DE NC  K C +++F+C++G QC+P    CDG   C D SDE       R C  HEI          C      CIP+S  CD +N+C   +DEE
Sbjct:   45 CITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNNG-QCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEIS---------CGAHSTQCIPVSWRCDGENDCDSGEDEE 147          

HSP 3 Score: 72.7886 bits (177), Expect = 1.723e-12
Identity = 46/120 (38.33%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQR 622
            ++  CI   W CDG  DC+SG+DE NC    C  +EF C SG +CI +  +C+G   C D SDE +C      +     +F C+     CIPIS VCD   +C    DE    S++ C R
Sbjct:  123 HSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSG-RCISRNFVCNGQDDCSDGSDELDCAPPTCGA----HEFQCSTSS--CIPISWVCDDDADCSDQSDE----SLEQCGR 231          

HSP 4 Score: 56.225 bits (134), Expect = 2.521e-7
Identity = 43/126 (34.13%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  221 ENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHS-GTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            + C  SD++     N   C+   W CDG+ DCE G DES   C  + C  +E  C +  TQCIP    CDG   C    DE NC         S  +F C+     CI  + VC+ +++C    DE
Sbjct:   70 KTCAESDFV----CNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENCGNITC----SPDEFTCSSG--RCISRNFVCNGQDDCSDGSDE 185          
BLAST of Low-density lipoprotein receptor vs. Ensembl Human
Match: LRP8 (LDL receptor related protein 8 [Source:HGNC Symbol;Acc:HGNC:6700])

HSP 1 Score: 232.261 bits (591), Expect = 4.116e-65
Identity = 173/543 (31.86%), Postives = 266/543 (48.99%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP-GNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK--LLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFA 1891
            CI   W CD + DC    DE +CP K C D++F C +G  CI +   CDG   C D SDE   T   + +C    +F C  DG  C+   + C+++ +C    DE      ++ C  N      NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C CY GY  +   ++ C    G    LI  N      IDL   +  Y  L    +++V +DV++  +   ++W   S  K+  + +D   +  E+   ++ +  S +        ++ DW+   ++WT S  K I V          L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+  +  N KT+IS+   L +PF IAVFE+ +FWTD     I S +++     ++LA+ +  P  I + +++ QP+    D    +   N   GC ++CLP P  S   +  PKY C CP    L  D   C+ A
Sbjct:   59 CIPSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNG-HCIHERWKCDGEEECPDGSDESEAT-CTLGTCRG-DEFQCG-DG-TCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHN------NGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECK-DPDACSQICVNYKGYFKCECYPGYEMDLL-TKNCKAAAGKSPSLIFTNRHEVRRIDLVKRN--YSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQA---KIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDF-SGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRA--PDACELSVQPN--GGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRA 565          
BLAST of Low-density lipoprotein receptor vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 233.417 bits (594), Expect = 8.920e-65
Identity = 170/542 (31.37%), Postives = 266/542 (49.08%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIH---ESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            CI K W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   CVD SDE NC    +  C    +F C + GE CI IS+VC+++ +C R+  +EP   +  C  N+C L+ NGGCSH C +     +C C  G++L  D +TC DIDEC  +P  C+QIC N  G Y+C C  GY+ +      C     + S++ T    R+ +  +      Y  L     + V +D D+  + Q +FW   S   +  + ID KV          H  + D+        ++ DW+   ++WT +  K I V          L N  L  P SIAVDP++  VYW D G      +IE   MN  +RR LV+ +++ P  + +DL + +LYW D     ++ ++L+  +    + S + L +P ++ +FE+ ++W D     +   +K T S+  T++  +     I V ++++QP      E D+ +         GC ++CLP P   IN +  PKY C CP    ++ +   C 
Sbjct:  251 CIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNC--KNVNQCLGPGKFKC-RSGE-CIDISKVCNQEQDC-RDWSDEP---LKECHINEC-LVNNGGCSHICKDLVIGYECDCAAGFEL-IDRKTCGDIDECQ-NPGICSQICINLKGGYKCECSRGYQMDLATG-VCKAVGKEPSLIFT---NRRDIRKIGLERKEYIQLVEQLRNTVALDADI--AAQKLFWADLSQKAIFSASIDDKVG--------RHVKMIDNVYNP--AAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWG---EPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMEN--------GGCEYLCLPAP--QIN-DHSPKYTCSCPSGYNVEENGRDCQ 750          

HSP 2 Score: 79.337 bits (194), Expect = 1.770e-14
Identity = 44/106 (41.51%), Postives = 62/106 (58.49%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI+  W CDG++DC  G DE NC  K C +++F+C++G QC+P    CDG   C D SDE     H +++C  I +  C      CIP+S  CD +N+C   +DEE
Sbjct:   45 CITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNNG-QCVPSRWKCDGDPDCEDGSDESPEQCH-MRTC-RIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEE 147          

HSP 3 Score: 73.1738 bits (178), Expect = 1.367e-12
Identity = 46/120 (38.33%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQR 622
            ++  CI   W CDG  DC+SG+DE NC    C  +EF C SG +CI +  +C+G   C D SDE +C      +     +F C+     CIPIS VCD   +C    DE    S++ C R
Sbjct:  123 HSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSG-RCISRNFVCNGQDDCSDGSDELDCAPPTCGA----HEFQCSTSS--CIPISWVCDDDADCSDQSDE----SLEQCGR 231          

HSP 4 Score: 56.225 bits (134), Expect = 2.301e-7
Identity = 43/126 (34.13%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  221 ENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHS-GTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            + C  SD++     N   C+   W CDG+ DCE G DES   C  + C  +E  C +  TQCIP    CDG   C    DE NC         S  +F C+     CI  + VC+ +++C    DE
Sbjct:   70 KTCAESDFV----CNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENCGNITC----SPDEFTCSSG--RCISRNFVCNGQDDCSDGSDE 185          
BLAST of Low-density lipoprotein receptor vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 229.95 bits (585), Expect = 1.166e-64
Identity = 167/562 (29.72%), Postives = 279/562 (49.64%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHSGT-QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISN--KLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKI 1942
            CIS  W CDG+ +C+ G DES   C    C   +F C     +CIP+   CDG   C + SDE+ C    +  C+  ++F C+  GE CI + +VC+   +C R+  +EP   +  C  N+C L  NGGCSH C +     +C CP G++L    R C DIDEC   P  C+Q+C N  G Y+C C +G++ + H ++ C   +   SI       R  +  +      Y  L  +  ++V +D ++  +   ++W   S   +  +++D + + +  Y  +  +++      Q    ++ DW+   ++WT S+   + V +T       L  +    PR+I VDP++  +YW D GT     +I+   +N  +   LV++N++ P  + +DL   +LYW D    SI+ I+++   N KTI+ +  +L +PFS+AVFE+ +FWTD     I S +++T     +LA+ ++ P  + + + + QP+    +      L N   GC ++CLP P   INP+  PK+ C CP    L  D  +C              + RLK+
Sbjct:   39 CISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGC----LTLCEGPNKFKCHS-GE-CITLDKVCNMARDC-RDWSDEP---IKECGTNEC-LDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRR-CEDIDECQ-DPDTCSQLCVNLEGGYKCQCEEGFQLDPH-TKAC---KAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEV--ASNRIYWSDLSQRMICSTQLD-RAHGVSSYDTVISRDI------QAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPA---KIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNG-GNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPR--GVNWCERTTLSN--GGCQYLCLPAP--QINPHS-PKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKV 563          
BLAST of Low-density lipoprotein receptor vs. Ensembl Celegans
Match: T13C2.6 (pep chromosome:WBcel235:II:6783427:6788255:1 gene:WBGene00020481.1 transcript:T13C2.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13C2.6)

HSP 1 Score: 188.734 bits (478), Expect = 1.023e-49
Identity = 169/575 (29.39%), Postives = 255/575 (44.35%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPP--KVC-LDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCT--KHEIKSCD-----SISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVD--NCQRN---DCKLIP------------------NGG---------------CSHFCTNFFTYIK----CHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEY--------CITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTD-------MSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKN-LRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLP 1789
            CI   W CD   DC+   DE NC      C L  EF C +   CI K  +CDG   C D SDE +C   + E KS +     S   +       +CIP S  C+ + +C    DE+  N      CQ+    +C   P                  +G                 S  C    ++++    CHC  GYKL+  N  C+DI+EC  +   C+QIC N PGSY C+C+ GY+ +  +++         C    GD  +L+T N       DL    HF  P+ +S  S V +D   H    T+ W    +  L +  +   + N+    FL        H   L  D       ++ DW+  LLFWT      I V +  +    VL +  LE PR+IAVDP    ++W D G K    RIE   M+  +R V+V  + +  P  L +D  ++++YW+D    SI   +    N    + S++ L +PFS+AVFE+ +F+TDW  + +I+++K T +D  TV+ +V  P+ +++ +K  QP +      S          C H+CLP
Sbjct:  225 CIPSRWRCDAEVDCKDHSDEKNCTAIQHTCKLAEEFACKASHNCINKAFVCDGELDCSDGSDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAPVTCQKGTEYECPSTPLQCIEMSKLCASAQFDCGDGNMSVCSQKKIIEMCKPSSEGCVCRPSFVRGNNVCHCKDGYKLE--NGQCIDINECEIA-GVCDQICLNIPGSYRCACHAGYQISFGDTKIGSGRIANKCRAMGGDPLVLLT-NRHTIRQFDLVNKMHF--PVSSSPGSAVAMD--FHILNGTLIW----SDVLSKQILKCSIGNVSNA-FLGTDMCDKKHEIVLTGDKIHTPDGLAVDWVHDLLFWTDGGLDQINVLDMKNGKQRVLYSSDLEEPRAIAVDPEVGLIFWTDWGKKA---RIERSGMDGQHRTVIVEGDRVVWPNGLALDYVDKRVYWADAKIKSIFSCDYWGKNIKTVLHSHQYLRHPFSMAVFEDRLFYTDWEHDGVITVNKFTGADIRTVMDQVKSPMTVRIYHKQAQPLMQNKCENSE---------CDHLCLP 774          

HSP 2 Score: 71.2478 bits (173), Expect = 1.968e-12
Identity = 48/134 (35.82%), Postives = 66/134 (49.25%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGT---------QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNK---DGEICIPISEVCDKKNNCGRNQDEE 592
            C +++   C+D     CI   W CDG+ DC++ +DE NC PKVC   E  C             +CIP   +CDG F C DKSDE  C     +      QF C +   D  +CIP + VCD + +C   +DE+
Sbjct:   32 CDATNSFQCQD---GRCIPMSWRCDGDIDCQNEEDEKNC-PKVCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDEFQCKNVSCQE----KQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQ 157          

HSP 3 Score: 67.3958 bits (163), Expect = 3.174e-11
Identity = 64/190 (33.68%), Postives = 86/190 (45.26%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKV--CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE-----RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGC--SHFCTN--FFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSY 811
            CI + W CDG +DC +GKDE NC  K   C DN F C +G  CI K  +CDG   C D SDE      NC +  +  C     + C   GE CIP    CD + +C  + DE+   ++    ++ CKL     C  SH C N  F    +  C  G           D D+C+   ++C    +  P SY
Sbjct:  137 CIPETWVCDGQRDCTNGKDEQNCTSKTSKCPDNNFQCSNG-NCIFKNWVCDGEEDCSDGSDELLTAPSNCNR-TVNQCPPGEMWKCGS-GE-CIPSRWRCDAEVDCKDHSDEKNCTAI----QHTCKLAEEFACKASHNCINKAFVCDGELDCSDGS----------DEDDCADVRTECKSGERTCPASY 308          

HSP 4 Score: 58.9214 bits (141), Expect = 1.300e-8
Identity = 41/114 (35.96%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCH--SG--TQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            +    CI   W CDG  DCE   DE  C    C + +F C   SG  + CIP+  +CDG   C +  DE+NCT    K  D  + F C+     CI  + VCD + +C    DE
Sbjct:   88 LERFKCIPNKWVCDGEFDCEDKSDEFQCKNVSCQEKQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNCTSKTSKCPD--NNFQCSNGN--CIFKNWVCDGEEDCSDGSDE 197          
BLAST of Low-density lipoprotein receptor vs. Ensembl Celegans
Match: T13C2.6 (pep chromosome:WBcel235:II:6783427:6788255:1 gene:WBGene00020481.1 transcript:T13C2.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13C2.6)

HSP 1 Score: 188.734 bits (478), Expect = 1.186e-49
Identity = 169/575 (29.39%), Postives = 255/575 (44.35%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPP--KVC-LDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCT--KHEIKSCD-----SISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVD--NCQRN---DCKLIP------------------NGG---------------CSHFCTNFFTYIK----CHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEY--------CITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTD-------MSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKN-LRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLP 1789
            CI   W CD   DC+   DE NC      C L  EF C +   CI K  +CDG   C D SDE +C   + E KS +     S   +       +CIP S  C+ + +C    DE+  N      CQ+    +C   P                  +G                 S  C    ++++    CHC  GYKL+  N  C+DI+EC  +   C+QIC N PGSY C+C+ GY+ +  +++         C    GD  +L+T N       DL    HF  P+ +S  S V +D   H    T+ W    +  L +  +   + N+    FL        H   L  D       ++ DW+  LLFWT      I V +  +    VL +  LE PR+IAVDP    ++W D G K    RIE   M+  +R V+V  + +  P  L +D  ++++YW+D    SI   +    N    + S++ L +PFS+AVFE+ +F+TDW  + +I+++K T +D  TV+ +V  P+ +++ +K  QP +      S          C H+CLP
Sbjct:  227 CIPSRWRCDAEVDCKDHSDEKNCTAIQHTCKLAEEFACKASHNCINKAFVCDGELDCSDGSDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAPVTCQKGTEYECPSTPLQCIEMSKLCASAQFDCGDGNMSVCSQKKIIEMCKPSSEGCVCRPSFVRGNNVCHCKDGYKLE--NGQCIDINECEIA-GVCDQICLNIPGSYRCACHAGYQISFGDTKIGSGRIANKCRAMGGDPLVLLT-NRHTIRQFDLVNKMHF--PVSSSPGSAVAMD--FHILNGTLIW----SDVLSKQILKCSIGNVSNA-FLGTDMCDKKHEIVLTGDKIHTPDGLAVDWVHDLLFWTDGGLDQINVLDMKNGKQRVLYSSDLEEPRAIAVDPEVGLIFWTDWGKKA---RIERSGMDGQHRTVIVEGDRVVWPNGLALDYVDKRVYWADAKIKSIFSCDYWGKNIKTVLHSHQYLRHPFSMAVFEDRLFYTDWEHDGVITVNKFTGADIRTVMDQVKSPMTVRIYHKQAQPLMQNKCENSE---------CDHLCLP 776          

HSP 2 Score: 69.707 bits (169), Expect = 6.814e-12
Identity = 47/135 (34.81%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCP-PKVCLDNEFLCHSGT---------QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNK---DGEICIPISEVCDKKNNCGRNQDEE 592
            C +++   C+D     CI   W CDG+ DC++ +DE NCP  +VC   E  C             +CIP   +CDG F C DKSDE  C     +      QF C +   D  +CIP + VCD + +C   +DE+
Sbjct:   32 CDATNSFQCQD---GRCIPMSWRCDGDIDCQNEEDEKNCPISEVCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDEFQCKNVSCQE----KQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQ 159          

HSP 3 Score: 67.3958 bits (163), Expect = 3.431e-11
Identity = 64/190 (33.68%), Postives = 86/190 (45.26%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKV--CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE-----RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGC--SHFCTN--FFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSY 811
            CI + W CDG +DC +GKDE NC  K   C DN F C +G  CI K  +CDG   C D SDE      NC +  +  C     + C   GE CIP    CD + +C  + DE+   ++    ++ CKL     C  SH C N  F    +  C  G           D D+C+   ++C    +  P SY
Sbjct:  139 CIPETWVCDGQRDCTNGKDEQNCTSKTSKCPDNNFQCSNG-NCIFKNWVCDGEEDCSDGSDELLTAPSNCNR-TVNQCPPGEMWKCGS-GE-CIPSRWRCDAEVDCKDHSDEKNCTAI----QHTCKLAEEFACKASHNCINKAFVCDGELDCSDGS----------DEDDCADVRTECKSGERTCPASY 310          

HSP 4 Score: 58.9214 bits (141), Expect = 1.290e-8
Identity = 41/114 (35.96%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCH--SG--TQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            +    CI   W CDG  DCE   DE  C    C + +F C   SG  + CIP+  +CDG   C +  DE+NCT    K  D  + F C+     CI  + VCD + +C    DE
Sbjct:   90 LERFKCIPNKWVCDGEFDCEDKSDEFQCKNVSCQEKQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNCTSKTSKCPD--NNFQCSNGN--CIFKNWVCDGEEDCSDGSDE 199          
BLAST of Low-density lipoprotein receptor vs. Ensembl Celegans
Match: lrp-1 (Low-density lipoprotein receptor-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q04833])

HSP 1 Score: 174.096 bits (440), Expect = 2.322e-44
Identity = 153/560 (27.32%), Postives = 250/560 (44.64%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESN-CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPD-NRTCVDIDECSASPSKCNQICKNTPGSYECSC----------YDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNN---IEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS---NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKV---VKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHG------CSHICLPFPSNSINPNEGPKYKCLCPKDSKL 1861
            +   CI K W CDG++DC  G DE + C  K C  NEF C +  +C P+   CD    C D SDE  C ++         +++C   G  CI   ++CD   +C    DE+       C +N   L P+ GC   C       +C CP GYKL    +RTC DI+EC A    C+Q+C N    + CSC          +   + N     YC++   D+  L          ++        K L  S E +  ID D     + +FW      +L  S     V++   I + + L+ K+L    +   C  ++ DW+   L+   S  + I V++      +VLL  GL  P  IA+DP+   +++ +        ++E   M+  NRR LV+ +  Q   +++D+  +++YW  +DP      ++D   N + I++   N + +PF +A+F+  ++WTDW +  +I ++K  SD+  + +     V P+ I   + + QP   +S+     CL  ++        C  +C+    N      G  YKC CP   KL
Sbjct:  191 DKTQCIQKSWVCDGSKDCADGSDEPDTCEFKKCTANEFQCKN-KRCQPRKFRCDYYDDCGDNSDEDECGEYRCPP----GKWNCPGTGH-CIDQLKLCDGSKDCADGADEQ------QCSQN---LCPSLGCQAGCHPSPHGGECTCPSGYKLDDRFHRTCSDINEC-AEFGYCDQLCANHRPGFTCSCLGDCFTLQMEHGPGKDNLTMRGYCVSNNADKMKLFVARREGLYRLNPKNPDEEVKKLA-SGEFIYGIDFDYGD--RKIFWTD----RLAHSAFSADVDDEGEISQIKKLSLKSL----VYPRC--LAVDWITNTLYIIESGSRRIDVSSYDGERRTVLLADGLTLPLDIALDPLRGEMFFTN------QLKLEAAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYW--VDPKVDRLESIDYQGNDRRIVAQGMNVVPHPFGLALFDQYLYWTDWTRLGVIQVEKFGSDTKLLWSNTENNVFPMGISAYHPMAQPGPGQSE-----CLAMKIENPCTNADCEGMCILSKDNG---GFGVGYKCACPIGQKL 705          

HSP 2 Score: 164.851 bits (416), Expect = 2.010e-41
Identity = 144/549 (26.23%), Postives = 243/549 (44.26%), Query Frame = 2
Query:  272 NCISKDWWCDGNQDCESGKDE-SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCD----SISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQ-PDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG--RQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEM--MLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVK-PLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            +CI   W CDG+ DC  G DE +NC    C  + F C +  +C+P    CDG   C D SDE++C K+   +      S  QF C   GE CI  ++VCD+  +C    DE        C  ++C L     C   C +     KC C  G+ +   D ++C +++EC    S C+Q C +  GSY+C C DGY+ +  +     T+       +  N    R++ ID N     Y+      +++V++D+DL +  +  + I Q   +L +  +D   + +  Y  +   N+           ++ DW+   L+  +  E+ I V          L+   ++ P++I V P    +++ +   +    RI +       D    L   +L  P  + ID    +L+W D     I F++ D  N  + I + +  +  S+ VF++ ++W DW   +++  DK T  + T+L K V+ P  +++++ + QP         + C  N   GCSH+CL           G  Y C CP    L  D+ TC 
Sbjct: 3111 HCIHSTWECDGDNDCLDGSDEHANCTYSSCQPDFFQC-ANHKCVPNSWKCDGNDDCEDGSDEKDCPKNSASAQKASKCSNGQFQCTS-GE-CIDDAKVCDRNFDCTDRSDES-----SLCFIDECSLAEKPLCEQKCMDMKIGYKCDCFEGFAIDISDQKSCHNVNECYEGISGCSQKCDDKIGSYKCGCVDGYQLSSDDHSCKRTEMEPEPFFLLANKHYIRKISIDGNK----YELAAQGFDNVVSLDIDLTE--KKAYLIDQGKLRLLRVDLDEMDSPLSSYETVLRHNVYGTE------GIAVDWVGRKLYMLNRQERSIRVCELDGRFCKTLIRDRIQQPKAIVVHPGKGYLFFTEWSLQPYIGRIALDGSPELQDPIFKLAEHDLGWPNAIAIDYFSDRLFWGDAHLNEIGFMDFDG-NGRRHIPAQRTSHVSSMVVFDDYLYWADWNLREVLRCDKWTGKNETILKKTVQLPNDLRIVHPMRQP------AYPNPCGDNN-GGCSHLCLIGAG-------GNGYTCSCPDQFVLLSDQKTCE 3624          

HSP 3 Score: 151.369 bits (381), Expect = 3.528e-37
Identity = 149/568 (26.23%), Postives = 243/568 (42.78%), Query Frame = 2
Query:  221 ENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN---CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE---RNC-TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRT-CVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMID--LNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWT-SSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK--VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            E+CT  D   C  +++  CI   W CDG QDC+ G DE        + C  ++F C +G +CI    LCDG   C D SDE   R C T    + C       C  D E CIP+ ++CD K +C    DE        C R+ C      GCS  C N      C CP G +L   N+T C   +EC  S S C+Q CK+    + CSC +GY  +       +      + +   N  R    D  L+    F   + N+      I +        ++W      K+    +    N      F+       D +  +   ++ DW+   L+W  SS+  I           ++L++Q +  PR IAVDP    ++W D G    +P IE   M+  +R+++V   +  P  + +D    ++Y++D     I+F+N D     + + S+K + +P ++A+FE+ ++++D R  ++    K  + + +        K L +  ++ V+QP I  +  +++         CSH+CL    N+        + C CP   KL      C
Sbjct: 1268 ESCTP-DQFKC--VSSGLCIPASWKCDGQQDCDDGSDEPKFGCTSGRQCSSDQFKCGNG-RCILNNWLCDGENDCGDGSDESSERGCKTSMNARKC-PFEHVACENDQETCIPLHQLCDGKTHCPGGTDEG-----GRCARDLCS-ADRAGCSFKCHNSPNGPICSCPFGEQLV--NKTKCEPENECLDS-SSCSQRCKDEKHGFTCSCDEGYELDVDKRTCKVADNVKDTRIYVSNRNRIYYSDHKLDNWHTFGAIVENA------IALAWDSLTDRIYWSDIREKKI----LSANRNGTNATVFIA------DGL-DITEGIALDWVGRNLYWVDSSLNTIEVANLEDPKQRTLLVHQNVSQPRGIAVDPRKGVMFWTDWG---QNPCIERASMDGTDRQIIVKTKIYWPNTIALDYTTDRVYFADSKLDFIDFVNYDGSGRTQVLASSKFVQHPHALAIFEDMMYYSDRRLQKLQVYPKYPNGTTSEYPSHTFSKALGVVAVHPVLQPVIKNNPCSTNP--------CSHLCLLNNKNT--------FTCKCPMGEKLDASGKKC 1785          

HSP 4 Score: 144.821 bits (364), Expect = 5.212e-35
Identity = 150/609 (24.63%), Postives = 248/609 (40.72%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPP---KVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKS--CDSISQFDCNKDGEICIPISEVCDKKNNCGRN--QDE---------EPG---------------NSVDNCQRND-------------------CKLIPN-GGCSHFCTNFFTYIKCHCPLGYKLQPDN-RTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQN----QHNSEYCITKEGDRSILITLNGGRQLMIDLN-----TGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKI-----------------------IYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDL-QERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCP 1846
            CI++  WCD  +DC +  DE +C     + C   EF C + + CIP+  +CDG   C D SDE   T  E +S  CD   +F C     +C+ I ++C+  N+CG N   DE         E G               N    C R D                   C+   N GGC H CT+      CHC  G++  P + + C+DIDEC+ + + C Q+C NT GSY C C++ Y  N        + C  K    +++I   G    ++ L+     T  H      +    ++ I  D  +  + M+WI  S   + +S I     + E  +     ++    +G + T ++ D+  G LF  +  E I                       I+V          ++   L+ P ++   P    + + D G      +IE   M+  +R+++V   +  P  + ID  +  ++YW D     ++ +N+D   + +T + +    P+++ VFEN+I+W       +   DK      +VLA     L      +V Q    ++  T   C + +   CSH+C+  PS          + CLCP
Sbjct: 3929 CIAEHKWCDRKKDCPNAADELHCEDVSRRTCSPFEFEC-ANSVCIPRKFMCDGDNDCGDNSDE---TSSECRSAQCDPPLRFRCAH-SRLCLNILQLCNGFNDCGPNDFSDEHLSMCSSFSEYGDCSSDQFKCANGKCVNGTVACDRKDDCGDASDEIGCSKHGGKTSCEAFGNNGGCKHICTDVRDGFYCHCRDGFRPDPQSPKECIDIDECAGN-NTCTQLCLNTKGSYLCRCHEDYENNVVVGSMTGKDCRAKGDAANVMI---GADDSLVQLSLHGSGTNRHAAAKANDDDNDIIGIAFDPRK--ELMYWIDGSERTIYRSAIANGNQSHEGQKL----DVDFAAMGVVPTAIAVDYTTGNLFIAAVSENIENGLVTARKKRMSEPIDNQNTGFIFVCLPDGRYLKKIVAGHLQQPTALITAPSAGRICYSDAGLHA---KIECADMDGTHRQIIVKDLVFSPTSMAIDEGKGNRIYWVDPKYRRVDAVNID--GSERTTVVHDRHIPYAVDVFENHIYWLSRESKTLYVQDKFGRGRVSVLA---SDLEDGHTVRVSQKYAKDTQRTVSGCERAQ---CSHLCVSLPSTG--------FACLCP 4503          

HSP 5 Score: 78.9518 bits (193), Expect = 1.078e-14
Identity = 87/357 (24.37%), Postives = 159/357 (44.54%), Query Frame = 2
Query:  770 SKCNQICKNTPGSYE--CSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDV-DLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYR--FLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSS----PRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDV----------TSHACLKNRMHGCSHIC 1783
            S C Q+C  TPG+    CSC  G  + +        +E D  I+ + +G + + + +       +PL +    + N+   D+  + + ++++ +S   +G +     +NN E  R  F   K      I  + +DM  DWL   +++T+     +   +T     S + +       ++A+DP +  ++W D G K S     PRIE   +   +R+V+VS+++  P  + +D + +K+YW+D++  +I   + D  N  K I S       S+ +++  ++ +D   N +  IDK   +S + L  VV    I    +V      ESDV          TS  C K    GC  +C
Sbjct: 2409 SPCTQLCFATPGTQTPTCSCARGVLKGR------TCEEPDTYIMFS-DGDKIIDVAIEPDVKASRPLKDPFPEISNLQTFDVDVNLRRVYFVVES--PVGVNISWFSMNNAENPRLVFGASKQPHAKEIRHI-SDMKLDWLTQKIYFTTGRGGKVMAIDTAGEHLSTIASGDWT--YALAIDPCSGLLFWSDSGYKTSGGLYEPRIERSNLAGGSRKVIVSESISLPAAIAVDFRNQKIYWADVNRLNIEVADYDGQNR-KVIASG--YRAKSLDIWDRWLYMSDPLSNGVFRIDK---ESGSGLENVVSDRRIPGALRVF---ASESDVRTRNQVCNALTSQLC-KTDNGGCDQLC 2743          

HSP 6 Score: 78.1814 bits (191), Expect = 2.056e-14
Identity = 45/178 (25.28%), Postives = 81/178 (45.51%), Query Frame = 2
Query: 1274 ENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKN---RMHGCSHICLPFPS 1798
            E P SIAVDP++  +YW D G K   P I+   ++   R V+VS  + +P DL++D+  + +YWSD     I  +   T   P+ + S+ +     +A+   N++WTD R  ++       + +  +L+      +++ +  V     +     S  C      R   C+ +C   P 
Sbjct: 2248 ETPSSIAVDPVSRYLYWADQGQK---PTIQRSFLDGSRREVIVSSGIAEPTDLVVDVASKMIYWSDAKMDGIYRVR-STGGTPELVRSD-IASAAGVALHGQNMYWTDNRLEKLFRATSKPNQTSLLLSPTTVAASLKDIGDVAVFSSNNQPRASSPCQITDNLRKSPCTQLCFATPG 2420          

HSP 7 Score: 71.633 bits (174), Expect = 2.227e-12
Identity = 45/107 (42.06%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG+ DC  G DE    CPP  C   +F C +G QC+P    CDG   C D SDE +C     +SC +  QF C   G +CIP S  CD + +C    DE
Sbjct: 1199 CIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFRCANGRQCVPLRNHCDGQSDCEDGSDEDSCAV-TAESC-TPDQFKCVSSG-LCIPASWKCDGQQDCDDGSDE 1302          

HSP 8 Score: 70.0922 bits (170), Expect = 5.808e-12
Identity = 45/125 (36.00%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGT----QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRN 625
            N   CI  +W CDG+ DC  G+DE +CP   C  +++ C + T     CI +   CD    C D SDE++C    +  C S + F C  DG  C  +S+ CD K +C    DE+     D+C RN
Sbjct:   61 NDGKCIRTEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQRCDNITDCADGSDEKDCPASTV-DCSSQNVFMC-ADGRQCFDVSKKCDGKYDCRDLSDEK-----DSCSRN 178          

HSP 9 Score: 70.0922 bits (170), Expect = 6.824e-12
Identity = 93/407 (22.85%), Postives = 165/407 (40.54%), Query Frame = 2
Query:  641 PNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICK-NTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNI----DVDLHQSPQTMFWIQQSN--GKLGQSKIDLK-----VNNIEKYRFLNHKNLSDDHIGQLCTDMSFDW-LRGLLFW---TSSIEKIIYXXXXXXXXXXXXXXQ---GLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDS----YTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPF 1792
            PNG  S + ++ F+       +   LQP     +  + CS +P  C+ +C  N   ++ C C  G + +    + CI  +  +  L+ +       I++N+ S    P+      L  +    D       + MF ++ +N    L Q   D       VN   K +  +     D +       + FDW  R L+     T +IE II           +  +Q    +  P +IAVD     V+W+D G   +  ++    ++  N  V+ S +L +   + ID    ++Y+S+   G I+ +  D  +    ++S+    P  +A + + +F+ D   +  I +  I  DS    +T   K V+ LA     K +QP+   S    H C  N  + C HIC+P 
Sbjct: 1717 PNGTTSEYPSHTFSKALGVVAVHPVLQP----VIKNNPCSTNP--CSHLCLLNNKNTFTCKCPMGEKLDASGKK-CI--DDAKPFLVIIQKTNVFGIEMNSASEKETPVLAGMVPLSGLGNAFDAAYDALSEEMFILEHTNHAKTLAQITTDSAIYRSTVNGGNKTKMFSSAVPDDAYC------LGFDWNGRNLVVGNKITQTIE-IIRTQGKQYRSVILSNDQSPTAVVTPVAIAVDADKGYVFWLDRGGGAADAKVARAGLDGSNPLVIASNDLAELDHIAIDTTNTRVYFSEAKAGRISSVTYDGQDR-HYVLSDGGRQPNGLAFYGDRLFYADSAFDS-IEVATINGDSQPPQWTHFKKDVENLANI---KALQPRASSS---GHPCHINNGN-CDHICIPL 2098          

HSP 10 Score: 62.003 bits (149), Expect = 2.083e-9
Identity = 43/130 (33.08%), Postives = 64/130 (49.23%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP-GNSVDNCQRNDCKLIPNGGC 655
            CI + W CD + DC  G DE    C    C  N+F C +G +CIP   LCDG   C D +DE       ++   S  QF C  +G  C+P+   CD +++C    DE+    + ++C  +  K + +G C
Sbjct: 1158 CIPEQWKCDSDNDCGDGSDEKLEMCGNATCAANQFSCANG-RCIPIYWLCDGDNDCYDGTDEDKERCPPVQC--SALQFRC-ANGRQCVPLRNHCDGQSDCEDGSDEDSCAVTAESCTPDQFKCVSSGLC 1283          

HSP 11 Score: 55.8398 bits (133), Expect = 1.578e-7
Identity = 42/108 (38.89%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  224 NCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKD---ESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIP 538
            NCT   +    D     CI K W+CDG  DC  G D   ES C  ++C   EF C +   C     +CDG   C D SDE+NC     K+CD    F C   G  CIP
Sbjct: 3626 NCTERQFACGGD--DAKCIPKLWYCDGEPDCRDGSDEPGESICGQRICPVGEFQC-TNHNCTRPFQICDGNDDCGDSSDEQNCD----KACDPW-MFKCAATGR-CIP 3724          

HSP 12 Score: 55.4546 bits (132), Expect = 1.950e-7
Identity = 41/114 (35.96%), Postives = 52/114 (45.61%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE-----SNCPPKV-CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI K+W CDG  DC    DE       C  +  C +N   C +  +CIP    CDG   C D SDE  + C   +   C +  +F C  D   CIP    CD  N+CG   DE+
Sbjct: 1068 CIPKEWKCDGENDCLDESDEIDEKGDKCFHETECAENTIKCRNTKKCIPAQYGCDGDNDCGDYSDEDVKYCKDGQKPVC-AAKKFQC--DNHRCIPEQWKCDSDNDCGDGSDEK 1178          

HSP 13 Score: 54.6842 bits (130), Expect = 2.927e-7
Identity = 40/110 (36.36%), Postives = 53/110 (48.18%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLD-NEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            ++  CI    +C+G  DC    DE       C D  EF C +  +CIP+  +CD    C D SDE + +        S S+F CN DG+ CIP S+VCD    C    DE
Sbjct: 3802 SSYRCIPNWAFCNGQDDCRDNSDEDKQRCPTCDDVGEFRCATSGKCIPRRWMCDTENDCGDNSDELDASCGGTTRPCSESEFRCN-DGK-CIPGSKVCDGTIQCSDGLDE 3909          

HSP 14 Score: 53.5286 bits (127), Expect = 7.363e-7
Identity = 39/125 (31.20%), Postives = 54/125 (43.20%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDES--NCP----PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--------RNCTKHEIKSCDSISQFDCNKDGEI------CIPISEVCDKKNNCGRNQDE 589
            CI + W CDG+ DC  G DE+  NC      K+C+ +        +CI +  +CDG   C D SDE        R CT  E         F C  + ++      CIP + +CD    C   +DE
Sbjct: 2973 CIPETWQCDGDNDCSDGWDETHTNCTDTAGKKICVGDYLFQCDNLKCISRAFICDGEDDCGDGSDEHSRHGCGNRTCTDQE---------FHCTSNAKLAQPKYECIPRAWLCDGDVTCAGGEDE 3088          
BLAST of Low-density lipoprotein receptor vs. Ensembl Celegans
Match: lrp-2 (Low-density lipoprotein RecePtor related [Source:UniProtKB/TrEMBL;Acc:O01768])

HSP 1 Score: 164.851 bits (416), Expect = 2.053e-41
Identity = 132/493 (26.77%), Postives = 224/493 (45.44%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFL-CHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQ---FDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQ-TMFWIQQSNGKLGQSKID----LKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVS-KNLRQ---PLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVV-KPLAIQVLNKVIQ 1708
            C+     CDG  DC +G+DE+ CPP +C     L C +G +CI K L CDG   C D SDE++CT+  +       Q   + C+     CI    +CD  N+C    DE    +  NC   D     + GCSH C        C CP  + L  +  TC   D C     +C+Q C     S+ C C D ++     S  CI+ +  +  LI  N     MI          P+  +  + + +D   HQ+   +++W   S  K+    +D    L    I  Y   N + +            + DW+ G ++W  S    I V +      + ++NQ + N RS+A+D     ++W D   ++S+PRIE   +  +NR ++    N+ Q   P  + +D   +++YW+D    SI+ I  D  ++        +L + F I V+E +++++DWR N I  +DK    + +++ +V  +P +++++++  Q
Sbjct: 1153 CLRSFQLCDGFPDCLTGEDETECPPSMCDSTTHLSCLNGQKCISKQLECDGVDDCGDNSDEKHCTEIRLDEAALRCQSPMYQCDGPNFKCISDKHLCDGTNDCEEGDDEGLWCTF-NCTDAD-----DLGCSHTCRPTPVGPICSCPDDHYLDKNGVTCSKKDPCRF--GQCSQYCSPHGSSHFCYCEDSFKLGADRSS-CISDDPRKPFLIYSNRHEIRMIQSKYPGSL--PMITNLVNAIALDFKYHQNGSVSIYWTDLSADKIYTGLVDQRTILYQRTIVSYGVFNAEGI------------AVDWISGNIYWIDSFLDTIQVVSEDGTKRATVINQNMGNARSLAIDVEEGFMFWTDW--EESNPRIERASLAGNNRAIIWKISNIAQAGWPNGIALDTIAKRVYWADAKSDSIHTITYDGRDHVIVFRDPERLGHCFGIDVYEGHVYFSDWRTNTISKVDKWFGSNVSIIERVATQPFSLKIVHRSKQ 1620          

HSP 2 Score: 147.902 bits (372), Expect = 5.007e-36
Identity = 145/556 (26.08%), Postives = 243/556 (43.71%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDESNCPP--KVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCN-KDGEI-CIPISEVCDKKNNCGRNQDEEPGNSVDNCQ--RNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQP-DNRTCVDIDECSASPSKCNQICKNTPG-SYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFW--IQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWL-RGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVS-KNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA--KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSH------ICLPFPSNSINPNEGPKYKCLCPKDSKLQG 1867
             V C      CDG QDC  G DE NC    + C  NE++C SG QCI    LCD +  CVD SDE    C+  E       S + C   +G I C+   ++CD + +C    DE+  N   NC   RN C    N      C     +  C C  GY L P D +TC+    C  +   C+  C +     ++C C  GY  ++ N + C   +   + ++ + G R  +  ++   H    L ++  + V +D D+      ++W  +     K G + +    N    YR +N  +L    I  +    + DWL R + +   + + I            +L    L +PR+I +DP+   V+W D G   +S  I  M M+  N +V++  + +R P  L +D   ++LY+ D     I   N D     + ++   + + F++AVFE+ ++W+DW  + I  + KIT  +  VL   K  +P+  ++++  +Q         S   LK   H CS       +C+P  +  +  +    + C+C +  + +G
Sbjct: 2957 VVACELTAVLCDGIQDCSDGFDEKNCASLDRQCKPNEWMCDSG-QCIDSGRLCDASVDCVDGSDEWVEICSLSEPPRRGCPSGWSCLLTNGTIGCLQEQQLCDGRRDCMSGIDEQCDNPQGNCSSTRNSCDQTWN------CQRHAGFESCSCDDGYHLSPYDKKTCLRSPSCPKA--NCSHFCIDRRDVGHQCFCAPGYILSE-NQKDCRRNDTIEAEILMVYGHRLKLFTID--GHAKATLLSNLTNGVALDYDVKS--DLVYWTDVAHDGNKAGITSMS---NQPNTYRVIN--SLPTKGIDGI----AVDWLGRNIYYTDRNHDAIAVCDMRGRFNRILLKGTPLNDPRAIVLDPLQALVFWTDWG---ASAHIGRMNMDGSNEQVILQDRTIRWPNALAVDAPAQRLYFGDAHRDYIASCNYDGSKR-RMVLRGSVRHIFALAVFEDYVYWSDWHNHTIERVHKITGTNRKVLIQDKQYRPMGFKIVHPSLQ---------SMGSLKTARHPCSQPARCDNLCIPANTPDLTTSS-DNFTCMCAQGFRSEG 3475          

HSP 3 Score: 97.4413 bits (241), Expect = 2.290e-20
Identity = 110/478 (23.01%), Postives = 201/478 (42.05%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHC-------VDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSAS----PSKCNQICK-NTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMI----DLNTGSHFYKPLYNSHESLVNID-----------VDLHQSPQ------TMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKN--------------------------LSDDHIGQLCTDMSFDWLRGLLFWTS--SIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPK 1525
            C  + W+CDG  DC+   DE +   + CL+NEF+C +G +C+P+  LCD  + C        D SDE     ++   CD  +++ C+K  + C+P+ + CD K +C    DE     V++ +  D        C +        IKC+CP    L    + C  ++ C  +    P  C+Q C  N  G++ CSC+D  R    N  +C+  +      + +   ++L +     +++ S   +PL       + I            + L +SP       T   ++ S        ID  +++I   RF N  N                          ++   +G +  DM +D L G L  +    +++ I+  +  S     L  Q + +P ++A+DP    +Y++D+G +     I+ +  N +  R +VS  + + +  +ID  E +L+ +  D        LD+ ++ K
Sbjct:   54 CYPEQWYCDGFPDCQDSSDEPSTCKRTCLENEFVCKTG-KCLPRGYLCDSQYDCGRLPNGDRDLSDEAPELCNQPLHCD-YNEYACSKSAQ-CVPLFKFCDGKRDCSDGSDEHSMCHVEDPKTAD-------SCEYGAAMTIDGIKCYCPKNKFLNEQGK-CEFVNHCERTKNGLPPVCSQDCTDNKNGTFTCSCFDP-RLTVVNGTHCVADKDQTIPSVAILTKKKLFVLQKNKMSSYSSMPRPLGKPGAMTLVIQHPDFPEATVPILCLSESPSANDSYITCGNVEGSEPATKTYAIDFDLSSIHIIRFDNIGNNWIFTDASYYVFICKHNSVRISSCRTVTAGDMGTI-QDMKYDGLNGQLLVSEVDVLQQGIWRIDVASGQRYRLSYQPITSP-ALAIDPFTETLYFVDIGARS----IKAVDYNANYSRTIVSGRIAKEVK-MIDYAEGRLFLTLKDNRVFAMNALDSNSDMK 512          

HSP 4 Score: 86.2705 bits (212), Expect = 7.873e-17
Identity = 128/544 (23.53%), Postives = 215/544 (39.52%), Query Frame = 2
Query:  233 SSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCNKDGEICIPIS-EVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTY-IKCHCPLGYKLQPDNRTCVDIDECSAS---PSKCNQICKNTPG-SYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDL-NTGSHFYKPLYNSHESLV--NIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTD------MSFDWLRGLLFWTSSIEKI----------IYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNR-------------RVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSH 1741
             SD   C D+      +K   CDG  DC SGKDE+NC       N F C    Q I +  +CDG + C D  DE    C   + + C  I   D   D + C+ +S  +CD   +C    DE P +  D C+             + CTN     +   C      + D     D D C A       C Q C      +  C C  GY + +++   C        + IT NG R  ++ L N+     +P++N   +L+   ID        T+ +       +G S++D++            K  SD  IG    +      +++D++   +++T S E+           IYV       T  L+        S+AVDPI   ++W       S+P   ++  N D +             + LV +N+ +P  +++D    +LYW D+   +I  ++ D   + +T+   +L   P ++ V    I+    RQ  I  + K T  +   + K ++ ++ ++  +V  P  H     +H
Sbjct: 3756 GSDEKGCPDLECHLASNKSLICDGTIDCSSGKDENNCHNNG-ESNFFQC--SMQTIKEWQVCDGRWDCADGLDESPEMCASRKAR-CFRIGYCD---DKKQCLDVSTALCDGIRDCFDGSDENPIHCKDMCKGK-----------YRCTNGRCIDVSARC----DGRDDCGDGSDEDTCGAECHHFGVCAQKCWMAFNHTARCHCAPGYARTKNDENECEPLSKSAEMFIT-NGNRLHLMSLENSQVSVLRPVFNIKMNLIPGGIDFGYDVFRTTLMYTV----GIGNSRVDIR-----------SKKWSDGLIGSWGEEESTAGLITYDFMHNNVYFTESSEQNRGVLFDRQANIYVAKAKDTSTRTLIVNSTGTINSLAVDPIKRLIFWT-----TSAPVPRILSANLDGKPIAQPFKTGSQPHKALVERNIFEPTSMVLDFSNERLYWIDVLKRTIETVSFDG-RDRRTVRKFELGDTPVTMDVLGGYIYLIT-RQGSIHRMHKFTGKTNKYVQK-IREVSPRIQIRVAHPAKHTVSHITH 4253          

HSP 5 Score: 70.4774 bits (171), Expect = 5.435e-12
Identity = 43/112 (38.39%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVD 610
            C+ K W CDG  DC  G DE NC  K C   EF C S  +CIP    CDG   C D  DE  C + E  S    + F C      CIP++  CD  ++C  N      + VD
Sbjct: 2829 CMPKHWQCDGQPDCADGSDEKNCDAKKCTSFEFSCESSKKCIPLEQKCDGRRDCPDGEDEHQC-ETECDSKGGNATFRCTN--HRCIPMAWRCDGTDDCMDNAKSLGSDEVD 2937          

HSP 6 Score: 68.9366 bits (167), Expect = 1.478e-11
Identity = 45/123 (36.59%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  239 DYLNCEDINAVN-CISKDWWCDGNQDCESGKDESNCPPKV--CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNC--GRNQDEE 592
            D+  C +  A++ CI K+++CDG  DC  G+DE +    +  C   +F C SG +CIPK   CDGT  C D SDE+ C K     CD+            C+   ++CD K  C  G ++DEE
Sbjct: 3617 DFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQCTSG-KCIPKRRQCDGTLDCRDGSDEKGCKKECAIVCDN-----------SCVHADDLCDGKKKCNDGSDEDEE 3727          

HSP 7 Score: 68.5514 bits (166), Expect = 1.956e-11
Identity = 74/331 (22.36%), Postives = 138/331 (41.69%), Query Frame = 2
Query:  815 CSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQL-CTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQG-LENPRSIAVDPINTGVYWIDLGT-----KKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTI-ISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDS----YTVLAKVVKPLAIQVLN-KVIQPKIHESDVTSHACLKNRMHG 1768
            C C DGY QN  N++   +K+     L  L   R   I +      Y+        L+N+     + P  M +  +    L     DL+ +++   +  +         G + C  M++D+    L+ T    KII V   ++     ++  G + NPR+IA+    + ++W          +K    IE   ++   R+ LVSKN      L +DL+   LYW D     I  I  +  +    +  ++K+ +P+ +A F+N+IF+T++++  +  ++    D     +   A V + L  +  N +   P    S++  H C  +   G
Sbjct:  570 CFCRDGYIQN--NTKCSASKDLKDEELFVLAQLRPSRIKILGFDKNYRTEIIGVSDLLNV-----KRPSAMTFDPKGEQLL---MYDLRRHSLVVQKIGSTNYTVHGLTGIMNCEGMAYDFTSDNLYMTDQRRKIITVQRLSNLSIQKVVVSGNMSNPRAIAIHIAKSYLFWGSWNEDNNDDEKIPAMIERSKLDGSERKTLVSKNAMWINGLTLDLKNDYLYWCDAYRNVIERIRWNGADREVVVHGADKISHPYGLAFFDNHIFYTEFKKGAVKRVNVDFPDDVQEVFQYSATVFELLVFKNSNPETTSPCSTSSNICEHFCFASSCKG 890          

HSP 8 Score: 67.3958 bits (163), Expect = 4.376e-11
Identity = 42/118 (35.59%), Postives = 57/118 (48.31%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNC------------PPKVC-LDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG  DC  G DE +C             P+ C    +F C +   C+PK   CDG   C D SDE+NC   + K C S  +F C +  + CIP+ + CD + +C   +DE
Sbjct: 2776 CIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRTCMPKHWQCDGQPDCADGSDEKNC---DAKKCTSF-EFSC-ESSKKCIPLEQKCDGRRDCPDGEDE 2888          

HSP 9 Score: 67.0106 bits (162), Expect = 4.886e-11
Identity = 61/186 (32.80%), Postives = 82/186 (44.09%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESN-----CPPKVCLDNEFLC-----HSGTQCIPKLLLCDGTFHCVDKSDERN--CTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCK----LIPNGGCSHFCT--NFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKC 778
            CIS  W CDG  DC  G+DE       CPP  C+  +F+C     ++  QC+    LCDG   C    DE    C   E       +QF C  D + CIP++ VCDK+ +C    DE       NC+   CK       NG     C    F+   +  CP G + +PD  +C  I EC+    +C
Sbjct: 3495 CISSWWRCDGQDDCGDGEDEGYFVEGVCPPFPCIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENFECTE----AQFKCG-DKKKCIPLTSVCDKEKDCDDGSDEL------NCEITSCKPDFFACFNGTAISKCIPKEFYCDGEDDCPEG-QDEPD--SCFGIGECTHEQFQC 3666          

HSP 10 Score: 67.0106 bits (162), Expect = 5.838e-11
Identity = 45/132 (34.09%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCP-PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE----PGNSVDNCQRNDCKLIPNGGC 655
            CI K   C+G Q+C++G DE +CP  K+C  +EF C +G  CI +  +CDG   C+D  DE +C + E   C    QF C      C+ +   CD   +C  + DE      GNS   C + +  +  +G C
Sbjct: 1025 CIIKSKRCNGVQECDNGADEEDCPRSKLCDPDEFRCGTGL-CIKQSQVCDGKMQCLDGLDEEHCNEEE--KCLQGRQFRCANGKSTCLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMCADGKC 1153          

HSP 11 Score: 63.5438 bits (153), Expect = 5.706e-10
Identity = 50/207 (24.15%), Postives = 93/207 (44.93%), Query Frame = 2
Query: 1274 ENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK---LLYPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            + PR IA+ P    +++ +     S   IE +  +   R  +V ++L     L IDL   KLY+SD     I+  + D  +  + ++SN     ++PF ++++++ I +TDW +  ++ ++KIT SD+  +      P+ + V++            TS AC  N +  C   C    +         +  C C  + +L  D  TC
Sbjct: 2442 DRPRHIAIHPCRMLLFFTNNAITGSV--IERVYFSGFKRDQIVQEDLHDLRGLTIDLDSEKLYFSDSKDFKISRCDFDGSHR-ELVVSNTDIPSIHPFELSIYDDEIIFTDWVRRSVVGVNKITGSDNRNINRATDVPVGLVVVD------TKREYCTSDACADNELK-CEDYCRLMANG--------QASCACNGERRLNSDNRTC 2630          

HSP 12 Score: 55.8398 bits (133), Expect = 1.379e-7
Identity = 41/112 (36.61%), Postives = 51/112 (45.54%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEI--CIPISEVCDKKNNCGRNQDE 589
               C+     CDG +DC  G DE  + C    C + +F C    +CIP   +CD    C D SDE NC   EI SC     F C     I  CIP    CD +++C   QDE
Sbjct: 3542 TAQCLYASKLCDGVKDCSGGDDEEPAFCENFECTEAQFKCGDKKKCIPLTSVCDKEKDCDDGSDELNC---EITSCKP-DFFACFNGTAISKCIPKEFYCDGEDDCPEGQDE 3649          

HSP 13 Score: 53.5286 bits (127), Expect = 6.772e-7
Identity = 41/122 (33.61%), Postives = 55/122 (45.08%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLD-NEFL------CHSGTQCIPKLLLCDGTFHCVDKSDERNC---------TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI     C+  QDC    DE  CP + C   NEF       C + +QCI     CDGT  C D SDE++C         +    +SCD+ +QF C      C+P    CD + +C    DE+
Sbjct: 2729 CIPSKARCNHMQDCNDASDEIGCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLAT-RTCMPKHWQCDGQPDCADGSDEK 2849          

HSP 14 Score: 53.5286 bits (127), Expect = 7.185e-7
Identity = 43/132 (32.58%), Postives = 60/132 (45.45%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGT---QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSH 661
            CI     CD  +DC+ G DE NC    C  + F C +GT   +CIPK   CDG   C +  DE + +   I  C +  QF C      CIP    CD   +C    DE+       C++ +C ++ +  C H
Sbjct: 3587 CIPLTSVCDKEKDCDDGSDELNCEITSCKPDFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPD-SCFGIGEC-THEQFQCTSGK--CIPKRRQCDGTLDCRDGSDEK------GCKK-ECAIVCDNSCVH 3707          
BLAST of Low-density lipoprotein receptor vs. Ensembl Celegans
Match: rme-2 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:O44191])

HSP 1 Score: 155.992 bits (393), Expect = 4.443e-39
Identity = 147/585 (25.13%), Postives = 241/585 (41.20%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPK----------------------------VCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKH-------------EIKSCDSISQFDCNKDGE---ICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGY--RQNQHNSEYCITKEGDRSILITLNGG-RQL-MIDLNTGSHFYKPL--YNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWT------SSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNK-----VIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCP 1846
            CI  D  CDG+ DC  G DE NC  +                             C     +CHSG  CIP   LCDG   C D SDE+NC  +              + SC +   + C   G    +CIP++  C+    C    DE             C       C H C N     +C C  GYKL  D  TC D DEC+     C   C++  GS+ C C +GY    + H+ +Y  T   +  + I+L G  RQ+ + D   GS+ Y P+  +  H ++ +ID  +H++ +    I   +   G    +L V++    R L    +         ++++ DW+ G +F+T      S+   I  ++            QG ++ R + V P+   + WID  + +   RI M  M+    R+L+   L  P  L ID     +Y+ D++   I  +N+DT    + +ISN + +P+ +A F   ++W DW  ++ + + ++T    +       P  I   N+      +   ++++   S+ CL+     C  +C+  P +          KC+CP
Sbjct:   70 CIQPDLVCDGHTDCSGGDDEVNCTRRGHENMQSSTDFHDDVHLVDPTFFANEDNKCRSGYTMCHSGDVCIPDSFLCDGDLDCDDASDEKNCQTNAPSEEEYLSGQADHMHSCSAAGMYSCGTKGSEIGVCIPMNATCNGIKECPLGDDES----------KHCSECARKRCDHTCMNTPHGARCICQEGYKLADDGLTCEDEDECATHGHLCQHFCEDRLGSFACKCANGYELETDGHSCKYETTTTPEGYLFISLGGEVRQMPLADFTDGSN-YSPIQKFAGHGTIRSIDF-MHRNNKMFMSISDEH---GDPTGELSVSDNGLMRVLRENVIG-------VSNVAVDWIGGNVFFTQKSPSPSAGISICTMSGMFCRRVIEGKEQG-QSYRGLVVHPMRGLIIWID--SYQKYHRIMMANMDGSQVRILLDNKLEVPSALAIDYIRHDVYFGDVERQLIERVNIDTKER-RVVISNGVHHPYDMAYFNGFLYWADW-GSESLKVQEMTHHHSS-------PQVIHTFNRYPYGIAVNHSLYQTGPPSNPCLELE---CPWLCVIVPKSDFIMTA----KCVCP 613          
BLAST of Low-density lipoprotein receptor vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0113480)

HSP 1 Score: 263.848 bits (673), Expect = 3.353e-76
Identity = 185/565 (32.74%), Postives = 279/565 (49.38%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKH-----EIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDS---YTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C S +Y  C+D   + C+   W CDG++DC  G DE  +NC    C  ++F C     CIP  L C+G   C D SDER+C            C++ S+FDC   G  C+P+S+VCDK+ +C   +DE  G     C  N+C    NGGC H C +      C C  GYKL PD R C DI+EC   P KC+QIC N  G ++C C  GY ++  N   C   EG  S+L+      R++ +D     H     + NS ++   +D         +FW   +   + ++ ID      EK   L   +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   L+ PRSIA+DPI   +YW D G   +SPRIE   M+  +R  ++S +++ P  + +DL ++++YW D     I+  N D     + + S + L +PFSI  FE+N++WTDW +  +   +K T +     T +  +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C
Sbjct:  196 CLSHEY-QCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQC-GDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCG--GGQCVPLSKVCDKRKDCPDGEDEPAGK----CGINECAS-KNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINECEV-PGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD-----HMEMTSIVNSTKAATALDFVFRTG--MIFWSDVTTQSIYKAPID---EGNEKTVVLTKSSVTSD-------GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWG---ASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMVDGLMC 718          

HSP 2 Score: 60.8474 bits (146), Expect = 3.545e-9
Identity = 36/87 (41.38%), Postives = 45/87 (51.72%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN--CPPKVCLDNEFLCHSGT-QCIPKLLLCDGTFHCVDKSDERNCTK 469
            NE   SSD   C +    NCI   W CD   DC  G DE+N  C  + C  +E+ C SG  QC+P   +CD +  C D SDE NC +
Sbjct:   27 NEATCSSDQFRCGN---GNCIPNKWRCDQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQ 110          
BLAST of Low-density lipoprotein receptor vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0335238)

HSP 1 Score: 263.462 bits (672), Expect = 1.107e-75
Identity = 185/565 (32.74%), Postives = 279/565 (49.38%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKH-----EIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDS---YTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C S +Y  C+D   + C+   W CDG++DC  G DE  +NC    C  ++F C     CIP  L C+G   C D SDER+C            C++ S+FDC   G  C+P+S+VCDK+ +C   +DE  G     C  N+C    NGGC H C +      C C  GYKL PD R C DI+EC   P KC+QIC N  G ++C C  GY ++  N   C   EG  S+L+      R++ +D     H     + NS ++   +D         +FW   +   + ++ ID      EK   L   +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   L+ PRSIA+DPI   +YW D G   +SPRIE   M+  +R  ++S +++ P  + +DL ++++YW D     I+  N D     + + S + L +PFSI  FE+N++WTDW +  +   +K T +     T +  +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C
Sbjct:  194 CLSHEY-QCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQC-GDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCG--GGQCVPLSKVCDKRKDCPDGEDEPAGK----CGINECAS-KNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINECEV-PGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD-----HMEMTSIVNSTKAATALDFVFRTG--MIFWSDVTTQSIYKAPID---EGNEKTVVLTKSSVTSD-------GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWG---ASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMVDGLMC 716          

HSP 2 Score: 64.3142 bits (155), Expect = 3.746e-10
Identity = 38/85 (44.71%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN-CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTK 469
            NE   SSD   C +    NCI   W CD   DC  G DE+N      C +NEF C +  QCIP+  LCDG+  C DKSDE +C +
Sbjct:   27 NEATCSSDQFRCGN---GNCIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHCNQ 108          
BLAST of Low-density lipoprotein receptor vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0335237)

HSP 1 Score: 263.077 bits (671), Expect = 1.181e-75
Identity = 185/565 (32.74%), Postives = 279/565 (49.38%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKH-----EIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDS---YTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C S +Y  C+D   + C+   W CDG++DC  G DE  +NC    C  ++F C     CIP  L C+G   C D SDER+C            C++ S+FDC   G  C+P+S+VCDK+ +C   +DE  G     C  N+C    NGGC H C +      C C  GYKL PD R C DI+EC   P KC+QIC N  G ++C C  GY ++  N   C   EG  S+L+      R++ +D     H     + NS ++   +D         +FW   +   + ++ ID      EK   L   +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   L+ PRSIA+DPI   +YW D G   +SPRIE   M+  +R  ++S +++ P  + +DL ++++YW D     I+  N D     + + S + L +PFSI  FE+N++WTDW +  +   +K T +     T +  +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C
Sbjct:  234 CLSHEY-QCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQC-GDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCG--GGQCVPLSKVCDKRKDCPDGEDEPAGK----CGINECAS-KNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINECEV-PGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD-----HMEMTSIVNSTKAATALDFVFRTG--MIFWSDVTTQSIYKAPID---EGNEKTVVLTKSSVTSD-------GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWG---ASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMVDGLMC 756          

HSP 2 Score: 61.6178 bits (148), Expect = 2.630e-9
Identity = 37/84 (44.05%), Postives = 45/84 (53.57%), Query Frame = 2
Query:  221 ENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN-CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTK 469
            E   SSD   C +    NCI   W CD   DC  G DE+N      C +NEF C +  QCIP+  LCDG+  C DKSDE +C +
Sbjct:   68 EATCSSDQFRCGN---GNCIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHCNQ 148          
BLAST of Low-density lipoprotein receptor vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301466)

HSP 1 Score: 263.462 bits (672), Expect = 1.247e-75
Identity = 185/565 (32.74%), Postives = 279/565 (49.38%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKH-----EIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDS---YTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C S +Y  C+D   + C+   W CDG++DC  G DE  +NC    C  ++F C     CIP  L C+G   C D SDER+C            C++ S+FDC   G  C+P+S+VCDK+ +C   +DE  G     C  N+C    NGGC H C +      C C  GYKL PD R C DI+EC   P KC+QIC N  G ++C C  GY ++  N   C   EG  S+L+      R++ +D     H     + NS ++   +D         +FW   +   + ++ ID      EK   L   +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   L+ PRSIA+DPI   +YW D G   +SPRIE   M+  +R  ++S +++ P  + +DL ++++YW D     I+  N D     + + S + L +PFSI  FE+N++WTDW +  +   +K T +     T +  +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C
Sbjct:  196 CLSHEY-QCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQC-GDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCG--GGQCVPLSKVCDKRKDCPDGEDEPAGK----CGINECAS-KNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINECEV-PGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD-----HMEMTSIVNSTKAATALDFVFRTG--MIFWSDVTTQSIYKAPID---EGNEKTVVLTKSSVTSD-------GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWG---ASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMVDGLMC 718          

HSP 2 Score: 61.6178 bits (148), Expect = 2.723e-9
Identity = 36/87 (41.38%), Postives = 45/87 (51.72%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN--CPPKVCLDNEFLCHSGT-QCIPKLLLCDGTFHCVDKSDERNCTK 469
            NE   SSD   C +    NCI   W CD   DC  G DE+N  C  + C  +E+ C SG  QC+P   +CD +  C D SDE NC +
Sbjct:   27 NEATCSSDQFRCGN---GNCIPNKWRCDQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQ 110          
BLAST of Low-density lipoprotein receptor vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0335235)

HSP 1 Score: 264.618 bits (675), Expect = 1.585e-75
Identity = 185/565 (32.74%), Postives = 279/565 (49.38%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKH-----EIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDS---YTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C S +Y  C+D   + C+   W CDG++DC  G DE  +NC    C  ++F C     CIP  L C+G   C D SDER+C            C++ S+FDC   G  C+P+S+VCDK+ +C   +DE  G     C  N+C    NGGC H C +      C C  GYKL PD R C DI+EC   P KC+QIC N  G ++C C  GY ++  N   C   EG  S+L+      R++ +D     H     + NS ++   +D         +FW   +   + ++ ID      EK   L   +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   L+ PRSIA+DPI   +YW D G   +SPRIE   M+  +R  ++S +++ P  + +DL ++++YW D     I+  N D     + + S + L +PFSI  FE+N++WTDW +  +   +K T +     T +  +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C
Sbjct:  342 CLSHEY-QCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQC-GDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCG--GGQCVPLSKVCDKRKDCPDGEDEPAGK----CGINECAS-KNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINECEV-PGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD-----HMEMTSIVNSTKAATALDFVFRTG--MIFWSDVTTQSIYKAPID---EGNEKTVVLTKSSVTSD-------GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWG---ASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMVDGLMC 864          

HSP 2 Score: 62.003 bits (149), Expect = 1.791e-9
Identity = 37/84 (44.05%), Postives = 45/84 (53.57%), Query Frame = 2
Query:  221 ENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN-CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTK 469
            E   SSD   C +    NCI   W CD   DC  G DE+N      C +NEF C +  QCIP+  LCDG+  C DKSDE +C +
Sbjct:  176 EATCSSDQFRCGN---GNCIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHCNQ 256          
BLAST of Low-density lipoprotein receptor vs. Ensembl Zebrafish
Match: ldlrb (low density lipoprotein receptor b [Source:ZFIN;Acc:ZDB-GENE-040426-1254])

HSP 1 Score: 257.299 bits (656), Expect = 5.510e-74
Identity = 179/539 (33.21%), Postives = 266/539 (49.35%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK--LLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYT-VLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C+   W CDG  DC    DE NC    C  +EFLC  G  C+P L  CDG   C D+SDE +CT   +  CD+ S+F C+  GE CI    VCD + +CG   DE     + +C  N+C L  NGGCSH C +     +C CP G++L  ++  C D+DEC      C+Q+C N PGSY+C C +GY  + H +  C    G  + L  L   R  +  L  GS  Y  +     ++V +DVD+ +   T++W   S  K+  +       N         + + D  I +    ++ DW+   ++WT S ++ +    T        L  GL+NPR+I +DP +  ++W D G    S RIE   +N  +R  LV+ N+  P  + +D+  R+LYW D    +++ I +D  N   T+I ++  L +P ++AVFE  +FWTD   + I S +++T    + VL  +  P  I + + + QP     D    + L N   GC  +CLP P  +IN    PKY C CP    L  D  TC
Sbjct:  144 CVPDSWRCDGAFDCSDRSDEDNCTVHTCRPDEFLCADGG-CVPGLRQCDGHPDCGDRSDELDCTP--VSVCDAPSRFKCSS-GE-CISAERVCDGQRDCGDASDE----PIRDCNVNEC-LSSNGGCSHLCVDLRLGFECSCPAGFRLA-NHTHCEDVDEC-VDADACSQMCVNLPGSYKCVCAEGYELD-HMTRDCRAATGPEAFL--LFSTRHEVRKLALGSREYTAVLRQQRNVVALDVDVQR--DTLYWSDLSQRKIYSTTASNPTQN---------RTVIDSWISRP-EGLAVDWVHRNIYWTDSEQRSV-SVATADGSKRKTLIHGLQNPRAIVLDPQSNFMFWSDWGV---SARIERCGLNGADRTALVTDNIVWPNGIALDVLGRRLYWVDSKLHTLSSIGVDG-NGRHTLIHDQQTLPHPLALAVFEEKVFWTDVANHGIWSANRLTGHEISAVLKHLQSPEDIVLYHSLTQPS--GRDWCRESALLN--GGCEFLCLPAP--AIN-THSPKYTCACPDHMTLAEDMRTC 643          

HSP 2 Score: 75.0998 bits (183), Expect = 2.286e-13
Identity = 43/106 (40.57%), Postives = 53/106 (50.00%), Query Frame = 2
Query:  272 NCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
             C+S  W CDG  DCE+G DE NC  K C   EF C SG QC+    +CDG   C D SDE  C  H   +C   + F C+    +C+P    CD   +C    DE
Sbjct:   18 QCVSSRWRCDGKSDCENGADEQNCAQKNCSAEEFRCGSG-QCVSLSFVCDGDSDCSDGSDEAACPTH-THTCGPTA-FQCSSPA-VCVPQLWACDGDPDCADGSDE 119          
BLAST of Low-density lipoprotein receptor vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 249.21 bits (635), Expect = 1.420e-70
Identity = 186/542 (34.32%), Postives = 274/542 (50.55%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN 1894
            CI + W CDG+ DC+ G DE NC  + C  ++F C  G+ CI     C+G   CVD +DE NC    +  C+S  QF C + GE CI +S+VC+K  +C    DE     +  C  N+C LI NGGCSH C +     +C C  G +L  D +TC D++EC  +P  C+QIC N  G Y+C C++GY+ +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I    + +   +  +HK + DD   Q+   ++ DW+   ++W+    K I V N       VL N GL+ P SIAVDP++  +YW D G      +IE   MN ++R+VLV  +++ P  + +DL + +LYW D     +  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS +CLP P   IN +  PKY C+CP+   L  D L C  A+
Sbjct:  247 CIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNC--KNLTQCNSSDQFKC-RSGE-CIEMSKVCNKVRDCPDWSDE----PIKECNMNEC-LINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNEC-LNPGICSQICINLKGGYKCECHNGYQMDPTTG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFIQ--QMIFW-----ADLGQKAI---FSTVLDKQDESHKKVIDDV--QMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQLS-----GTNWCNEKMENGGCSFMCLPAP--QINKHS-PKYTCVCPEGQTLASDGLRCRAAS 749          

HSP 2 Score: 75.8702 bits (185), Expect = 1.284e-13
Identity = 43/105 (40.95%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG+ DC  G DE++C  K C + +F+C SG QCIPK   CDG   C D SDE     H  ++C  +++F C      CIP+   CD + +C   +DE
Sbjct:   41 CIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSG-QCIPKRWQCDGEPDCEDGSDESIEMCH-TRTC-RVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE 142          

HSP 3 Score: 58.5362 bits (140), Expect = 2.725e-8
Identity = 37/95 (38.95%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPIS 544
            + +  CI   W CDG +DC++G+DE NC    C   EF C SG +C+ +  +C+G   C D SDE++C      SC S S+  C  +   CIP S
Sbjct:  118 VGSTQCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTCSSG-RCVSRKFVCNGEDDCGDGSDEQDCAP---SSC-SPSEIPCGNN--TCIPRS 205          
BLAST of Low-density lipoprotein receptor vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 248.825 bits (634), Expect = 1.606e-70
Identity = 189/552 (34.24%), Postives = 277/552 (50.18%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIH 1924
            CI + W CDG+ DC+ G DE NC  + C  ++F C  G+ CI     C+G   CVD +DE NC    +  C+S  QF C + GE CI +S+VC+K  +C    DE     +  C  N+C LI NGGCSH C +     +C C  G +L  D +TC D++EC  +P  C+QIC N  G Y+C C++GY+ +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I    + +   +  +HK + DD   Q+   ++ DW+   ++W+    K I V N       VL N GL+ P SIAVDP++  +YW D G      +IE   MN ++R+VLV  +++ P  + +DL + +LYW D     +  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS +CLP P   IN +  PKY C+CP+   L  D L C    +     TSIH
Sbjct:  247 CIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNC--KNLTQCNSSDQFKC-RSGE-CIEMSKVCNKVRDCPDWSDE----PIKECNMNEC-LINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNEC-LNPGICSQICINLKGGYKCECHNGYQMDPTTG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFIQ--QMIFW-----ADLGQKAI---FSTVLDKQDESHKKVIDDV--QMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQLS-----GTNWCNEKMENGGCSFMCLPAP--QINKHS-PKYTCVCPEGQTLASDGLRCRAEGNLS---TSIH 756          

HSP 2 Score: 75.485 bits (184), Expect = 1.434e-13
Identity = 43/105 (40.95%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG+ DC  G DE++C  K C + +F+C SG QCIPK   CDG   C D SDE     H  ++C  +++F C      CIP+   CD + +C   +DE
Sbjct:   41 CIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSG-QCIPKRWQCDGEPDCEDGSDESIEMCH-TRTC-RVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE 142          

HSP 3 Score: 58.5362 bits (140), Expect = 2.900e-8
Identity = 37/95 (38.95%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPIS 544
            + +  CI   W CDG +DC++G+DE NC    C   EF C SG +C+ +  +C+G   C D SDE++C      SC S S+  C  +   CIP S
Sbjct:  118 VGSTQCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTCSSG-RCVSRKFVCNGEDDCGDGSDEQDCAP---SSC-SPSEIPCGNN--TCIPRS 205          
BLAST of Low-density lipoprotein receptor vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 248.825 bits (634), Expect = 1.685e-70
Identity = 189/552 (34.24%), Postives = 277/552 (50.18%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIH 1924
            CI + W CDG+ DC+ G DE NC  + C  ++F C  G+ CI     C+G   CVD +DE NC    +  C+S  QF C + GE CI +S+VC+K  +C    DE     +  C  N+C LI NGGCSH C +     +C C  G +L  D +TC D++EC  +P  C+QIC N  G Y+C C++GY+ +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I    + +   +  +HK + DD   Q+   ++ DW+   ++W+    K I V N       VL N GL+ P SIAVDP++  +YW D G      +IE   MN ++R+VLV  +++ P  + +DL + +LYW D     +  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS +CLP P   IN +  PKY C+CP+   L  D L C    +     TSIH
Sbjct:  247 CIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNC--KNLTQCNSSDQFKC-RSGE-CIEMSKVCNKVRDCPDWSDE----PIKECNMNEC-LINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNEC-LNPGICSQICINLKGGYKCECHNGYQMDPTTG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFIQ--QMIFW-----ADLGQKAI---FSTVLDKQDESHKKVIDDV--QMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQLS-----GTNWCNEKMENGGCSFMCLPAP--QINKHS-PKYTCVCPEGQTLASDGLRCRAEGNLS---TSIH 756          

HSP 2 Score: 75.485 bits (184), Expect = 1.436e-13
Identity = 43/105 (40.95%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG+ DC  G DE++C  K C + +F+C SG QCIPK   CDG   C D SDE     H  ++C  +++F C      CIP+   CD + +C   +DE
Sbjct:   41 CIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSG-QCIPKRWQCDGEPDCEDGSDESIEMCH-TRTC-RVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE 142          

HSP 3 Score: 58.5362 bits (140), Expect = 2.829e-8
Identity = 37/95 (38.95%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPIS 544
            + +  CI   W CDG +DC++G+DE NC    C   EF C SG +C+ +  +C+G   C D SDE++C      SC S S+  C  +   CIP S
Sbjct:  118 VGSTQCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTCSSG-RCVSRKFVCNGEDDCGDGSDEQDCAP---SSC-SPSEIPCGNN--TCIPRS 205          
BLAST of Low-density lipoprotein receptor vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 248.054 bits (632), Expect = 4.467e-70
Identity = 185/539 (34.32%), Postives = 272/539 (50.46%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            CI + W CDG+ DC+ G DE NC  + C  ++F C  G+ CI     C+G   CVD +DE NC    +  C+S  QF C + GE CI +S+VC+K  +C    DE     +  C  N+C LI NGGCSH C +     +C C  G +L  D +TC D++EC  +P  C+QIC N  G Y+C C++GY+ +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I    + +   +  +HK + DD   Q+   ++ DW+   ++W+    K I V N       VL N GL+ P SIAVDP++  +YW D G      +IE   MN ++R+VLV  +++ P  + +DL + +LYW D     +  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS +CLP P   IN +  PKY C+CP+   L  D L C 
Sbjct:  247 CIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNC--KNLTQCNSSDQFKC-RSGE-CIEMSKVCNKVRDCPDWSDE----PIKECNMNEC-LINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNEC-LNPGICSQICINLKGGYKCECHNGYQMDPTTG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFIQ--QMIFW-----ADLGQKAI---FSTVLDKQDESHKKVIDDV--QMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQLS-----GTNWCNEKMENGGCSFMCLPAP--QINKHS-PKYTCVCPEGQTLASDGLRCR 746          

HSP 2 Score: 75.8702 bits (185), Expect = 1.146e-13
Identity = 43/105 (40.95%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG+ DC  G DE++C  K C + +F+C SG QCIPK   CDG   C D SDE     H  ++C  +++F C      CIP+   CD + +C   +DE
Sbjct:   41 CIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSG-QCIPKRWQCDGEPDCEDGSDESIEMCH-TRTC-RVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE 142          

HSP 3 Score: 58.9214 bits (141), Expect = 2.191e-8
Identity = 37/95 (38.95%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPIS 544
            + +  CI   W CDG +DC++G+DE NC    C   EF C SG +C+ +  +C+G   C D SDE++C      SC S S+  C  +   CIP S
Sbjct:  118 VGSTQCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTCSSG-RCVSRKFVCNGEDDCGDGSDEQDCAP---SSC-SPSEIPCGNN--TCIPRS 205          
BLAST of Low-density lipoprotein receptor vs. Ensembl Xenopus
Match: LRP8 (LDL receptor related protein 8 [Source:NCBI gene;Acc:100489827])

HSP 1 Score: 256.914 bits (655), Expect = 2.484e-73
Identity = 182/565 (32.21%), Postives = 282/565 (49.91%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKII 1945
            N  NCI  +W CDG++DC+   DE +C    C  +EF C  G+ C+  +  C+G   C+D SDE  C  H    C+   +F C K GE CI  ++VCD   +C    DE    S+  C  N+C ++ NGGCSH C +     +C CP+GYKL  D +TC DIDEC  +P  C+QIC N  G ++C CY+GY  +   S+ C    G    LI  N  R  +  ++     Y  L    +++V++DV++  + + ++W      ++  + +D   +  E    +N    S +        ++ DW+   ++WT S  K I V          L   GL  PR+IAVDP+   ++W D G      +IE   +N  +R+VLVS N+  P  + +D+   +LYW D    +++ ++ +  N    I S + L +PF +AVFE+ IFWTD     I S +++T    ++LA  +  P  I V++++ QPK        +AC +  +   GC ++CLP P  S +    PKY C CP    L  D  +C       +K+T   SK L  +
Sbjct:  150 NNGNCILLNWRCDGDEDCKDKSDEMDCHLATCRPDEFQCGDGS-CVHGMKQCNGVRDCLDSSDEAGCQTH--SPCEGDGRFQC-KSGE-CIDSTKVCDGNRDCRDWSDE----SLTACDINEC-MVNNGGCSHICRDLKVGYECDCPVGYKLM-DKKTCGDIDECE-NPDACSQICVNYKGDFKCECYEGYEMDSV-SKTC-KAVGQNPYLIFTN--RHELRQIDIVHRDYSRLAAQLKNVVSLDVEV--TSRMIYWCDLYYRRIYSAPLDRAADPSEHVVIINTTLHSPE-------GLAIDWIHKNIYWTDSGNKTISVATADGCKRKTLFRNGLGEPRAIAVDPVQGFMFWSDWG---DPAKIEKAGLNGGDRQVLVSDNIEWPNGITLDVLGCRLYWVDSKLHTLSSVDFNGFNRKLLISSEDSLSHPFGLAVFEDKIFWTDLENEAIFSANRLTGHEISILADNLNNPHDIVVVHQLKQPK------AVNACNQGSLPNGGCEYLCLPAPQISAH---SPKYTCACPDGIALGPDMRSC-------EKVTVATSKPLADV 670          
BLAST of Low-density lipoprotein receptor vs. Ensembl Xenopus
Match: LRP8 (LDL receptor related protein 8 [Source:NCBI gene;Acc:100489827])

HSP 1 Score: 256.144 bits (653), Expect = 2.223e-72
Identity = 182/565 (32.21%), Postives = 282/565 (49.91%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKII 1945
            N  NCI  +W CDG++DC+   DE +C    C  +EF C  G+ C+  +  C+G   C+D SDE  C  H    C+   +F C K GE CI  ++VCD   +C    DE    S+  C  N+C ++ NGGCSH C +     +C CP+GYKL  D +TC DIDEC  +P  C+QIC N  G ++C CY+GY  +   S+ C    G    LI  N  R  +  ++     Y  L    +++V++DV++  + + ++W      ++  + +D   +  E    +N    S +        ++ DW+   ++WT S  K I V          L   GL  PR+IAVDP+   ++W D G      +IE   +N  +R+VLVS N+  P  + +D+   +LYW D    +++ ++ +  N    I S + L +PF +AVFE+ IFWTD     I S +++T    ++LA  +  P  I V++++ QPK        +AC +  +   GC ++CLP P  S +    PKY C CP    L  D  +C       +K+T   SK L  +
Sbjct:  242 NNGNCILLNWRCDGDEDCKDKSDEMDCHLATCRPDEFQCGDGS-CVHGMKQCNGVRDCLDSSDEAGCQTH--SPCEGDGRFQC-KSGE-CIDSTKVCDGNRDCRDWSDE----SLTACDINEC-MVNNGGCSHICRDLKVGYECDCPVGYKLM-DKKTCGDIDECE-NPDACSQICVNYKGDFKCECYEGYEMDSV-SKTC-KAVGQNPYLIFTN--RHELRQIDIVHRDYSRLAAQLKNVVSLDVEV--TSRMIYWCDLYYRRIYSAPLDRAADPSEHVVIINTTLHSPE-------GLAIDWIHKNIYWTDSGNKTISVATADGCKRKTLFRNGLGEPRAIAVDPVQGFMFWSDWG---DPAKIEKAGLNGGDRQVLVSDNIEWPNGITLDVLGCRLYWVDSKLHTLSSVDFNGFNRKLLISSEDSLSHPFGLAVFEDKIFWTDLENEAIFSANRLTGHEISILADNLNNPHDIVVVHQLKQPK------AVNACNQGSLPNGGCEYLCLPAPQISAH---SPKYTCACPDGIALGPDMRSC-------EKVTVATSKPLADV 762          

HSP 2 Score: 71.633 bits (174), Expect = 3.318e-12
Identity = 40/106 (37.74%), Postives = 53/106 (50.00%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI   W CD + DC    DE +CP   C ++EF C+SG  CI     CDG   C DKSDE   T  ++    +  +F C      CIP+S  CD + +C    DE+
Sbjct:   40 CIPSVWRCDEDDDCADNSDEDDCPKTTCGEDEFTCNSG-HCISARWKCDGEEECPDKSDESEATSKQVC---AAQKFSCGGPSNKCIPVSWRCDGERDCENGLDEK 141          

HSP 3 Score: 63.1586 bits (152), Expect = 1.743e-9
Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG +DCE+G DE +CP   C   EF C++ T C+  + +CDG  +C D SDER C     K      +F C  +   CI    +CD + +C    DE
Sbjct:  121 CIPVSWRCDGERDCENGLDEKDCPTS-CTPGEFQCNNKT-CLASVFVCDGVNNCGDGSDERGCLPITCKP----GEFRCGNNE--CILEKWLCDGQPDCDDQSDE 217          

HSP 4 Score: 59.6918 bits (143), Expect = 1.823e-8
Identity = 42/111 (37.84%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPK-VCLDNEFLCHSGT-QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            N+ +CIS  W CDG ++C    DES    K VC   +F C   + +CIP    CDG   C +  DE++C      SC +  +F CN   + C+    VCD  NNCG   DE
Sbjct:   75 NSGHCISARWKCDGEEECPDKSDESEATSKQVCAAQKFSCGGPSNKCIPVSWRCDGERDCENGLDEKDCP----TSC-TPGEFQCNN--KTCLASVFVCDGVNNCGDGSDE 178          
BLAST of Low-density lipoprotein receptor vs. Ensembl Xenopus
Match: LRP8 (LDL receptor related protein 8 [Source:NCBI gene;Acc:100489827])

HSP 1 Score: 253.447 bits (646), Expect = 1.017e-71
Identity = 181/565 (32.04%), Postives = 281/565 (49.73%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKII 1945
            N  NCI  +W CDG++DC+   DE +C    C  +EF C  G+ C+  +  C+G   C+D SDE  C       C+   +F C K GE CI  ++VCD   +C    DE    S+  C  N+C ++ NGGCSH C +     +C CP+GYKL  D +TC DIDEC  +P  C+QIC N  G ++C CY+GY  +   S+ C    G    LI  N  R  +  ++     Y  L    +++V++DV++  + + ++W      ++  + +D   +  E    +N    S +        ++ DW+   ++WT S  K I V          L   GL  PR+IAVDP+   ++W D G      +IE   +N  +R+VLVS N+  P  + +D+   +LYW D    +++ ++ +  N    I S + L +PF +AVFE+ IFWTD     I S +++T    ++LA  +  P  I V++++ QPK        +AC +  +   GC ++CLP P  S +    PKY C CP    L  D  +C       +K+T   SK L  +
Sbjct:  208 NNGNCILLNWRCDGDEDCKDKSDEMDCHLATCRPDEFQCGDGS-CVHGMKQCNGVRDCLDSSDEAGCQSAH-SPCEGDGRFQC-KSGE-CIDSTKVCDGNRDCRDWSDE----SLTACDINEC-MVNNGGCSHICRDLKVGYECDCPVGYKLM-DKKTCGDIDECE-NPDACSQICVNYKGDFKCECYEGYEMDSV-SKTC-KAVGQNPYLIFTN--RHELRQIDIVHRDYSRLAAQLKNVVSLDVEV--TSRMIYWCDLYYRRIYSAPLDRAADPSEHVVIINTTLHSPE-------GLAIDWIHKNIYWTDSGNKTISVATADGCKRKTLFRNGLGEPRAIAVDPVQGFMFWSDWG---DPAKIEKAGLNGGDRQVLVSDNIEWPNGITLDVLGCRLYWVDSKLHTLSSVDFNGFNRKLLISSEDSLSHPFGLAVFEDKIFWTDLENEAIFSANRLTGHEISILADNLNNPHDIVVVHQLKQPK------AVNACNQGSLPNGGCEYLCLPAPQISAH---SPKYTCACPDGIALGPDMRSC-------EKVTVATSKPLADV 729          

HSP 2 Score: 62.7734 bits (151), Expect = 2.106e-9
Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG +DCE+G DE +CP   C   EF C++ T C+  + +CDG  +C D SDER C     K      +F C  +   CI    +CD + +C    DE
Sbjct:   87 CIPVSWRCDGERDCENGLDEKDCPTS-CTPGEFQCNNKT-CLASVFVCDGVNNCGDGSDERGCLPITCKP----GEFRCGNNE--CILEKWLCDGQPDCDDQSDE 183          

HSP 3 Score: 57.3806 bits (137), Expect = 9.835e-8
Identity = 41/114 (35.96%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNC----PPKVCLDNEFLCHSGT-QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            N+ +CIS  W CDG ++C    DES        +VC   +F C   + +CIP    CDG   C +  DE++C      SC +  +F CN   + C+    VCD  NNCG   DE
Sbjct:   38 NSGHCISARWKCDGEEECPDKSDESEATCSSAKQVCAAQKFSCGGPSNKCIPVSWRCDGERDCENGLDEKDCP----TSC-TPGEFQCNN--KTCLASVFVCDGVNNCGDGSDE 144          

HSP 4 Score: 51.9878 bits (123), Expect = 4.655e-6
Identity = 30/80 (37.50%), Postives = 39/80 (48.75%), Query Frame = 2
Query:  353 VCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
             C ++EF C+SG  CI     CDG   C DKSDE   T    K   +  +F C      CIP+S  CD + +C    DE+
Sbjct:   29 TCGEDEFTCNSG-HCISARWKCDGEEECPDKSDESEATCSSAKQVCAAQKFSCGGPSNKCIPVSWRCDGERDCENGLDEK 107          
BLAST of Low-density lipoprotein receptor vs. Ensembl Xenopus
Match: LRP8 (LDL receptor related protein 8 [Source:NCBI gene;Acc:100489827])

HSP 1 Score: 253.062 bits (645), Expect = 1.841e-71
Identity = 181/565 (32.04%), Postives = 281/565 (49.73%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKII 1945
            N  NCI  +W CDG++DC+   DE +C    C  +EF C  G+ C+  +  C+G   C+D SDE  C       C+   +F C K GE CI  ++VCD   +C    DE    S+  C  N+C ++ NGGCSH C +     +C CP+GYKL  D +TC DIDEC  +P  C+QIC N  G ++C CY+GY  +   S+ C    G    LI  N  R  +  ++     Y  L    +++V++DV++  + + ++W      ++  + +D   +  E    +N    S +        ++ DW+   ++WT S  K I V          L   GL  PR+IAVDP+   ++W D G      +IE   +N  +R+VLVS N+  P  + +D+   +LYW D    +++ ++ +  N    I S + L +PF +AVFE+ IFWTD     I S +++T    ++LA  +  P  I V++++ QPK        +AC +  +   GC ++CLP P  S +    PKY C CP    L  D  +C       +K+T   SK L  +
Sbjct:  249 NNGNCILLNWRCDGDEDCKDKSDEMDCHLATCRPDEFQCGDGS-CVHGMKQCNGVRDCLDSSDEAGCQSAH-SPCEGDGRFQC-KSGE-CIDSTKVCDGNRDCRDWSDE----SLTACDINEC-MVNNGGCSHICRDLKVGYECDCPVGYKLM-DKKTCGDIDECE-NPDACSQICVNYKGDFKCECYEGYEMDSV-SKTC-KAVGQNPYLIFTN--RHELRQIDIVHRDYSRLAAQLKNVVSLDVEV--TSRMIYWCDLYYRRIYSAPLDRAADPSEHVVIINTTLHSPEG-------LAIDWIHKNIYWTDSGNKTISVATADGCKRKTLFRNGLGEPRAIAVDPVQGFMFWSDWG---DPAKIEKAGLNGGDRQVLVSDNIEWPNGITLDVLGCRLYWVDSKLHTLSSVDFNGFNRKLLISSEDSLSHPFGLAVFEDKIFWTDLENEAIFSANRLTGHEISILADNLNNPHDIVVVHQLKQPK------AVNACNQGSLPNGGCEYLCLPAPQISAH---SPKYTCACPDGIALGPDMRSC-------EKVTVATSKPLADV 770          

HSP 2 Score: 73.559 bits (179), Expect = 9.264e-13
Identity = 41/106 (38.68%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI   W CD + DC    DE +CP   C ++EF C+SG  CI     CDG   C DKSDE   T    K   +  +F C      CIP+S  CD + +C    DE+
Sbjct:   44 CIPSVWRCDEDDDCADNSDEDDCPKTTCGEDEFTCNSG-HCISARWKCDGEEECPDKSDESEATCSSAKQVCAAQKFSCGGPSNKCIPVSWRCDGERDCENGLDEK 148          

HSP 3 Score: 62.3882 bits (150), Expect = 2.697e-9
Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG +DCE+G DE +CP   C   EF C++ T C+  + +CDG  +C D SDER C     K      +F C  +   CI    +CD + +C    DE
Sbjct:  128 CIPVSWRCDGERDCENGLDEKDCPTS-CTPGEFQCNNKT-CLASVFVCDGVNNCGDGSDERGCLPITCKP----GEFRCGNNE--CILEKWLCDGQPDCDDQSDE 224          

HSP 4 Score: 56.9954 bits (136), Expect = 1.246e-7
Identity = 41/114 (35.96%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNC----PPKVCLDNEFLCHSGT-QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            N+ +CIS  W CDG ++C    DES        +VC   +F C   + +CIP    CDG   C +  DE++C      SC +  +F CN   + C+    VCD  NNCG   DE
Sbjct:   79 NSGHCISARWKCDGEEECPDKSDESEATCSSAKQVCAAQKFSCGGPSNKCIPVSWRCDGERDCENGLDEKDCP----TSC-TPGEFQCNN--KTCLASVFVCDGVNNCGDGSDE 185          
BLAST of Low-density lipoprotein receptor vs. Ensembl Xenopus
Match: LRP8 (LDL receptor related protein 8 [Source:NCBI gene;Acc:100489827])

HSP 1 Score: 251.521 bits (641), Expect = 3.733e-71
Identity = 176/540 (32.59%), Postives = 272/540 (50.37%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGD 1870
            N  NCI  +W CDG++DC+   DE +C    C  +EF C  G+ C+  +  C+G   C+D SDE  C  H    C+   +F C K GE CI  ++VCD   +C    DE    S+  C  N+C ++ NGGCSH C +     +C CP+GYKL  D +TC DIDEC  +P  C+QIC N  G ++C CY+GY  +   S+ C    G    LI  N  R  +  ++     Y  L    +++V++DV++  + + ++W      ++  + +D   +  E    +N    S +        ++ DW+   ++WT S  K I V          L   GL  PR+IAVDP+   ++W D G      +IE   +N  +R+VLVS N+  P  + +D+   +LYW D    +++ ++ +  N    I S + L +PF +AVFE+ IFWTD     I S +++T    ++LA  +  P  I V++++ QPK        +AC +  +   GC ++CLP P  S +    PKY C CP    L  D
Sbjct:  259 NNGNCILLNWRCDGDEDCKDKSDEMDCHLATCRPDEFQCGDGS-CVHGMKQCNGVRDCLDSSDEAGCQTH--SPCEGDGRFQC-KSGE-CIDSTKVCDGNRDCRDWSDE----SLTACDINEC-MVNNGGCSHICRDLKVGYECDCPVGYKLM-DKKTCGDIDECE-NPDACSQICVNYKGDFKCECYEGYEMDSV-SKTC-KAVGQNPYLIFTN--RHELRQIDIVHRDYSRLAAQLKNVVSLDVEV--TSRMIYWCDLYYRRIYSAPLDRAADPSEHVVIINTTLHSPEG-------LAIDWIHKNIYWTDSGNKTISVATADGCKRKTLFRNGLGEPRAIAVDPVQGFMFWSDWG---DPAKIEKAGLNGGDRQVLVSDNIEWPNGITLDVLGCRLYWVDSKLHTLSSVDFNGFNRKLLISSEDSLSHPFGLAVFEDKIFWTDLENEAIFSANRLTGHEISILADNLNNPHDIVVVHQLKQPK------AVNACNQGSLPNGGCEYLCLPAPQISAH---SPKYTCACPDGIALGPD 761          

HSP 2 Score: 68.1662 bits (165), Expect = 4.735e-11
Identity = 41/106 (38.68%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI   W CD + DC    DE +CP   C ++EF C+SG  CI     CDG   C DKSDE   T    K  +   +F C      CIP+S  CD + +C    DE+
Sbjct:   57 CIPSVWRCDEDDDCADNSDEDDCPKTTCGEDEFTCNSG-HCISARWKCDGEEECPDKSDESEATCSSGKCSE---KFSCGGPSNKCIPVSWRCDGERDCENGLDEK 158          

HSP 3 Score: 62.003 bits (149), Expect = 3.647e-9
Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG +DCE+G DE +CP   C   EF C++ T C+  + +CDG  +C D SDER C     K      +F C  +   CI    +CD + +C    DE
Sbjct:  138 CIPVSWRCDGERDCENGLDEKDCPTS-CTPGEFQCNNKT-CLASVFVCDGVNNCGDGSDERGCLPITCKP----GEFRCGNNE--CILEKWLCDGQPDCDDQSDE 234          

HSP 4 Score: 53.5286 bits (127), Expect = 1.581e-6
Identity = 39/111 (35.14%), Postives = 52/111 (46.85%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            N+ +CIS  W CDG ++C    DES   C    C +         +CIP    CDG   C +  DE++C      SC +  +F CN   + C+    VCD  NNCG   DE
Sbjct:   92 NSGHCISARWKCDGEEECPDKSDESEATCSSGKCSEKFSCGGPSNKCIPVSWRCDGERDCENGLDEKDCP----TSC-TPGEFQCNN--KTCLASVFVCDGVNNCGDGSDE 195          
BLAST of Low-density lipoprotein receptor vs. Ensembl Mouse
Match: Lrp8 (low density lipoprotein receptor-related protein 8, apolipoprotein e receptor [Source:MGI Symbol;Acc:MGI:1340044])

HSP 1 Score: 249.98 bits (637), Expect = 8.214e-71
Identity = 178/553 (32.19%), Postives = 272/553 (49.19%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCP---PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHES-DVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKIT 1915
            C+   W CDG +DCE G DE+ CP   P  C +NEF C  GT C+  +  C+    C D SDE  C +    +C+   +F C K GE C+   +VCD + +C R+  +EP      C  N+C L  NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C C+ GY  +   ++ C    G    LI  N      IDL      Y  L    +++V +DV++  +   ++W   S  K+  + +D      E+   ++ +  S +        ++ DW+   ++WT S  K I V  T       L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+ +  N    I S   L +PF +AVFE+ +FWTD     I S +++      +LA+ +  P  I + +++ QPK  ++ D+++         GC ++CLP P  S   +  PKY C CP    L  D   C+ A       T
Sbjct:  135 CVPASWRCDGEKDCEGGADEAGCPTSAPGPCRENEFQCGDGT-CVLAIKRCNQERDCPDGSDEAGCLQE--STCEGPRRFQC-KSGE-CVDGGKVCDDQRDC-RDWSDEPQKV---CGLNEC-LHNNGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECQ-DPDACSQICVNYKGYFKCECHPGYEMDTL-TKNCKAVAGKSPSLIFTNRHEVRRIDLV--KRDYSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQA---KIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLSAQP-----NGGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTT 652          
BLAST of Low-density lipoprotein receptor vs. Ensembl Mouse
Match: Lrp8 (low density lipoprotein receptor-related protein 8, apolipoprotein e receptor [Source:MGI Symbol;Acc:MGI:1340044])

HSP 1 Score: 246.899 bits (629), Expect = 4.475e-69
Identity = 176/550 (32.00%), Postives = 272/550 (49.45%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHES-DVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKIT 1915
            CI   W CDG++DC+   DE++C P  C +NEF C  GT C+  +  C+    C D SDE  C +    +C+   +F C K GE C+   +VCD + +C R+  +EP      C  N+C L  NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C C+ GY  +   ++ C    G    LI  N      IDL      Y  L    +++V +DV++  +   ++W   S  K+  + +D      E+   ++ +  S +        ++ DW+   ++WT S  K I V  T       L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+ +  N    I S   L +PF +AVFE+ +FWTD     I S +++      +LA+ +  P  I + +++ QPK  ++ D+++         GC ++CLP P  S   +  PKY C CP    L  D   C+ A       T
Sbjct:  264 CIHLGWRCDGDRDCKDKSDEADCSPGPCRENEFQCGDGT-CVLAIKRCNQERDCPDGSDEAGCLQE--STCEGPRRFQC-KSGE-CVDGGKVCDDQRDC-RDWSDEPQKV---CGLNEC-LHNNGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECQ-DPDACSQICVNYKGYFKCECHPGYEMDTL-TKNCKAVAGKSPSLIFTNRHEVRRIDLV--KRDYSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQA---KIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLSAQP-----NGGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTT 778          

HSP 2 Score: 66.6254 bits (161), Expect = 9.656e-11
Identity = 38/107 (35.51%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CD + DC    DE +CP + C D++F C +G  CIP+   CDG   C D SDE    C+  E  +     +  C      C+P S  CD + +C    DE
Sbjct:   53 CIPLVWRCDEDNDCSDNSDEDDCPKRTCADSDFTCDNG-HCIPERWKCDGEEECPDGSDESKATCSSEECPA----EKLSCGPTSHKCVPASWRCDGEKDCEGGADE 154          
BLAST of Low-density lipoprotein receptor vs. Ensembl Mouse
Match: Lrp8 (low density lipoprotein receptor-related protein 8, apolipoprotein e receptor [Source:MGI Symbol;Acc:MGI:1340044])

HSP 1 Score: 246.899 bits (629), Expect = 4.475e-69
Identity = 176/550 (32.00%), Postives = 272/550 (49.45%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHES-DVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKIT 1915
            CI   W CDG++DC+   DE++C P  C +NEF C  GT C+  +  C+    C D SDE  C +    +C+   +F C K GE C+   +VCD + +C R+  +EP      C  N+C L  NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C C+ GY  +   ++ C    G    LI  N      IDL      Y  L    +++V +DV++  +   ++W   S  K+  + +D      E+   ++ +  S +        ++ DW+   ++WT S  K I V  T       L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+ +  N    I S   L +PF +AVFE+ +FWTD     I S +++      +LA+ +  P  I + +++ QPK  ++ D+++         GC ++CLP P  S   +  PKY C CP    L  D   C+ A       T
Sbjct:  264 CIHLGWRCDGDRDCKDKSDEADCSPGPCRENEFQCGDGT-CVLAIKRCNQERDCPDGSDEAGCLQE--STCEGPRRFQC-KSGE-CVDGGKVCDDQRDC-RDWSDEPQKV---CGLNEC-LHNNGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECQ-DPDACSQICVNYKGYFKCECHPGYEMDTL-TKNCKAVAGKSPSLIFTNRHEVRRIDLV--KRDYSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQA---KIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLSAQP-----NGGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTT 778          

HSP 2 Score: 66.6254 bits (161), Expect = 9.656e-11
Identity = 38/107 (35.51%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CD + DC    DE +CP + C D++F C +G  CIP+   CDG   C D SDE    C+  E  +     +  C      C+P S  CD + +C    DE
Sbjct:   53 CIPLVWRCDEDNDCSDNSDEDDCPKRTCADSDFTCDNG-HCIPERWKCDGEEECPDGSDESKATCSSEECPA----EKLSCGPTSHKCVPASWRCDGEKDCEGGADE 154          
BLAST of Low-density lipoprotein receptor vs. Ensembl Mouse
Match: Lrp8 (low density lipoprotein receptor-related protein 8, apolipoprotein e receptor [Source:MGI Symbol;Acc:MGI:1340044])

HSP 1 Score: 241.506 bits (615), Expect = 3.092e-68
Identity = 171/553 (30.92%), Postives = 263/553 (47.56%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNS-VDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHES-DVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKIT 1915
            CI   W CD + DC    DE +CP + C D++F C +G  CIP+   CDG   C D SDE    C+  E  +     +  C      C+P S  CD + +C    DE    + ++ C  N      NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C C+ GY  +   ++ C    G    LI  N      IDL      Y  L    +++V +DV++  +   ++W   S  K+  + +D      E+   ++ +  S +        ++ DW+   ++WT S  K I V  T       L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+ +  N    I S   L +PF +AVFE+ +FWTD     I S +++      +LA+ +  P  I + +++ QPK  ++ D+++         GC ++CLP P  S   +  PKY C CP    L  D   C+ A       T
Sbjct:   53 CIPLVWRCDEDNDCSDNSDEDDCPKRTCADSDFTCDNG-HCIPERWKCDGEEECPDGSDESKATCSSEECPA----EKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTWLNECLHN------NGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECQ-DPDACSQICVNYKGYFKCECHPGYEMDTL-TKNCKAVAGKSPSLIFTNRHEVRRIDLV--KRDYSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQA---KIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLSAQP-----NGGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTT 569          
BLAST of Low-density lipoprotein receptor vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 237.269 bits (604), Expect = 1.217e-66
Identity = 172/545 (31.56%), Postives = 268/545 (49.17%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIH---ESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN 1894
            CI K W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   CVD SDE NC    +  C    +F C + GE CI +S+VCD++ +C R+  +EP   +  C  N+C L+ NGGCSH C +     +C C  G++L  D +TC DIDEC  +P  C+QIC N  G Y+C C  GY+ +      C     + S++ T    R+ +  +      Y  L     + V +D D+  + Q +FW   S   +  + ID KV          H  + D+        ++ DW+   ++WT +  K I V          L N  L  P SIAVDP++  VYW D G      +IE   MN  +RR LV+++++ P  + +DL + +LYW D     ++ ++L+  +    + S + L +P ++ +FE+ ++W D     +   +K T S+  T++  +     I V ++++QP      E D+ +         GC ++CLP P   IN +  PKY C CP    L+ +   C   N
Sbjct:  210 CIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNC--KNVNQCLGPGKFKC-RSGE-CIDMSKVCDQEQDC-RDWSDEP---LKECHINEC-LVNNGGCSHICKDLVIGYECDCAAGFEL-IDRKTCGDIDECQ-NPGICSQICINLKGGYKCECSRGYQMDLATG-VCKAVGKEPSLIFT---NRRDIRKIGLERKEYIQLVEQLRNTVALDADI--AAQKLFWADLSQKAIFSASIDDKVG--------RHFKMIDNVYNP--AAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWG---EPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEDDMEN--------GGCEYLCLPAP--QIN-DHSPKYTCSCPNGYNLEENGRECQRIN 712          

HSP 2 Score: 63.929 bits (154), Expect = 6.104e-10
Identity = 39/105 (37.14%), Postives = 56/105 (53.33%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI+  W CDG++DC  G DE NC  K C +++F+C +G QC+P    CDG   C D SDE       I    S  +F C+     C+  + VC+ +++C    DE
Sbjct:   45 CITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNG-QCVPNRWQCDGDPDCEDGSDESPEQCRNITC--SADEFTCSSG--RCVSRNFVCNGQDDCDDGSDE 144          
BLAST of Low-density lipoprotein receptor vs. UniProt/SwissProt
Match: sp|Q98931|LRP8_CHICK (Low-density lipoprotein receptor-related protein 8 OS=Gallus gallus OX=9031 GN=LRP8 PE=1 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.960e-70
Identity = 184/539 (34.14%), Postives = 270/539 (50.09%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            CI  +W CDG++DC+   DE +CP   C  +EF C  GT CI     CD    C D SDE  C +    +C+S S+F C K GE CI   +VCD   +C R+  +EP   +  C  N+C L  NGGCSH C +     +C CP GYKL  D +TC DIDEC  +P  C+QIC N  G Y+C CY+GY  +  +        G    LI  N      IDL      Y  +    +++V +DV++  +   ++W      K+  + ID   +  E+   ++ +  S + +       + DW+   ++WT S  K I V     +    + N  L  PR+IAVDP    +YW D G K    +IE   +N   R+VLVS N+  P  + +DL  ++LYW D    S++ I+ +  N    I S + L +PF +AVFE+ +FWTD     I S ++++    +VLA+ +  P  I V +++ QPK  +S   S         GC ++CLP P   I+P   PK+ C CP +  L  D   C+
Sbjct:  246 CILLNWKCDGDEDCKDKSDEQDCPLVTCRPDEFQCGDGT-CIHGAKQCDKVHDCPDNSDEAGCVQE--SACESPSKFQC-KSGE-CIDGGKVCDLHRDC-RDWSDEP---LKECGINECSL-NNGGCSHICKDLKIGYECECPPGYKLL-DKKTCGDIDECE-NPDACSQICINYKGDYKCECYEGYEMDTLSKN--CKAVGKSPYLIFTNRHEVRKIDLV--KRDYSRIIPMLKNVVALDVEV--ATNRIYWCDLFYRKIYSAYIDKASDTAEQVILIDSQLNSPEGV-------AIDWVHKNIYWTDSGNKTISVATADGSRRRTVFNSDLSEPRAIAVDPTRRFMYWSDWGDKA---KIEKAGLNGVGRQVLVSDNIEWPNGITLDLLNQRLYWVDSKLHSLSCIDFNGSNREVLISSIDDLSHPFGLAVFEDRVFWTDLENEAIFSANRLSGLDISVLAENLNNPHDIVVFHELKQPKAPDSCELS----PQPNGGCEYLCLPAP--HISP-RSPKFTCACPDNMWLGPDMKKCY 749          

HSP 2 Score: 64.6994 bits (156), Expect = 2.726e-9
Identity = 40/107 (37.38%), Postives = 50/107 (46.73%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERN--CTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CD + DC    DE++CP K C + +F C +G  CIP    CDG   C D SDE    CTK    +     +  C      CIP S  CD + +C    DE
Sbjct:   41 CIPAVWACDEDNDCSDNSDEADCPKKTCAETDFACDNG-HCIPDRWKCDGEEECSDGSDESEAACTKQVCPA----EKISCGDLSNKCIPSSWRCDGQKDCESGIDE 142          
BLAST of Low-density lipoprotein receptor vs. UniProt/SwissProt
Match: sp|Q924X6|LRP8_MOUSE (Low-density lipoprotein receptor-related protein 8 OS=Mus musculus OX=10090 GN=Lrp8 PE=1 SV=2)

HSP 1 Score: 246.899 bits (629), Expect = 3.131e-68
Identity = 176/550 (32.00%), Postives = 272/550 (49.45%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHES-DVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKIT 1915
            CI   W CDG++DC+   DE++C P  C +NEF C  GT C+  +  C+    C D SDE  C +    +C+   +F C K GE C+   +VCD + +C R+  +EP      C  N+C L  NGGCSH CT+     +C CP G++L  D +TC DIDEC   P  C+QIC N  G ++C C+ GY  +   ++ C    G    LI  N      IDL      Y  L    +++V +DV++  +   ++W   S  K+  + +D      E+   ++ +  S +        ++ DW+   ++WT S  K I V  T       L ++ L  PR+IAVDP+   +YW D G +    +IE   +N  +R+ LVS N+  P  + +DL  ++LYW D     ++ I+ +  N    I S   L +PF +AVFE+ +FWTD     I S +++      +LA+ +  P  I + +++ QPK  ++ D+++         GC ++CLP P  S   +  PKY C CP    L  D   C+ A       T
Sbjct:  264 CIHLGWRCDGDRDCKDKSDEADCSPGPCRENEFQCGDGT-CVLAIKRCNQERDCPDGSDEAGCLQE--STCEGPRRFQC-KSGE-CVDGGKVCDDQRDC-RDWSDEPQKV---CGLNEC-LHNNGGCSHICTDLKIGFECTCPAGFQLL-DQKTCGDIDECQ-DPDACSQICVNYKGYFKCECHPGYEMDTL-TKNCKAVAGKSPSLIFTNRHEVRRIDLV--KRDYSRLIPMLKNVVALDVEV--ATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPE-------GLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQA---KIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLSAQP-----NGGCEYLCLPAPQIS---SHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTT 778          

HSP 2 Score: 66.6254 bits (161), Expect = 6.755e-10
Identity = 38/107 (35.51%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE--RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CD + DC    DE +CP + C D++F C +G  CIP+   CDG   C D SDE    C+  E  +     +  C      C+P S  CD + +C    DE
Sbjct:   53 CIPLVWRCDEDNDCSDNSDEDDCPKRTCADSDFTCDNG-HCIPERWKCDGEEECPDGSDESKATCSSEECPA----EKLSCGPTSHKCVPASWRCDGEKDCEGGADE 154          
BLAST of Low-density lipoprotein receptor vs. UniProt/SwissProt
Match: sp|P20063|LDLR_RABIT (Low-density lipoprotein receptor (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=LDLR PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 4.826e-66
Identity = 169/542 (31.18%), Postives = 270/542 (49.82%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISN--KLLYPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            C+   W CDG+ DC  G DE +C    C  +EF C  GT CI     CD    C D SDE  C    +  C+   +F C+  GE CI + +VC+   +C ++  +EP   +  C  N+C +  NGGCSH C +     +CHCP GY+L  D R C DI+EC   P  C+Q+C N  GSY+C C  G++ + H S+ C   +   SI       R  +  +      Y  L  + +++V +D ++  +   ++W   S  K+  ++ID   +    Y  +   +L      Q    ++ DW+ G ++WT S+   + V +T       L  Q    PR+I VDP +  +YW D G      +IE   +N  +   LV+++++ P  + +DL   +LYW D    SI+ I+++   N KT++ +  +L +PFS+A+FE+ +FWTD     I S +++T SD + V   ++ P  I + + + QP+        + C K  +   GC ++CLP P   IN +  PK+ C CP  + L  D  +C 
Sbjct:  196 CVHASWRCDGDADCRDGSDERDCAAATCRPDEFQCSDGT-CIHGSRQCDQQQDCGDMSDEVGCVN--VTLCEGPDKFKCHS-GE-CISLDKVCNSARDC-QDWSDEP---IKECATNEC-MRGNGGCSHTCFDLRIGHECHCPKGYRLV-DQRRCEDINECE-DPDICSQLCVNLAGSYKCECRAGFQLDPH-SQACKAVD---SIAYLFFTNRHEVRKMTLDRSEYTSLIANLKNVVALDAEV--ASNRIYWSDLSQRKIYSAQID-GAHGFPAYDTVISSDL------QAPDGLAVDWIHGHIYWTDSVLGTVSVADTRGFRRKTLFRQEGSKPRAIVVDPAHGFMYWTDWGVPA---KIEKGGLNGVDVYSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNG-GNRKTVLEDEQRLAHPFSLAIFEDKVFWTDVINEAIFSANRLTGSDVHLVAENLLSPEDIVLFHNLTQPR------GVNWCEKTALPNGGCQYLCLPAP--QIN-SHSPKFTCACPDGTLLAADMRSCR 699          

HSP 2 Score: 78.1814 bits (191), Expect = 1.690e-13
Identity = 48/125 (38.40%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  224 NCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPG 598
             C S D+     +N   CI   W CDG QDCE G DE  C PK C  +EF C  G  CI +L  CDG   C D SDE +C           + F CN     C+P    CD + +C    DE P 
Sbjct:   54 TCKSDDFSCGGRLN--RCIPGHWKCDGQQDCEDGSDELGCAPKTCSQDEFRCAEGA-CISRLFACDGEPDCPDGSDEASCAPSTCGP----AHFRCNSSS--CVPALWACDGEPDCDDGSDEWPA 169          
BLAST of Low-density lipoprotein receptor vs. UniProt/SwissProt
Match: sp|P98165|VLDLR_CHICK (Very low-density lipoprotein receptor OS=Gallus gallus OX=9031 GN=VLDLR PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.847e-65
Identity = 171/543 (31.49%), Postives = 268/543 (49.36%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMH-GCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN 1894
            CI K W CDG+ DC+ G DE NCP + C  ++F C  G  CI     C+G   C+D +DE NC  + +  C    +F C + GE CI I++VC+   +C ++  +EP   +  C  N+C L+ NGGCSH C +     +C CP G++L  D RTC DIDEC  +P  C+QIC N  G Y+C C  GY+ +           G    LI  N  R+ +  +      Y  L     + V +D D+ +  Q ++W   S   +  + ID +       R L++ +            ++ DW+   ++WT S  K I V +       VL    L  P SIAVDP++  +YW D G      +IE   MN  +R+ LV+  ++ P  + +DL + +LYW D     ++ ++L+  +    + S+  L +P ++ +FE+ +FW D     +   +K T ++  T++  +     I V ++++QP         + C +N ++ GCS++CLP P   IN +  PKY C CP    LQ D L C   N
Sbjct:  269 CIHKKWRCDGDPDCKDGSDEINCPSRTCRPDQFRCEDGN-CIHGSRQCNGVRDCLDGTDEANC--NNVIQCSGPGKFKC-RSGE-CIDINKVCNHHGDC-KDWSDEP---LKECNINEC-LVNNGGCSHICRDLVIGYECDCPAGFELV-DRRTCGDIDECQ-NPGICSQICINLKGGYKCECSRGYQMDLATG--VCKAVGKEPCLIFTN--RRDIRKIGLERKEYIQLVEQLRNTVALDADIAE--QKLYWADFSQKAIFSASIDTRDKVGTHTRILDNIHSP--------AGIAVDWIYKNIYWTDSSAKTISVASLNGKKRKVLFLSELREPASIAVDPLSGFMYWSDWG---EPAKIEKAGMNGFDRQQLVTTEIQWPNGIALDLVKSRLYWLDSKLHMLSSVDLNGQDRRLVLKSHMFLPHPLALTIFEDRVFWIDGENEAVYGANKFTGAELVTLVNNLNDAQDIIVYHELVQPS------GRNWCEENMVNGGCSYLCLPAP--QINEHS-PKYTCTCPAGYFLQEDGLRCGGFN 773          

HSP 2 Score: 78.1814 bits (191), Expect = 1.860e-13
Identity = 43/106 (40.57%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI   W CDG++DC  G DES C  K C +++F+C+SG QC+P    CDG   C D SDE     H +++C  +++  C      CIP+S  CD + +C   +DEE
Sbjct:   63 CIPLLWKCDGDEDCSDGSDESACVKKTCAESDFVCNSG-QCVPNRWQCDGDPDCEDGSDESAELCH-MRTC-RVNEISCGPQSTQCIPVSWKCDGEKDCDSGEDEE 165          

HSP 3 Score: 77.0258 bits (188), Expect = 4.385e-13
Identity = 48/119 (40.34%), Postives = 60/119 (50.42%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQR 622
            +  CI   W CDG +DC+SG+DE NC    C   EF C SG QCI K  +C+G   C D SDE  C          + +F C      CIPIS VCD   +C  + DE    S++ C R
Sbjct:  142 STQCIPVSWKCDGEKDCDSGEDEENCGNVTCSAAEFTCSSG-QCISKSFVCNGQDDCSDGSDELECAPPTC----GVHEFQCKS--STCIPISWVCDDDADCSDHSDE----SLEQCGR 249          

HSP 4 Score: 62.003 bits (149), Expect = 1.745e-8
Identity = 45/126 (35.71%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  221 ENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESN--CPPKVCLDNEFLCH-SGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            + C  SD++     N+  C+   W CDG+ DCE G DES   C  + C  NE  C    TQCIP    CDG   C    DE NC         S ++F C+     CI  S VC+ +++C    DE
Sbjct:   88 KTCAESDFV----CNSGQCVPNRWQCDGDPDCEDGSDESAELCHMRTCRVNEISCGPQSTQCIPVSWKCDGEKDCDSGEDEENCGNVTC----SAAEFTCSSGQ--CISKSFVCNGQDDCSDGSDE 203          
BLAST of Low-density lipoprotein receptor vs. UniProt/SwissProt
Match: sp|P98156|VLDLR_MOUSE (Very low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Vldlr PE=1 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 5.658e-65
Identity = 171/542 (31.55%), Postives = 267/542 (49.26%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIH---ESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            CI K W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   CVD SDE NC    +  C    +F C + GE CI +S+VCD++ +C R+  +EP   +  C  N+C L+ NGGCSH C +     +C C  G++L  D +TC DIDEC  +P  C+QIC N  G Y+C C  GY+ +      C     + S++ T    R+ +  +      Y  L     + V +D D+  + Q +FW   S   +  + ID KV          H  + D+        ++ DW+   ++WT +  K I V          L N  L  P SIAVDP++  VYW D G      +IE   MN  +RR LV+++++ P  + +DL + +LYW D     ++ ++L+  +    + S + L +P ++ +FE+ ++W D     +   +K T S+  T++  +     I V ++++QP      E D+ +         GC ++CLP P   IN +  PKY C CP    L+ +   C 
Sbjct:  251 CIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNC--KNVNQCLGPGKFKC-RSGE-CIDMSKVCDQEQDC-RDWSDEP---LKECHINEC-LVNNGGCSHICKDLVIGYECDCAAGFEL-IDRKTCGDIDECQ-NPGICSQICINLKGGYKCECSRGYQMDLATG-VCKAVGKEPSLIFT---NRRDIRKIGLERKEYIQLVEQLRNTVALDADI--AAQKLFWADLSQKAIFSASIDDKVG--------RHFKMIDNVYNP--AAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWG---EPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEDDMEN--------GGCEYLCLPAP--QIN-DHSPKYTCSCPNGYNLEENGRECQ 750          

HSP 2 Score: 80.1073 bits (196), Expect = 4.785e-14
Identity = 44/106 (41.51%), Postives = 62/106 (58.49%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI+  W CDG++DC  G DE NC  K C +++F+C +G QC+P    CDG   C D SDE     H +++C  I++  C      CIP+S  CD +N+C   +DEE
Sbjct:   45 CITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNG-QCVPNRWQCDGDPDCEDGSDESPEQCH-MRTC-RINEISCGARSTQCIPVSWRCDGENDCDNGEDEE 147          

HSP 3 Score: 69.707 bits (169), Expect = 7.870e-11
Identity = 43/119 (36.13%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQR 622
            +  CI   W CDG  DC++G+DE NC    C  +EF C SG +C+ +  +C+G   C D SDE +C      +     +F C+     CIP+S VCD   +C    DE    S++ C R
Sbjct:  124 STQCIPVSWRCDGENDCDNGEDEENCGNITCSADEFTCSSG-RCVSRNFVCNGQDDCDDGSDELDCAPPTCGA----HEFQCSTSS--CIPLSWVCDDDADCSDQSDE----SLEQCGR 231          
BLAST of Low-density lipoprotein receptor vs. TrEMBL
Match: A0A1S6KMJ9 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 649/667 (97.30%), Postives = 651/667 (97.60%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANH-RQQKITSIHSKRLKIILGVXXXXXXXXXXXXXXXCVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA 2215
            NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCL+NEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKN+MHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN  RQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQ              LSELLASDVSSTATA
Sbjct:   19 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNKMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANQDRQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQ--------------LSELLASDVSSTATA 671          
BLAST of Low-density lipoprotein receptor vs. TrEMBL
Match: A0A0P8ZZH4 (Uncharacterized protein, isoform H OS=Drosophila ananassae OX=7217 GN=Dana\GF18235 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 6.715e-81
Identity = 188/563 (33.39%), Postives = 288/563 (51.15%), Query Frame = 2
Query:  269 VNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC-TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITS---DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKR 1933
              C+ + W CDG +DC  G+DES  NCP   C  ++F C   + CI   L+C+G   C D +DE NC     IK C++ S+FDC   G  CIP+++VCD++ +C   +DE  G     C  N+C    NGGC H C N     +C C  GYKL PDNR+CVDIDEC  +P  C+Q C N  GS++C C +GY +  HN   C   EG  S+L+T     R++ +D          + NS +S   +D         +FW   +   + +S ID      EK   + H +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   ++ PRSIA+DPI+  +YW D G   +SPRIE   M+  +R  +++ +++ P  + +DL  +++YW D     I+  N D     + + S++ L +PFSI  FE++++WTDW +  +   +K T     + T    +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C         + S+HS+R
Sbjct:  211 TTCLHRTWVCDGEKDCPDGEDESSENCPTVTCRPDQFQCRDRS-CIAGNLICNGQGDCADGTDEVNCNITAPIKPCNTTSEFDCG--GGQCIPLAKVCDRRKDCPNGEDEPAGK----CSVNECATA-NGGCMHTCVNLAVGYRCECHAGYKLAPDNRSCVDIDECE-TPGVCSQQCINQVGSFKCECQEGYMRVMHNHTRCKASEGHASLLLTRRHDIRKIALDRPE----MTSIVNSTKSSTALDFVFRTG--MIFWSDVTTKSIYKSPID---EGNEKTLVVKHSSVTSD-------GLAVDWIYNHVYYTDTHKCTIELTNFEGSMGKVLVEDSVDIPRSIALDPIDGWMYWSDWG---ASPRIERAGMDGSHRTAIITYDVKWPNGITLDLVLKRIYWVDGKLNIISSANFDGSQRRQVLYSSEYLRHPFSITTFEDHVYWTDWDKQAVFKANKFTGQDVQAVTATHMLEHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMSDGLMC----VEDLYVPSVHSRR 731          
BLAST of Low-density lipoprotein receptor vs. TrEMBL
Match: A0A0P8XYT3 (Uncharacterized protein, isoform C OS=Drosophila ananassae OX=7217 GN=Dana\GF18235 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 7.127e-81
Identity = 188/563 (33.39%), Postives = 288/563 (51.15%), Query Frame = 2
Query:  269 VNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC-TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITS---DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKR 1933
              C+ + W CDG +DC  G+DES  NCP   C  ++F C   + CI   L+C+G   C D +DE NC     IK C++ S+FDC   G  CIP+++VCD++ +C   +DE  G     C  N+C    NGGC H C N     +C C  GYKL PDNR+CVDIDEC  +P  C+Q C N  GS++C C +GY +  HN   C   EG  S+L+T     R++ +D          + NS +S   +D         +FW   +   + +S ID      EK   + H +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   ++ PRSIA+DPI+  +YW D G   +SPRIE   M+  +R  +++ +++ P  + +DL  +++YW D     I+  N D     + + S++ L +PFSI  FE++++WTDW +  +   +K T     + T    +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C         + S+HS+R
Sbjct:  211 TTCLHRTWVCDGEKDCPDGEDESSENCPTVTCRPDQFQCRDRS-CIAGNLICNGQGDCADGTDEVNCNITAPIKPCNTTSEFDCG--GGQCIPLAKVCDRRKDCPNGEDEPAGK----CSVNECATA-NGGCMHTCVNLAVGYRCECHAGYKLAPDNRSCVDIDECE-TPGVCSQQCINQVGSFKCECQEGYMRVMHNHTRCKASEGHASLLLTRRHDIRKIALDRPE----MTSIVNSTKSSTALDFVFRTG--MIFWSDVTTKSIYKSPID---EGNEKTLVVKHSSVTSD-------GLAVDWIYNHVYYTDTHKCTIELTNFEGSMGKVLVEDSVDIPRSIALDPIDGWMYWSDWG---ASPRIERAGMDGSHRTAIITYDVKWPNGITLDLVLKRIYWVDGKLNIISSANFDGSQRRQVLYSSEYLRHPFSITTFEDHVYWTDWDKQAVFKANKFTGQDVQAVTATHMLEHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMSDGLMC----VEDLYVPSVHSRR 731          
BLAST of Low-density lipoprotein receptor vs. TrEMBL
Match: A0A0P8YF16 (Uncharacterized protein, isoform I OS=Drosophila ananassae OX=7217 GN=Dana\GF18235 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 7.446e-81
Identity = 188/563 (33.39%), Postives = 288/563 (51.15%), Query Frame = 2
Query:  269 VNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC-TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITS---DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKR 1933
              C+ + W CDG +DC  G+DES  NCP   C  ++F C   + CI   L+C+G   C D +DE NC     IK C++ S+FDC   G  CIP+++VCD++ +C   +DE  G     C  N+C    NGGC H C N     +C C  GYKL PDNR+CVDIDEC  +P  C+Q C N  GS++C C +GY +  HN   C   EG  S+L+T     R++ +D          + NS +S   +D         +FW   +   + +S ID      EK   + H +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   ++ PRSIA+DPI+  +YW D G   +SPRIE   M+  +R  +++ +++ P  + +DL  +++YW D     I+  N D     + + S++ L +PFSI  FE++++WTDW +  +   +K T     + T    +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C         + S+HS+R
Sbjct:  210 TTCLHRTWVCDGEKDCPDGEDESSENCPTVTCRPDQFQCRDRS-CIAGNLICNGQGDCADGTDEVNCNITAPIKPCNTTSEFDCG--GGQCIPLAKVCDRRKDCPNGEDEPAGK----CSVNECATA-NGGCMHTCVNLAVGYRCECHAGYKLAPDNRSCVDIDECE-TPGVCSQQCINQVGSFKCECQEGYMRVMHNHTRCKASEGHASLLLTRRHDIRKIALDRPE----MTSIVNSTKSSTALDFVFRTG--MIFWSDVTTKSIYKSPID---EGNEKTLVVKHSSVTSD-------GLAVDWIYNHVYYTDTHKCTIELTNFEGSMGKVLVEDSVDIPRSIALDPIDGWMYWSDWG---ASPRIERAGMDGSHRTAIITYDVKWPNGITLDLVLKRIYWVDGKLNIISSANFDGSQRRQVLYSSEYLRHPFSITTFEDHVYWTDWDKQAVFKANKFTGQDVQAVTATHMLEHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMSDGLMC----VEDLYVPSVHSRR 730          
BLAST of Low-density lipoprotein receptor vs. TrEMBL
Match: A0A0P9AR64 (Uncharacterized protein, isoform K OS=Drosophila ananassae OX=7217 GN=Dana\GF18235 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 7.610e-81
Identity = 188/563 (33.39%), Postives = 288/563 (51.15%), Query Frame = 2
Query:  269 VNCISKDWWCDGNQDCESGKDES--NCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC-TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG-RQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITS---DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKR 1933
              C+ + W CDG +DC  G+DES  NCP   C  ++F C   + CI   L+C+G   C D +DE NC     IK C++ S+FDC   G  CIP+++VCD++ +C   +DE  G     C  N+C    NGGC H C N     +C C  GYKL PDNR+CVDIDEC  +P  C+Q C N  GS++C C +GY +  HN   C   EG  S+L+T     R++ +D          + NS +S   +D         +FW   +   + +S ID      EK   + H +++ D        ++ DW+   +++T + +  I +TN   ++  VL+   ++ PRSIA+DPI+  +YW D G   +SPRIE   M+  +R  +++ +++ P  + +DL  +++YW D     I+  N D     + + S++ L +PFSI  FE++++WTDW +  +   +K T     + T    +  P+ + V +   QP     D  +H C     H CSH+CLP P   IN    P+  C CP   KL  D L C         + S+HS+R
Sbjct:  210 TTCLHRTWVCDGEKDCPDGEDESSENCPTVTCRPDQFQCRDRS-CIAGNLICNGQGDCADGTDEVNCNITAPIKPCNTTSEFDCG--GGQCIPLAKVCDRRKDCPNGEDEPAGK----CSVNECATA-NGGCMHTCVNLAVGYRCECHAGYKLAPDNRSCVDIDECE-TPGVCSQQCINQVGSFKCECQEGYMRVMHNHTRCKASEGHASLLLTRRHDIRKIALDRPE----MTSIVNSTKSSTALDFVFRTG--MIFWSDVTTKSIYKSPID---EGNEKTLVVKHSSVTSD-------GLAVDWIYNHVYYTDTHKCTIELTNFEGSMGKVLVEDSVDIPRSIALDPIDGWMYWSDWG---ASPRIERAGMDGSHRTAIITYDVKWPNGITLDLVLKRIYWVDGKLNIISSANFDGSQRRQVLYSSEYLRHPFSITTFEDHVYWTDWDKQAVFKANKFTGQDVQAVTATHMLEHPMVVHVYHPYRQP-----DGVNH-CQSVNGH-CSHLCLPAP--RIN-ERSPRISCACPTGLKLMSDGLMC----VEDLYVPSVHSRR 730          
BLAST of Low-density lipoprotein receptor vs. Ensembl Cavefish
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:103043840])

HSP 1 Score: 261.151 bits (666), Expect = 1.518e-75
Identity = 183/544 (33.64%), Postives = 273/544 (50.18%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTII-SNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITS-DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            N+  CI   W CDG  DC    DE+NC    C  +EF C  G  CIP +  CDG FHC D SDE +C    +  C+  + F C + GE CI + +VC+K+ +C R+  +EP   +  C  N+C L+ NGGCSH C +     +C CP GY+L  DN+ C DIDEC A P  C+Q+C N  GS++C C +GY  +    E C    G+   L   N  R  +  +      Y  L    +++V +D+D  +S Q +FW    + K+  + +D   ++       +H  + D HI      ++ DW+ G ++WT SI  +I V  T  +    L+   L+ PR+I VDP    +YW D G      RIE   +N  +R  LV+ N+  P  + +D+  ++LYW D    +++ I ++       II    L +P S+ VFE  +FWTD   N I+S +++T  D   V   +V P  I + + + QP        ++ C + +    GC ++CLP P   INP+  PKY C CP    L  D   C
Sbjct:  182 NSGECIHGMWRCDGGFDCMDHSDEANCSAPTCRPDEFQCADGG-CIPGIRQCDGEFHCRDMSDENDCAT--VSKCEGPNTFHC-RSGE-CISLDKVCNKQRDC-RDWSDEP---LKECNTNEC-LVNNGGCSHTCNDLKIGYECLCPAGYRLV-DNKRCEDIDEC-ADPDTCSQVCVNLEGSFKCECEEGYEMDLMTKE-CKAVAGNVPYLYFTN--RHEVRKMTLDKSEYTCLIPRLKNVVALDMD--KSGQRIFWSDLFHKKIYSTPVDQAADSS------HHTTVIDGHISAP-EGLAVDWIHGNIYWTDSIFGLISVATTDGSKRKTLIRDELKKPRAIVVDPERNFMYWTDWG---HPARIEKSGLNGADRTALVTDNIVWPNGITLDMVNQRLYWVDSKLHTLSSIGVNGGLRHTLIIDEGTLAHPLSLTVFEEKVFWTDVSSNSIMSANRLTGKDIVKVAENLVSPEDIVLYHDLKQPN------GTNWCEEGKQVNGGCEYLCLPAP--RINPHS-PKYTCACPDHMVLGPDMRKC 689          

HSP 2 Score: 72.4034 bits (176), Expect = 1.186e-12
Identity = 43/109 (39.45%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGN 601
            C+   W CDG  DCE+G+DE  C  K C ++EF C +G QCI    +CD    C D SDE +C      +C + S F CN    +C+P    CD   +C    DE P N
Sbjct:   62 CVPSRWLCDGKADCENGRDEEGCVLKNCTEDEFRCANG-QCISASFVCDDESDCSDGSDEASCAP---PTCTAGS-FQCNN--SVCVPQLWACDGDADCADGSDEWPQN 163          
BLAST of Low-density lipoprotein receptor vs. Ensembl Cavefish
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:103043840])

HSP 1 Score: 261.151 bits (666), Expect = 5.090e-75
Identity = 183/556 (32.91%), Postives = 277/556 (49.82%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTII-SNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITS-DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM--HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITS 1918
            N+  CI   W CDG  DC    DE+NC    C  +EF C  G  CIP +  CDG FHC D SDE +C    +  C+  + F C + GE CI + +VC+K+ +C R+  +EP   +  C  N+C L+ NGGCSH C +     +C CP GY+L  DN+ C DIDEC A P  C+Q+C N  GS++C C +GY  +    E C    G+   L   N  R  +  +      Y  L    +++V +D+D  +S Q +FW    + K+  + +D   ++       +H  + D HI      ++ DW+ G ++WT SI  +I V  T  +    L+   L+ PR+I VDP    +YW D G      RIE   +N  +R  LV+ N+  P  + +D+  ++LYW D    +++ I ++       II    L +P S+ VFE  +FWTD   N I+S +++T  D   V   +V P  I + + + QP        ++ C + +    GC ++CLP P   INP+  PKY C CP    L  D   C   + + +   +
Sbjct:  201 NSGECIHGMWRCDGGFDCMDHSDEANCSAPTCRPDEFQCADGG-CIPGIRQCDGEFHCRDMSDENDCAT--VSKCEGPNTFHC-RSGE-CISLDKVCNKQRDC-RDWSDEP---LKECNTNEC-LVNNGGCSHTCNDLKIGYECLCPAGYRLV-DNKRCEDIDEC-ADPDTCSQVCVNLEGSFKCECEEGYEMDLMTKE-CKAVAGNVPYLYFTN--RHEVRKMTLDKSEYTCLIPRLKNVVALDMD--KSGQRIFWSDLFHKKIYSTPVDQAADSS------HHTTVIDGHISAP-EGLAVDWIHGNIYWTDSIFGLISVATTDGSKRKTLIRDELKKPRAIVVDPERNFMYWTDWG---HPARIEKSGLNGADRTALVTDNIVWPNGITLDMVNQRLYWVDSKLHTLSSIGVNGGLRHTLIIDEGTLAHPLSLTVFEEKVFWTDVSSNSIMSANRLTGKDIVKVAENLVSPEDIVLYHDLKQPN------GTNWCEEGKQVNGGCEYLCLPAP--RINPHS-PKYTCACPDHMVLGPDMRKCVEVDQKAKGAAT 720          

HSP 2 Score: 73.1738 bits (178), Expect = 8.107e-13
Identity = 43/109 (39.45%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGN 601
            C+   W CDG  DCE+G+DE  C  K C ++EF C +G QCI    +CD    C D SDE +C      +C + S F CN    +C+P    CD   +C    DE P N
Sbjct:   81 CVPSRWLCDGKADCENGRDEEGCVLKNCTEDEFRCANG-QCISASFVCDDESDCSDGSDEASCAP---PTCTAGS-FQCNN--SVCVPQLWACDGDADCADGSDEWPQN 182          
BLAST of Low-density lipoprotein receptor vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 243.817 bits (621), Expect = 2.359e-69
Identity = 184/555 (33.15%), Postives = 275/555 (49.55%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKR 1933
            CI + W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   C D +DE NC    +  C+   +F C + GE CI + +VC+K  +C    DE     +  C  N+C L+ NGGCSH C +     +C C  G +L  D +TC DI+EC  +P  C+QIC N  G Y+C C+ GY  +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I   V  ++K   + +  + D+   Q+   ++ DW+   ++W+    K I V N       VL ++ L+ P SIAVDP++  +YW D G      +IE   MN  +R+VLV  +++ P  + +DL + +LYW D    ++  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS++CLP P   IN +  PKY C+CP   +L  D L C   N      TSIH  +
Sbjct:  168 CIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNC--KNLTQCNGPDKFKC-RSGE-CIDMHKVCNKARDCPDWSDE----PIKECNLNEC-LLNNGGCSHICRDMVIGYECDCTPGLQL-IDRKTCGDINEC-LNPGICSQICINLKGGYKCECHSGYLMDAATG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFTQ--QRIFW-----ADLGQKAIFSTV--LDKREDVGYTKVIDNV--QMPVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKVLQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTMLANNLNEPQDIIVYHELIQLS-----GTNWCNEKVNNGGCSYMCLPAP--QINKHS-PKYTCVCPVGQELSSDGLRCRPGNIS----TSIHEVK 680          

HSP 2 Score: 70.0922 bits (170), Expect = 6.757e-12
Identity = 42/106 (39.62%), Postives = 59/106 (55.66%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI   W CDG++DC  G DES C  K+C + +F+C +G QCIPK   CDG   C D SDE   T+       ++ +F C      CI  + VC+ +++CG   DE+
Sbjct:    3 CIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNG-QCIPKRWHCDGEPDCEDGSDEG--TEQCCNVTCALLEFTCTSG--RCISQNFVCNGEDDCGDGSDEQ 103          
BLAST of Low-density lipoprotein receptor vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 243.817 bits (621), Expect = 8.604e-69
Identity = 181/555 (32.61%), Postives = 274/555 (49.37%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKR 1933
            CI + W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   C D +DE NC    +  C+   +F C + GE CI + +VC+K  +C    DE     +  C  N+C L+ NGGCSH C +     +C C  G +L  D +TC DI+EC  +P  C+QIC N  G Y+C C+ GY  +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I   V  ++K   + +  + D+   Q+   ++ DW+   ++W+    K I V N       VL ++ L+ P SIAVDP++  +YW D G      +IE   MN  +R+VLV  +++ P  + +DL + +LYW D    ++  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS++CLP P   IN +  PKY C+CP   +L  D L C    +    I  + S +
Sbjct:  246 CIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNC--KNLTQCNGPDKFKC-RSGE-CIDMHKVCNKARDCPDWSDE----PIKECNLNEC-LLNNGGCSHICRDMVIGYECDCTPGLQL-IDRKTCGDINEC-LNPGICSQICINLKGGYKCECHSGYLMDAATG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFTQ--QRIFW-----ADLGQKAIFSTV--LDKREDVGYTKVIDNV--QMPVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKVLQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTMLANNLNEPQDIIVYHELIQLS-----GTNWCNEKVNNGGCSYMCLPAP--QINKHS-PKYTCVCPVGQELSSDGLRCRPEGNISTSIHEVKSAK 762          

HSP 2 Score: 76.2554 bits (186), Expect = 8.771e-14
Identity = 42/105 (40.00%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG++DC  G DES C  K+C + +F+C +G QCIPK   CDG   C D SDE    +   ++C  +++F C      CIP+   CD +++C   +DE
Sbjct:   40 CIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNG-QCIPKRWHCDGEPDCEDGSDEGT-EQCYTRTC-RMNEFSCGVGSTPCIPVFWKCDGESDCDNGEDE 141          

HSP 3 Score: 67.0106 bits (162), Expect = 6.222e-11
Identity = 43/112 (38.39%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP 595
            + +  CI   W CDG  DC++G+DE NC    C   EF C SG +CI +  +C+G   C D SDE++C      SC   ++F C      CIP   VCD   +C  + DE P
Sbjct:  117 VGSTPCIPVFWKCDGESDCDNGEDEMNCGNVTCALLEFTCTSG-RCISQNFVCNGEDDCGDGSDEQDCAP---SSC-GPNEFQCGN--ATCIPSGWVCDDDPDCQDHSDESP 221          
BLAST of Low-density lipoprotein receptor vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 242.276 bits (617), Expect = 3.497e-68
Identity = 179/539 (33.21%), Postives = 269/539 (49.91%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            CI + W CDG+ DC+ G DE NCP + C  ++F C  G+ CI     C+G   C D +DE NC    +  C+   +F C + GE CI + +VC+K  +C    DE     +  C  N+C L+ NGGCSH C +     +C C  G +L  D +TC DI+EC  +P  C+QIC N  G Y+C C+ GY  +           G    LI  N  R+ +  L      Y  +     + V +D D  Q  Q +FW       LGQ  I   V  ++K   + +  + D+   Q+   ++ DW+   ++W+    K I V N       VL ++ L+ P SIAVDP++  +YW D G      +IE   MN  +R+VLV  +++ P  + +DL + +LYW D    ++  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K T    T+LA  + +P  I V +++IQ        T+    K    GCS++CLP P   IN +  PKY C+CP   +L  D L C 
Sbjct:  246 CIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNC--KNLTQCNGPDKFKC-RSGE-CIDMHKVCNKARDCPDWSDE----PIKECNLNEC-LLNNGGCSHICRDMVIGYECDCTPGLQL-IDRKTCGDINEC-LNPGICSQICINLKGGYKCECHSGYLMDAATG--VCKAVGKEPCLIFTN--RRDIRKLGLERREYTQIVEQLRNTVALDADFTQ--QRIFW-----ADLGQKAIFSTV--LDKREDVGYTKVIDNV--QMPVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKVLQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTMLANNLNEPQDIIVYHELIQLS-----GTNWCNEKVNNGGCSYMCLPAP--QINKHS-PKYTCVCPVGQELSSDGLRCR 746          

HSP 2 Score: 76.2554 bits (186), Expect = 7.957e-14
Identity = 42/105 (40.00%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG++DC  G DES C  K+C + +F+C +G QCIPK   CDG   C D SDE    +   ++C  +++F C      CIP+   CD +++C   +DE
Sbjct:   40 CIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNG-QCIPKRWHCDGEPDCEDGSDEGT-EQCYTRTC-RMNEFSCGVGSTPCIPVFWKCDGESDCDNGEDE 141          

HSP 3 Score: 67.0106 bits (162), Expect = 5.630e-11
Identity = 43/112 (38.39%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  260 INAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP 595
            + +  CI   W CDG  DC++G+DE NC    C   EF C SG +CI +  +C+G   C D SDE++C      SC   ++F C      CIP   VCD   +C  + DE P
Sbjct:  117 VGSTPCIPVFWKCDGESDCDNGEDEMNCGNVTCALLEFTCTSG-RCISQNFVCNGEDDCGDGSDEQDCAP---SSC-GPNEFQCGN--ATCIPSGWVCDDDPDCQDHSDESP 221          
BLAST of Low-density lipoprotein receptor vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 225.713 bits (574), Expect = 8.687e-62
Identity = 163/538 (30.30%), Postives = 235/538 (43.68%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSD--DHIGQLCTDMSFDWLRGLLFWTSSIEKII--------YXXXXXXXXXXXXXXQGLENPRSIAVDP-INTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVV-KPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKD 1852
            C+   + CD   DC  G DE  C    C  N+F C +G +CIP++  CDG   C D SDE     H+     +   F C   GE C+ I  VC++ N+C    DE+       C  N+C       C+H CTN  T   C C  G++L  + R C DIDEC+ +P  C+Q+C+NT GSY C C  GY +   N   C    G    LI  N  R  + ++  G   Y P+  +  + V +D D  +  + ++W            +D     IE+  FLN   L     H       ++ DW+   ++W  ++   +        Y     S          LENPR + + P     +YW D G      R+ M   N  N+ V++S  L  P  L ID    +++WSD     I + NLD  +   T ++  L + F++ VFE+ IFWTDW    I S  K T +  T+LA    +P  I V +   QP         + C  N   GCSH+CL           G  ++C CP D
Sbjct: 2967 CVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCENG-RCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGA-GE-CVAIHLVCNQANDCADGSDEK------GCGINECLYASINQCAHNCTNTLTSFYCSCWAGFRLMANGRACEDIDECNETPQVCSQLCENTAGSYFCKCAPGYVR-LPNGRTCRQNSGVEPYLIFSN--RYYVRNMTVGGRSYTPILQNLTNAVALDFD--RVERRLYW------------VDYGQRTIERM-FLNRTGLETVMKHDLPAPEGLAIDWVGRKMYWADAVLDCLNVAELDGRYRKKLLSGCVDTNHTYCLENPRGVTLHPRFGRVLYWTDWGNTPYIARVGMDGKN--NKSVVISTKLEWPNGLTIDYTTDRIFWSDAHLNYIEYANLDGSHR-HTTLAGSLPHVFALTVFEDTIFWTDWNTRSIESAHKYTGEGRTMLANTTHRPFDIHVYHPYRQPP-----EVPNPCGSNN-GGCSHLCLVAAG-------GTGFQCECPDD 3461          

HSP 2 Score: 212.231 bits (539), Expect = 2.539e-57
Identity = 168/568 (29.58%), Postives = 266/568 (46.83%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE-SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDR-SILITLNGGRQLMID-LNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTD-MSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTG--VYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKI-TSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKIILGV 1954
            CI   W CDG+ DC+ G DE   CPP+ C      C +G  C+P+   CDG   C D +DER+C     + C S SQ+ C  +   C+ + +VCD   +C    DE P     +C  +DC  + NGGCSH C       +C CP G++L  D + C D+DEC   P  C+Q C N  GS+ C C  GY      S+    K  DR  +L+ +    Q+  D +    +    +  +  S+V +D D       ++W       + + KI   + N    R L HK      +G   T+ ++ DW+   L+W   + + I V+    +  +VL++  + NPR + +DP +    ++W D G    +PRIE   M+   RR +VS  L  P  L ID     LY++D     I+F + +  N  + + S+ +L +P +I +FE+ ++WTD   N+++  +K    +  T++  + +P+ +   + V QP        ++ CL      CSH+CL  P   I P     Y C CP    L  D  TC     +++    +   R  II G+
Sbjct: 1205 CIPAGWECDGHPDCDDGSDEHPGCPPRTCAAGYLRCDNG-NCVPESWRCDGDNDCRDGTDERDCPTPPYR-CQSPSQWLC-PNHRACVDLRKVCDGNFDCPDGGDESP-----HCNEHDCS-VNNGGCSHGCVQGPFGAQCTCPPGFQLLDDTKNCADVDECDP-PGSCSQQCVNEHGSFRCHCDLGYTM---ESDRRTCKANDRHEVLLLVPSRSQIYSDNITATPNVLSSVVRNGRSIVAVDFDARAG--RIYW-----ADVAEDKIWSALRNGTD-RQLVHK-----QVGLTVTENLAVDWIGKNLYWLDFVLETIEVSRLDGSHRTVLISTNVTNPRGLVLDPRDGSRTMFWTDWG---KNPRIERAGMDGRLRRTIVSSKLYWPNGLAIDYATNLLYFADAYLDFIDFCDFNGQNRRQVLASDLILQHPHAITIFEDFVYWTDRSTNRVMRANKWHGGNQSTMIYNLQQPMGLVASHSVRQP------TATNPCLG---QSCSHLCLLSP---ITPF---FYSCACPSGWNLGPDGRTC-----QKEDRPFLIVVRSSIIFGI 1723          

HSP 3 Score: 158.303 bits (399), Expect = 7.661e-40
Identity = 145/542 (26.75%), Postives = 228/542 (42.07%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKID-LKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPI--NTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK--LLYPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C+ + + CD   DC  G DE+ C    C  N+F C SG +CI +  +CDG   C D SDER C     +  +   +       + CIP  +VCD + +C    DE    +   C   +C  +    C + C        C+CP  + +  ++ TC+D D+C      C+Q C+N P  + C C  GY              G  S+L + NG   +M DL       + L  S    V + VD H   + +FW      K+    +D L V  +        +NL            + DW+   L+   S    I VT+        L+ + L  PR IA+DP      +++ D      +PR+E   M+  NR  LV   L  P  + +D   ++++W D     I  +  D     KTI+S    + +PF I  FE+ +++TDW + ++  ++    SD   V    ++P  + V + + QP++       + C  N   GC  IC+    +    N G  Y+C C     LQ D L C
Sbjct:  168 CVPQSYRCDHIDDCTDGSDENGCVYGTCQGNQFTCASG-RCILQSWVCDGDDDCFDGSDERGCVSAASEERECYPEEWPCPGSKACIPFRKVCDGRRDCPHGTDESNSTAGLACSIENCGAL---SCEYRCHASPAGGACYCPPSFVVSNNSITCMDFDDCKMW-GVCDQFCENRPAGHMCQCSPGYLLEYGKHCRADVTSGVASLLFS-NGKDLVMSDLQ--GRTVRVLVPSQNRGVAVGVDYHYILRRVFWTDTMQNKVLSVNMDTLAVETVLSVALDMPENL------------AVDWISNKLYIVESSVDRIDVTDLNGANRLTLIAENLGRPRGIALDPTVGKGSIFFSDWDDASGNPRLERAYMDGTNRLALVRTKLGWPAGITLDFVLQRVFWVDNRFDYIESVTYDGLIR-KTILSGGANVPHPFDITTFEHYVYFTDWTRMEVTRVNVFNGSDLQVVHRSNIQPYGVIVHHSLRQPQVR------NPCGPNN-GGCEQICV---LSHRTDNVGLGYRCKCRVGFDLQPDGLRC 678          

HSP 4 Score: 156.377 bits (394), Expect = 2.635e-39
Identity = 157/561 (27.99%), Postives = 236/561 (42.07%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLD------NEFLCHSGTQCIPKLLLCDGTFHCVDKSDER--NCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNF-FTYIKCHCPLGYKLQPDNRT-CVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHN-SEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTM----FWIQQSNGKLGQSK-IDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLID-LQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKI---HESDVTSHACLKNRMHG-CSHICLPFPSNSINPNEGPKYKCLCPKDSK-LQGDKLTCHFA 1891
            CI   W CDG+ DC  G DE       CLD        F C +  +CI    +C+    C D SDE    C +     C +  +F C      CIP++ VC+  N C  N DE        C +   +      C   CTN       C C  G+    +NR  C D++EC      C Q C+N  G+YEC C DGYR    +  + CI  + +  +L+  +  R    DL   S       ++ E +  +D D       +    + + +S GK G  K   L   +     F    NL   +I Q    ++ DW+   ++WT +    I V          L+N  L+ P +IA++P    +YW D G     P+IEM  M+   R+ LV   L  P  L +D     ++YW D     I  +  D   + +T+IS  L  PF++ VFE+N++WT     Q+   +K  S         VK   + V + + Q ++   H  +V     +KN   G CSH+CL  P           Y C CP++++ + G +  C  A
Sbjct: 3819 CIPPSWKCDGDNDCGDGSDEE---LHHCLDTPCNPPGRFRCDN-NRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPC-TEEEFKCASG--RCIPMAAVCNNYNECRDNTDET------GCNQGQDRTCAERICEQNCTNLPGNGFICSCRPGFTANAENRNNCDDVNECEVF-GTCPQDCQNAKGTYECFCVDGYRSAAGSYGKRCIAND-NSPVLLLADKVRVRKYDLT--SQKQADYISNEEDIQALDFDWDHDGTGLSMVYYTVLRSGGKFGSIKRAYLAAFSNSSENFATGINLGLRYISQP-DGIAVDWVGRHIYWTDAQTSRIEVALLDGRYRKQLINSVLDKPATIALNPKLGMMYWTDWGV---VPKIEMAWMDGQQRQHLVQGLLGWPTGLAVDHTNNGRIYWCDAKENVIESVRPDG-GDRRTVISGDLGNPFTLDVFESNVYWTTRETGQVWQQNKFGSG--------VKSHILTVNSWLSQARVFQKHRYNVN----VKNPCKGTCSHLCLLRPQG---------YTCACPQNAQFIPGSETECDAA 4336          

HSP 5 Score: 95.5153 bits (236), Expect = 2.935e-20
Identity = 82/386 (21.24%), Postives = 159/386 (41.19%), Query Frame = 2
Query:  713 KLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNL-SDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVV--KPLAIQVLNKVIQPKIHESDVTSHACLKNRMH-GCSHICLPFPSNSINPNEGPKYKCLCPKDSK 1858
            ++QP     ++ + C  +   C Q C   P     +C   + +   +   C+    +  + +T +  R + +D    S    P+  +  S V + +D   +   +++ Q     L +S+I     +      +   +L S D I       +FDW+   ++++    + I          +V+    +  PR+I +DP    +YW D        +IE   +  + R  +++ +L  P  L +D  E  LYW+D     I    L    + + +I +  +YPF++ + E +++WTDW    +    K       V+ + +  +P+ I +L    Q +       S+ C  N+ + GCSHIC+P PS           +C CP   +
Sbjct: 2294 RVQPTAPELINFNPCRLNNGGCQQFCFALPSVTTATCACAHGELGSDRVSCVMPSDEYLMFVTEDSIRSMRLDPEDHS---LPIPTAQVSRVAVALDFDIADGRVYFTQSMG--LARSRISFFSLSSPSSVTVIASDLGSPDGI-------AFDWINRRIYYSDYANQTIGSMGLDGGNRTVVAL--VPRPRAIMLDPCKGYMYWTDWSVNA---KIERATLGGNFRVPIINSSLVWPNGLTLDYSENMLYWADAYRQKIERSTLT--GDRREVIVSMAVYPFALTIHEQHVYWTDWNTKSVYRATKDDGADQVVMIQNLPYRPMDIHILTASKQQRC------SNPC--NQFNGGCSHICVPGPSG---------VECQCPAQGR 2643          

HSP 6 Score: 95.5153 bits (236), Expect = 3.223e-20
Identity = 98/426 (23.00%), Postives = 163/426 (38.26%), Query Frame = 2
Query:  644 NGGCSHFCT------NFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQER---KLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDV--TSHACLK--NRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            NGGC   C       N     +C C +G+ LQPD   C  +                                   +++ +         I LN  +Q  + L        P+  S  + V ID D   + Q +     S GK+ Q  +D               NL+   +  +   +++DW+   L+WT +  + +       + +   +   L+NPRSI V P+   +++ D        +I     +  +   +V+ +L  P  L ID Q     KLYW D     I F N +  N  +    + L +PFSI++     +++DWR N I+ + K+      ++ +      IQ L  V   K++++D+   S+AC +  N    CSH C P PS +          C CP   +L  D   C
Sbjct:  641 NGGCEQICVLSHRTDNVGLGYRCKCRVGFDLQPDGLRCFPV-----------------------------------TKFLLFSAMTSVRGIPLNQSQQEDVIL--------PVMGSPVTFVGIDFD--AASQRVIVSDTSQGKIFQQNLD----------GTGRVNLTSRDVSSV-ESLAYDWVSKNLYWTDTRNRAV-TVMRLIDQSRRNILSNLQNPRSIVVHPLQGYIFYSDW---NRPAKIVRAWCDGSHATPIVNTSLGWPNGLAIDWQSPWNPKLYWVDAFFDRIEFSNFNGQNRQRLDRISHLAHPFSISIHGGFAYFSDWRLNSIVRVQKMDGGEAVIIRQ-----GIQYLMNV---KVYDTDIQTGSNACNRPANPNGDCSHFCFPAPSGA--------RVCGCPYGKRLAEDGRMC 990          

HSP 7 Score: 87.4261 bits (215), Expect = 1.003e-17
Identity = 88/387 (22.74%), Postives = 158/387 (40.83%), Query Frame = 2
Query:  797 TPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNI-------DVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKII-------YXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSP-RIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQP-----KIHESDV---TSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHF 1888
            TP  Y C+C  G+            ++ DR  LI +       I L+       P   S++++V I       DVD   + Q ++W++   G + + K D            N    +   I    + ++ DW+   L++T+   + I             + + +     G+  P  IA+DP    +YW D G+    P ++    M+  N  VL S N+     + +D++E+KLYW+    G I   ++   N  +  +   L +P+ +AV E+++++TD+               Y V+ +V K  +  VL +   P     K+H  D    T++AC      GC  +CLP P+         +  C C    +L  D+++C  
Sbjct: 1683 TPFFYSCACPSGWNLGPDGR---TCQKEDRPFLIVVRSSIIFGISLD-------PNQTSNDAMVPISGISNGYDVDFDDT-QFIYWVENP-GSIHRVKTD----------GTNRTQFAPSAILGAPSGLAIDWISRNLYYTNPRSQTIEVIKMDGVQNYRKTIIGNNGQTTGVGYPVGIALDPSRGRLYWTDHGSDSGVPAKVAAADMDGSNPTVLFSGNMDHVDFITLDMREQKLYWAVAGTGVIERGDVTGLN--RITVVQHLSHPWGVAVHESHLYYTDY--------------DYEVVERVGKDGSTPVLMRSNIPGLKCLKVHFRDTSSGTTNACSSGN-GGCQQLCLPRPN--------AQRACGCSTGFQLAPDQISCRL 2022          

HSP 8 Score: 82.4185 bits (202), Expect = 3.141e-16
Identity = 86/406 (21.18%), Postives = 158/406 (38.92%), Query Frame = 2
Query:  749 DECSASPSKCNQICKNTPGSYE-CSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTS--SIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLA----IQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKIT---SIHSKRL 1936
            + CS+    C Q+C   P +   C C  G+ Q   +   C   E    I+  L+  R   I+    S    P+  +  + +++DV  H     ++W    +    +    +K +    ++ +    +    +  +    + DW+ G L++T+  S E  + V    ++   VL    ++ PR +AVDP    ++W+D G +   P+IE   ++  NR V++   L  P  L ID     +YW+D     I  +  D               P+ +A++ +N+ W D    +++   K    S      +   L     + + +  +QP   E  +  + C  N   GC   C   PS +          C C    +L  D+++C   +          SI S RL
Sbjct: 1982 NACSSGNGGCQQLCLPRPNAQRACGCSTGF-QLAPDQISCRLYE-SFVIVSQLSAIRGFHINSTDHSEAMVPVAGTGRNALHVDV--HMPSGFLYWCDHGSASTYRGIRRIKPDG-SGFQTVVSSGIGPSGVAGI----AVDWVAGNLYFTNVFSSETHLEVQRLDTSFRRVLFKTSVDRPRHLAVDPRARFLFWVDAGQR---PKIERAFLDGTNRSVVLDVGLLSPRSLTIDRATDWVYWADDGLDRIGRLAPDGSTWQVVREGRGYPAPYGLAIYGSNLIWVDRNLRKVLQASKEPQASPPPPEVIRDNLGTLRDVTIFDPRVQPTAPEL-INFNPCRLNN-GGCQQFCFALPSVTT-------ATCACAH-GELGSDRVSCVMPSDEYLMFVTEDSIRSMRL 2365          

HSP 9 Score: 65.4698 bits (158), Expect = 5.247e-11
Identity = 59/200 (29.50%), Postives = 78/200 (39.00%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE-RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLI--PNGGCSHFCTNFFTYIKC-----------HCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDG 832
            CI + W CD   DC    DE  C P  C   +F C S  +CI +  +CDG   C D+SDE +NC      S    S F C      C+  +  CD   +C    DE+      +CQ   C  +   NG C +        + C            CP+G + Q  N  CV          +C+ I   T GS E  C  G
Sbjct:   13 CIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRCIARAFVCDGEADCADRSDEHQNCPGSTCSS----SHFTCASGH--CVQSAFRCDHFQDCDDRSDEQ------SCQYPTCAEMTCANGACFNTAQRCDGVVNCRDLSDEANCTARCPVG-EFQCANERCV------PQSYRCDHIDDCTDGSDENGCVYG 193          

HSP 10 Score: 58.9214 bits (141), Expect = 5.221e-9
Identity = 40/152 (26.32%), Postives = 58/152 (38.16%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGT--------------------------------------------QCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            CI   W CDG  DC+ G DE  + C  + C   +F C++G                                             +CIP   +C+G   C D SDE+ C +    +CD +  + C  D   CIP+   CD+ ++CG   DE 
Sbjct: 3571 CIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAE---ITCDPLGDYRC--DNHRCIPLRWRCDRYDDCGDGSDER 3717          

HSP 11 Score: 55.4546 bits (132), Expect = 5.496e-8
Identity = 43/150 (28.67%), Postives = 63/150 (42.00%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNC-------------------------PPKV---CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            C+S+++  C +     C+ + + CDG  DC  G DE  C                         P ++   C  ++F C SG +CIP+  +CD    C D SDER C      +C  + QF C      CI  + VCD  ++C    DE 
Sbjct: 1002 CSSTEFFACAN---GRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMS--GTCHPM-QFQCPD--HRCIDNAYVCDGDSDCVDGADER 1143          

HSP 12 Score: 52.7582 bits (125), Expect = 3.334e-7
Identity = 44/131 (33.59%), Postives = 58/131 (44.27%), Query Frame = 2
Query:  233 SSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRN 625
            SS +  C    + +C+   + CD  QDC+   DE +C    C   E  C +G  C      CDG  +C D SDE NCT      C  + +F C    E C+P S  CD  ++C    DE  G     CQ N
Sbjct:   82 SSSHFTCA---SGHCVQSAFRCDHFQDCDDRSDEQSCQYPTCA--EMTCANGA-CFNTAQRCDGVVNCRDLSDEANCTAR----C-PVGEFQCAN--ERCVPQSYRCDHIDDCTDGSDEN-GCVYGTCQGN 198          

HSP 13 Score: 51.6026 bits (122), Expect = 8.529e-7
Identity = 31/78 (39.74%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  359 LDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            + NEF C +G QCIP   +CD    C D +DE +      ++C   +QF C  D   CIP S +CD  N+CG   DE+
Sbjct: 2827 IANEFRCGNG-QCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPG-TQFTC--DSGRCIPGSWICDGDNDCGDGSDED 2900          

HSP 14 Score: 50.8322 bits (120), Expect = 1.568e-6
Identity = 34/107 (31.78%), Postives = 42/107 (39.25%), Query Frame = 2
Query:  344 PPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEI-----------KSCDSI-------------SQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            P   C   EF   +  +C+P+L LCDG   C D SDER C    +           + C  I              QF C   G  CIP   +CD  N+CG   DE 
Sbjct:  998 PTPQCSSTEFFACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTC-ASGNRCIPRYWICDTDNDCGDGSDER 1103          

HSP 15 Score: 49.6766 bits (117), Expect = 2.909e-6
Identity = 34/97 (35.05%), Postives = 45/97 (46.39%), Query Frame = 2
Query:  296 CDGNQDCESGKDESN--CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRN 580
            CD   +C  G DE    C    C   +F C +G +C+     CD T  C D SDE  C     ++CD  ++F C      CI  S+VC+  NNC  N
Sbjct: 2680 CDNRDNCRDGSDELERVCAFHTCEPTDFTCRNG-RCVRYGYRCDHTNDCGDSSDEEGCA---FRTCDPAAEFACTNG--RCIARSQVCNGVNNCRDN 2770          
BLAST of Low-density lipoprotein receptor vs. Ensembl Sea Lamprey
Match: LRP8 (LDL receptor related protein 8 [Source:HGNC Symbol;Acc:HGNC:6700])

HSP 1 Score: 207.223 bits (526), Expect = 1.652e-58
Identity = 142/456 (31.14%), Postives = 224/456 (49.12%), Query Frame = 2
Query:  350 KVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTI-ISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSY-TVLAKVVKPLAIQVLNKVIQP 1711
            + C  +E  C  G+ C+P    CDG   C D SDE +C    +  C     F C + GE C+   +VCD K +C    DE     +  C  N+C    NGGCSH C +     +C CP GY+L  D  TC D DEC   P  C+Q+C N  G Y+C CY+GY  +   ++ C   E  ++ LI  N      +DL+T S  YK L +   + V + V++  +   ++W      ++  + +D   ++      L    +           ++ DW+ G L+WT S  K + V     +    L  QGL  PR+IAVDP++  VYW D G      +IE   MN  +R+V+VSK++  P  + +DL  ++LYW D    +++ +NL      + +  ++ L +PF+IA+FE+ ++W D  +  I S DK T     +V+  +  P  + V + ++QP
Sbjct:    2 EACGASELRCTDGS-CVPGSSQCDGFRDCHDGSDEHDCNNTAV-DCTGPGWFRC-RSGE-CLQDRQVCDGKRDCHDWSDE----PLSLCNVNECATT-NGGCSHTCWDRPLGYECGCPAGYELL-DEYTCGDTDECK-QPGVCSQLCINYKGGYKCDCYEGYTMDP-ATQACKATEHQKTYLIFANQRDVRRVDLHTRS--YKQLISRTRNTVAVAVEI--TANRIYWSDLGQKQVYSAHMDEAHDSTRHTSVLGEAPV-------FVEGIAIDWVHGNLYWTDSKAKTVAVAKPDGSRRRTLFGQGLSEPRAIAVDPLSGFVYWSDWG---QPAKIEKAGMNGVSRQVIVSKDIEWPNGITLDLVNKRLYWVDSKLRTLSSVNLAGGERHEVMHQTDALHHPFAIAIFEDKVYWADGEKEAIYSADKHTGSGISSVVEDLHSPQDLLVYHPLLQP 431          
BLAST of Low-density lipoprotein receptor vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 213.001 bits (541), Expect = 1.232e-57
Identity = 157/515 (30.49%), Postives = 249/515 (48.35%), Query Frame = 2
Query:  353 VCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDER----NCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            +C  N+F C +G   +     CDG F C D+SDE     +C+ +  K C+  S F C  +G  C+  S +C+ +++C    DE       NC  N+C      GC+  CT+     KC C  G++L+ D +TCVD DEC  +   C+Q C N+ GS++C C DGYRQ  ++S  C     + +ILI  N  R  +  +N     Y  L     + V +D +  +      W+  ++     S I     N    + L+  +LS+         ++ DW+ G L+W       I V+       +VLLN GL+ PR++AVD     +YW D G     P I  M M+  NR V++   +  P  L +D    ++YW+D     I F ++D  N   T++S  + + F++++FE++++WTDW    +    K T +D  T+++ + +P+ + V +   QP     DV +H C  N   GCS++CL  P        G +YKC CP +  L  D  TC
Sbjct: 2826 MCGPNQFRCANGRCLLKSSWECDGDFDCHDRSDEAPINPHCSANNSK-CNDSSSFPC-ANGR-CVNESMLCNNQDDCEDGSDER------NCNINECADRRISGCTQECTDLKIGYKCKCRAGFQLKDDGKTCVDRDECRTT-YPCSQTCLNSHGSFKCLCTDGYRQRVNDSTSCKAISDEEAILIFAN--RYYLRKVNLDGSNYTLLKQGLNNAVALDFEWSEQ-----WVYWTDVTTQGSMIRRMHMNGSDTQVLHRTSLSNPD------GLAVDWIGGNLYWCDKGRDTIEVSKLNGLYRTVLLNNGLKEPRALAVDVRGGYLYWSDWG---EHPHIGRMGMDGSNRSVVIDTKITWPNGLSLDYVNNRIYWADAREDYIQFADMDGANR-HTVVSEDIPHIFALSLFEDHVYWTDWETKTVNRAHKSTGADRTTLISTLHRPMDLHVYHPFRQP-----DVPNHPCKVNN-GGCSNLCLISP--------GGQYKCACPTNFYLASDGRTC 3299          

HSP 2 Score: 202.216 bits (513), Expect = 4.594e-54
Identity = 171/593 (28.84%), Postives = 254/593 (42.83%), Query Frame = 2
Query:  263 NAVNCISKDWWCDGNQDCESGKDESNC--------PPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE---------------------------------------PGNSVDNCQRNDCKLIPNGGCSHFCTNF-FTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQ--PLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLL-YPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKV-VKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHG-CSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            N+  CI   W CDG+ DC    DE+N         PP  C  +EF C +  QCIP    CDG   C+D SDE+ C    +++CD   QF C   G  CI  +  CD  N+C  N DEE                                        G   D CQ N      NGGC+H CT      + C CP G +L  D ++C  +D C A   +C+Q C+      +C CYDG+     + E C + +     +I  N      IDL+ G   Y  L     + + ID  L+QS  +++W      K+   K+  +   +     +    L+          ++ DW+ G ++W  S    I V      + S L+  G+E+PR+IA+DP    ++W D  +  S PRIE + M+   R V+  +      P  L +D  E ++ W D    SI     D     + +  ++ L +PF++ +F   ++WTDWR N ++  +K T  + TV+ +   +P  + V +   QP      + ++ C  N   G CSH CL      IN N      C CP   KLQ DK TC
Sbjct:  996 NSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIPLRWRCDGDTDCIDTSDEKEC-DGVVRTCDPTLQFSCRDTGR-CISKTWFCDGDNDCEDNSDEEGCETMLCKPPSHSCANDSSICLSPKKLCDGHSDCPDGSDEGMLCDQCQVN------NGGCTHNCTVAPGEGVVCSCPSGMQLGKDKKSCDFMDYC-ARHLRCSQRCEQEKSIVKCGCYDGWML-MPDGENCQSLDPFVPFIIFSNRHEIRRIDLHKGD--YSVLVPGLRNTIAIDFHLNQS--SLYWTDVVEDKIYHGKLS-ETGGLTSVEVVVQHGLATPE------GLAVDWIAGNIYWVESNLDQIEVARLNGTMRSTLVAGGIEHPRAIALDPRYGILFWTDWDS--SFPRIEAISMSGTGRHVIHHEMGAGGWPNGLTVDYLENRIMWIDARSDSIYSALYDGTELIEVLRGHEFLSHPFAVTLFGGEVYWTDWRTNTLVRANKWTGQNVTVVQRTNTQPFDLHVFHPTRQP------MANNPCGDNEGRGPCSHHCL------INYNR--TAACTCPHLMKLQPDKRTC 1551          

HSP 3 Score: 180.644 bits (457), Expect = 5.418e-47
Identity = 141/498 (28.31%), Postives = 226/498 (45.38%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCL------DNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKS--CDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPG----NSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNID-VDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIG--QLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK-LLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYT-VLAKVVKPLAIQVLNKVIQPKI 1717
            C    W CDG  DC    DE+   P++CL        +F C +   C      CDG  +C D SDE NC K   K   C+S S+F C      CI    VC++ ++CG    +E        V+ C R    L P G     C +      C C  G++ +     C D++EC A    C Q+C NT GSY+C+C   Y +  H+S  C  +  ++ +L   +      +  N  +  Y+  Y   ++ V ID +D H     +FW     G++  S ++L      ++R      + D  I   ++   ++ DW+   L+WT S   +I V     +    L++  ++ P +I +DPI   +YW D G   ++ +IE   M+   R   V K+L+ P  L ID   ++LYW+D     I  I LD  +    + S + LL+PFSI +FE+ I+   +  N++  I K  S +   + A +     I V + + QP++
Sbjct: 3635 CKPLSWKCDGEDDCGDNSDET---PEMCLKFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKPSPKPRICNS-SEFKCGGTERKCISTQLVCNRFDDCGDGGSDEVACGGDQFVNECHR---PLNPCGD-DAICHDTLRGYYCECKPGFQRKATTSICEDVNEC-AQFGVCTQLCNNTKGSYKCNCSKNYIKGLHHS--CKAEGSEQMVLYIADNNEIRSLAPNNPNMAYEQAYQG-DATVRIDAMDAHVKSNRIFWTNWHMGRI--SMLELYPAGEHRHRRQTSGTVVDLDISGLKMPRGVAVDWVADNLYWTDSGRDVIEVAQLRGHYRKTLVSGMIDEPHAIVLDPIRGQMYWSDWG---NNAKIEQASMDGTRRHNFVEKDLQWPTGLAIDFMNQRLYWADAKLSVIGSIRLDGTDRVVAVDSKQGLLHPFSIEIFEDYIYGVTYVNNRVFRIHKFGSGTVVNITAGMSHATDIVVFHPLKQPEV 4115          

HSP 4 Score: 157.918 bits (398), Expect = 9.449e-40
Identity = 144/534 (26.97%), Postives = 230/534 (43.07%), Query Frame = 2
Query:  347 PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERN--CTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP--GNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEG--DRSILITLNGGRQLMIDLNTGSHF--YKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKY---RFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDW------RQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRM---HGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHF 1888
            PK C   +F+C  G  CI     CDG   C D SDE    C K     C  ++ + C    E+CI +S++CD  N+C    DE        +NC    C+        H C        C+C +G+++ PD + C D DEC A    C+Q C NT GSY CSC +GY   Q +S+ C  K    DR   + +   + ++     GS      P+     S +    D   S +   W+   +          ++  ++ +   R +N  +L+  H+ Q    M+ DWL G  ++   ++  I+V N   +    LL+  L NP++IA+DP    +++ D G     P++E   M+  N   LV   +  P  + +DL  R +YW+D     I  ++ +  N    I    + + F ++VFEN ++ T        +   +I +++  S  Y VL +VVK  A+ + ++  QP        SH C  ++     GCS ICL   S+           C C     L  D  +C  
Sbjct:    2 PKTCSPTQFVCKDGLTCISLGWRCDGEKDCPDGSDESPEICQKPNEMKC-QVNHYHC-LGTELCIHMSKLCDGNNDCPDGYDEGTHCREFAENCTVTLCR--------HKCAVTREGPACYCTVGHEVTPDEKGCKDFDEC-AVYGTCSQNCLNTDGSYSCSCVEGYLL-QPDSKSCKAKNDPVDRPAALLIANSQNVVATYLNGSIVPGLTPVATRQASAM----DFSYSEEMACWVNVGDSPTESRLHCARLAGLKGFSGERVIN-ISLNVHHVEQ----MAIDWLTGNFYFMDDVDDRIFVCNKQGDTCVTLLDLELYNPKAIALDPTMGKLFFTDYG---QIPKVERCDMDGGNCSKLVDSKIVFPHGIALDLVSRLVYWADAYLDYIEVVDYEGRNRRTIIQGPSVEHLFGLSVFENYLYATSIDNSNSPQNTTVIRVNRFNSTDYQVLTRVVKGGALHIYHRRRQPT-----GGSHPCAPDQYGKPGGCSDICLLASSHKTR-------TCRCRSGFSLGSDGKSCKM 499          

HSP 5 Score: 108.997 bits (271), Expect = 2.173e-24
Identity = 87/347 (25.07%), Postives = 165/347 (47.55%), Query Frame = 2
Query:  755 CSASPSKCNQIC-KNTPGSYECSCYDGY--RQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICL 1786
            CS +   C Q+C   +     C C  GY  + +Q N E      G   +     G R + +D    +    P+  S  SL  + +D H    T++W+      + ++K D      + +R    +++  + +G++   ++ DW+ G ++W      +I V     +   V+++QGL+ PR+IAV P    ++W + G    +PRIE   ++   R VLV+ ++  P  + +D +E KLYW D     I  I+L+T  N + ++S   +  FS++VF + I+W+D R +   SI + + ++ T +  +   + +Q+ +  +  K  E    ++ C +    GC  +CL
Sbjct: 1820 CSVNNGNCAQLCLPRSETVPTCRCTAGYNLQADQRNCE----GIGAFLLYSVHEGIRGIPLDPADKTDALVPI--SGTSLA-VGIDFHAGNDTIYWVDMGLSSIHRAKRD------QTWR----EDIITNGLGRV-EGIAVDWIAGNIYWIDQGFDVIEVARLNGSFRYVVISQGLDKPRAIAVHPDKGYLFWTEWG---QNPRIERSRLDGTERTVLVNVSIAWPNGISVDYEEDKLYWCDARTDKIERIDLETGENREVVLSTSNMDMFSVSVFGDYIYWSD-RTHANGSIKRGSKENATDVVALRTGIGVQLKDVKVFNK--ERQKGTNVCARQN-GGCEQLCL 2141          

HSP 6 Score: 96.6709 bits (239), Expect = 1.293e-20
Identity = 100/393 (25.45%), Postives = 163/393 (41.48%), Query Frame = 2
Query:  761 ASPSKCNQIC--KNTPGSYECSCYDGYRQNQHN-------SEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNI-DVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTS-SIEKIIYXXXXXXXXXXXXXXQG-LENPRSIAVDPINTGVYWIDL-----GTKKSSPRIEMMLMNTDNRRVLVS-KNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPL-AIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
              P  C+ IC   ++  +  C C  G+             +  C+ K   R  +I     R + +       F  P+    E+LVN   VD H     +++   +N  + + KID      E+   L   N+++         ++ DW+   L+WT   ++ I       ++     L +G + +PR+IAVDP++  +YW D      GTK+   +IE   M+  +R + VS K +  P  L +D+    LYW D     I  I LD           +L +PF +    +NIFWT++R   +   D I+ ++ TVL     P+  I+  ++  Q         ++AC  N   GCS +CL  P             C C  D  L  D +TC
Sbjct:  462 GKPGGCSDICLLASSHKTRTCRCRSGFSLGSDGKSCKMCITNLCLLKRLSRPGII-----RGMDVTGRVQDEFMIPI----ENLVNPRAVDFHAETGYVYFADTTNFLVARQKID----GTERETILK-TNINN------VEGIAVDWMGYNLYWTDDGLKTINVARLEKASQARRTLIEGNMTHPRAIAVDPVHGFMYWTDWEEDPKGTKRG--KIEHAWMDGTHRSIFVSSKTVLWPNGLSLDIPNGILYWCDAYFDQIERIKLDGTERKVVYDGQELSHPFGLTHHGHNIFWTEYRLGTVYRYDTISRNT-TVLRNERPPIFEIRTYDREQQKS------GTNACHVNN-GGCSILCLAVPEGR---------ACACADDQLLDADNITC 815          

HSP 7 Score: 83.9593 bits (206), Expect = 9.624e-17
Identity = 81/336 (24.11%), Postives = 129/336 (38.39%), Query Frame = 2
Query:  911 GRQLMIDLNTGSHFYKPLYNSHESLVNID------VDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCT--DMSFDWLRGLLFWTS-SIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPN-NPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
             RQ+ I    G     P YN   S    D      VD H + Q ++W             D++   I K  F+N  N+       L     ++ DW+ G L+WTS    K               + QGL+ P  +A+ PI   +YW D  T      I +  M+   + +L S+  + P+ L ID +E KLYW     G+IN   LD         + +KL  P ++A+  + ++W D    Q+ +  K    +  VL       + ++V ++ +Q   +   V +          C+ +CLP               C C     LQ D+  C 
Sbjct: 1561 ARQMEI---RGVDIDAPYYNFIISFTVPDIDNVTAVDFHGAEQRIYWS------------DVRTQTI-KRAFINGTNVETIVSADLANAHGLAVDWISGNLYWTSYDANKKQINVARMDGSFKTAVLQGLDKPHGLALHPIKGKMYWTDGDT------INVANMDGSEKAILHSQQ-KGPVGLSIDYEESKLYWISSGNGTINRCELDGSGLEIVETMKSKLTKPSALAIMGDKLWWADQASEQLGTCSKRDGSNAVVLRNSTANVMHLRVYDRDLQKGTNPCSVNN--------GNCAQLCLPRSETVPT--------CRCTAGYNLQADQRNCE 1857          

HSP 8 Score: 79.7221 bits (195), Expect = 2.141e-15
Identity = 44/107 (41.12%), Postives = 62/107 (57.94%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP 595
            CI+  W CDG+ DC  G DE +C P+ C  ++F C +G  CIP+   CD    C+D SDE NC    +++C    +F CN    +C P+S  CD +++CG N DE P
Sbjct: 3556 CIAGRWRCDGDHDCSDGSDEKDCSPR-CDHDQFQCRNG-HCIPQRWRCDADIDCIDGSDEDNCAAI-VRTCPH-HEFQCNN--TLCKPLSWKCDGEDDCGDNSDETP 3656          

HSP 9 Score: 75.0998 bits (183), Expect = 5.824e-14
Identity = 44/127 (34.65%), Postives = 69/127 (54.33%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGC 655
            C +  + CDG+ DC  G DE+NC   VCL ++F C +  +CIP +  C+G  +C D  DE++C +    +C + +QF C+   + CIP   VCD+ N+CG   DE    +   C + + +    G C
Sbjct: 3355 CTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDCPE---VTC-APNQFQCSST-KRCIPRVWVCDRDNDCGDGSDEPANCTQMTCGQEEFRCKGTGRC 3476          

HSP 10 Score: 72.0182 bits (175), Expect = 4.279e-13
Identity = 50/212 (23.58%), Postives = 91/212 (42.92%), Query Frame = 2
Query: 1106 FLNHKNLSDDHIGQLCTDMSFDWLRGL--------LFWTSSIEKIIYXXXXXXXXXXXXXXQGL------ENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVV--KPLAIQVL 1693
            F N + L +D  G+     +   + GL        L+WTS     I               + +      ++PR+  +D     ++W +    + SP I    ++  N +V+V  N+R P  L ID +  KLY+SD     I     D  +    I+ ++ ++ F +AV+ + +FWTDW +  ++  +K T     VL   +  +P+ +  L
Sbjct: 2238 FGNIQQLFNDGTGRRVIVENVGSVEGLAYHRGWDSLYWTSYTTSTITRHTVDQARPGAFDRETVVTMSADDHPRAFVMDECLNLMFWTNW--NELSPSIMRSFLSGANVQVIVGSNIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVVILRSEPVHSFGLAVYGDFVFWTDWVRRAVLRANKFTGTDVKVLRGEIPQQPMGMIAL 2447          

HSP 11 Score: 62.3882 bits (150), Expect = 4.473e-10
Identity = 42/107 (39.25%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESN--CPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG+ DC + +DESN  C  + C  N+F C SG  CIP    CD    C D+SDE     +   +C  ++QF CN     CI ++  CD  N+C    DE
Sbjct:  880 CIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASG-HCIPMSWKCDLDDDCGDRSDEPPSCAY--PTCFPLTQFACNNG--RCINMNWRCDADNDCADASDE 981          

HSP 12 Score: 61.6178 bits (148), Expect = 7.437e-10
Identity = 40/106 (37.74%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            C+   W CD + DC    DE  C P+ C ++EF C +G +CI     CDG   C D SDE++C+      CD   QF C ++G  CIP    CD   +C    DE+
Sbjct: 3517 CVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSCANG-RCIAGRWRCDGDHDCSDGSDEKDCSPR----CDH-DQFQC-RNGH-CIPQRWRCDADIDCIDGSDED 3614          

HSP 13 Score: 58.5362 bits (140), Expect = 5.975e-9
Identity = 45/124 (36.29%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  224 NCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDE-SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            NCT+S ++   D     CI   W CD   DC    DE ++CP   C   +F C +G  C     +CDG   C D SDE NC  H        SQF C +    CIP    C+ ++NCG  +DE+
Sbjct: 3302 NCTASRFVCKND----KCIPFWWKCDTEDDCGDRSDEPADCPDFKCRPGQFQCKNGI-CTNPAFICDGDNDCGDGSDEANCDVHVCLP----SQFKC-RTTHRCIPGIFRCNGQDNCGDGEDEK 3415          

HSP 14 Score: 53.9138 bits (128), Expect = 1.517e-7
Identity = 43/124 (34.68%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  233 SSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKV----CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            +S Y++C   +   C+   W CDG  DC    DE NC  K     C  + F C SG  CIP    CD    C D +DE NC       C ++  F+C  D   CI    +CD +++CG   DE+
Sbjct: 2631 ASGYVSCNSTSL--CVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGP-CIPTAWKCDREPDCDDGADELNCDM----LC-AVDHFEC--DNGKCITKRWMCDGEDDCGDRSDEK 2744          

HSP 15 Score: 52.7582 bits (125), Expect = 3.167e-7
Identity = 36/91 (39.56%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  233 SSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERN--CTKHEIKSCDSIS 499
            S DY NC    +  CI   W CD   DC+ G DE NC   +C  + F C +G +CI K  +CDG   C D+SDE++  CT    ++C +I+
Sbjct: 2675 SPDYFNCP---SGPCIPTAWKCDREPDCDDGADELNC-DMLCAVDHFECDNG-KCITKRWMCDGEDDCGDRSDEKDAHCT---FRACANIA 2757          

HSP 16 Score: 48.521 bits (114), Expect = 6.548e-6
Identity = 32/84 (38.10%), Postives = 44/84 (52.38%), Query Frame = 2
Query:  344 PPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERN--CTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            PP  C   EF C +G +CI +   CDG   C+D SDE    C +H   S     +F C  +   CIP+  +CD  N+CG ++DE
Sbjct:  823 PPPQCHPGEFACKNG-RCIQERWRCDGDNDCLDNSDEAPEICHQHTCPS----DRFKCQNN--RCIPLRWLCDGDNDCGNSEDE 899          

HSP 17 Score: 48.1358 bits (113), Expect = 8.228e-6
Identity = 38/122 (31.15%), Postives = 54/122 (44.26%), Query Frame = 2
Query:  242 YLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE-----RNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            Y+NC  +N   C+     C+G  DC    DE  C    C  +EF C  G+ CI  +  C+    C D SDE      NCT +      +     CN    +C+  + +CD  N+CG   DE+
Sbjct: 2547 YVNC--LNG-RCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGS-CIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNST-SLCVLPAWICDGANDCGDYADEK 2663          
BLAST of Low-density lipoprotein receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.2 bits (487), Expect = 7.428e-51
Identity = 148/514 (28.79%), Postives = 236/514 (45.91%), Query Frame = 2
Query:  272 NCISKDWWCDGNQDCESGKDESNC------PPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCT-NFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCT--DMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICL 1786
            +CI   W CDG+ DC    DE++       P + C ++EF C     CIP    CDG   C+D SDE+ C     ++C+  + F C  +G ICI  + VCD  N+C  N DE  G  V  CQ +       GGCSH CT      + C CP G +L  D +TC   D C A   +C+Q C+   G+ +C CYDG+R          T + D  +   +   R  +  ++  S  Y  L  S  + + ID    QS  T++W            +D++   I +  F+N   +       +     ++ DW+ G ++W      +I V     +   V++++ L+ P +IAV P    ++W + G    SPRIE  L++   R  LV+ ++  P  + ID  E KLYW D     I  ++L+T  N   ++       FS++VF ++I+W+D R     SI + + D+      +   ++ Q+    +  +  +  V   AC K+   GC  +CL
Sbjct:  161 HCIPSQWVCDGDNDCGDVSDETHTCEFPARPLRQCREDEFRCAINGNCIPLRWRCDGDADCMDISDEKECDGQR-RTCNPGTHFTCVSNG-ICIRKAWVCDGDNDCEDNSDE-AGCHVYLCQSD------KGGCSHNCTVTPVDGLVCSCPKGMQLGEDRKTCNFTDYC-ARHLRCSQRCEQEKGAVKCGCYDGWRLMLDGKSCRSTADADPFVPFIIFSTRHEIRRIDLHSRDYSVLVPSLRNAIAIDFHFGQS--TLYWTD---------VVDVRSRVIRRA-FINGTGVETIVTTDVMNTHGLAVDWISGNIYWIDHAFDVIEVARLNGSYRYVVVSEELDKPLAIAVHPQKGYLFWSEWG---HSPRIERTLLDGTERMALVNSSIASPNGISIDYDEGKLYWCDGQTDRIERVDLETGANRHVVLVATTSDMFSVSVFGSHIYWSD-RMQDSGSIKRGSKDNAADAVDLRTGISTQLNELKVYNRDRQKGVALSAC-KHTNGGCEDLCL 647          

HSP 2 Score: 170.629 bits (431), Expect = 7.011e-44
Identity = 141/578 (24.39%), Postives = 242/578 (41.87%), Query Frame = 2
Query:  272 NCISKDWWCDGNQDCESGKDESNCPPKV--CLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE----PGNSVDNCQRN------------DCKLIPN-------GGCSHF---------------------CTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIG-QLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTI-ISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKL 1861
            +CI + W CD + DC  G DE NC   V  C  +EF C+S T C P    CDG   C D SDE +        C    QF C  D  +C+ +  VCD  NNCG + DEE    P      C               D +L+ N       GG                         C +      C C  G++      +C D+DEC      C+Q+C NT GS+ CSC + + +  H+S  C   + +R+++   +  +   +     +  Y  +    +S+    + +H     +FW     G +   ++          R      +  +  G +  + ++ DW+ G L+WT S   ++ V   +      L++  +++P +IA+DP+   +YW D G   ++ +IE   M+   RR  V + ++ P  L +D   ++LYW+D     I+ I LD  +    + I   LL+PF+I VFE++I+   +  +++  + K  + +   L   +        + ++   + + +  ++ C + +   C  +CL      +NPN      C CP    L
Sbjct:  964 HCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDEFQCNS-TLCKPFSWRCDGEDDCGDNSDE-DADHCRAFQCPPRRQFRCRND-RVCVSLDRVCDGINNCGDHSDEEHCGEPARGARACTAEEFKCDSLERKCIDVRLLCNHHDDCGDGGSDEMACGGDPRVNECLSNACGFEASCHDTLQGYYCSCRPGFQWNASISSCEDVDEC-LHFGTCSQVCNNTKGSHVCSCAENFVKVHHHS--CKANDSERTMIYVADNNQVRGLSPQRANARYTQVLLGDDSVRVHSMGVHVRTARLFWTNWHLGSISSMELRPGAGRPRSVRDDTAAVVRLEIPGLRTPSGVAVDWVAGNLYWTDSGRDVVEVAQLSGQNRKTLVSGMIDDPHAIALDPVRGKMYWSDWG---NNAKIEQASMDGTRRRNFVEERVQWPTGLAVDYMNQRLYWADTKLSVISSIRLDGTDRVVAVSIKQGLLHPFAIDVFEDHIYGVTYTNSRVFRVHKFGNGTVEFLTMGLS----HATHALVFHPLKQPEAVANPCERKK---CERLCL------LNPNGA---TCNCPNGHSL 1516          

HSP 3 Score: 67.3958 bits (163), Expect = 1.260e-11
Identity = 44/116 (37.93%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNC 616
            CI   W CDG+ DC+ G DE    C    C+ + F C +  +CIP   LCDG   C +  DE N T   +++C +  QF C      CIPI+  CD  N+C  N DE P  +   C
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCKN-NRCIPMRWLCDGDNDCGENEDESN-TTCTVRTCPA-EQFTCGNGK--CIPIAWKCDLDNDCSDNSDEPPSCAYPTC 111          

HSP 4 Score: 62.3882 bits (150), Expect = 4.246e-10
Identity = 44/119 (36.97%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP-GNSVDNCQRND 628
            CI   W CD + DC    DE  C P+ C ++EF C +G +CI     CDG   C+D SDE++C+      C+   QF C ++G  CIP    CD   +C    DEE  G++V  C +++
Sbjct:  888 CIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSCANG-RCIAGRWRCDGDHDCMDGSDEKDCSLR----CEQ-DQFQC-QNGH-CIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDE 998          

HSP 5 Score: 53.1434 bits (126), Expect = 2.904e-7
Identity = 48/134 (35.82%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDES-NCPPKVCLD-NEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE-----PGNSVDNCQRNDCKLIPNGGC 655
            CI   W CD + DC    DE  +C    CL   +F C++G +CI     CD    C D SDE  C      +C + SQF C K+G  CIP   VCD  N+CG   DE      P   +  C+ ++ +   NG C
Sbjct:   83 CIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNG-RCINIRWRCDSDNDCADSSDEAGCN----NTC-ADSQFSC-KNGH-CIPSQWVCDGDNDCGDVSDETHTCEFPARPLRQCREDEFRCAINGNC 208          
BLAST of Low-density lipoprotein receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005343.1 (pep scaffold:Pmarinus_7.0:GL479201:37125:45319:-1 gene:ENSPMAG00000004851.1 transcript:ENSPMAT00000005343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 6.525e-32
Identity = 82/265 (30.94%), Postives = 133/265 (50.19%), Query Frame = 2
Query: 1160 MSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIIS-NKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK-VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKIIL 1948
            ++ DW+   L+W+ S  K +    T       L + GL+ PR+I VDPI   +YW D G      +IE   MN  NR  +V+ +++ P  + +DL  R+LYW D    +++ +++   +    + S + LL+PFSIAVFE+ ++WTD  +  I S++K T     VLA+ +  P  I V++ + QP    S    H+  ++   GC ++CLP P         P + C C  +S L  D  TC  A       T+ H +   ++L
Sbjct:   27 LAVDWIHNTLYWSDSGFKTL-SVATMDGRRRKLFDSGLQEPRAIVVDPIAGWLYWSDWGEPA---KIEKAGMNGANRHAIVTHDIQWPNGIALDLANRRLYWVDSKLHTLSSVDMSGQDRVTVLASYSDLLHPFSIAVFEDKVYWTDGEEEAIFSMNKFTGSGRRVLAENLHSPQDIVVVHPLAQPS--GSHTPHHS--RHEGSGCEYLCLPAPKVDAAL---PLFSCACADNSHLNPDGKTCSAAPQPDSNTTTPHVEGGGLVL 280          
BLAST of Low-density lipoprotein receptor vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 224.942 bits (572), Expect = 2.530e-63
Identity = 169/542 (31.18%), Postives = 256/542 (47.23%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMI-DLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTD--NRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQ--IISIDKITSDSYTVLAKVVKP-LAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C+   W CDG +DC  G DE  C    C  +EF C +G QCIP    CDGT +C D SDE+ C            +F C   G  CIP S+VCD   +C   +DE    ++D C+ +      NG CS  C +      C C  GYKLQ   R CVDIDEC A    C+Q+C+N  GS++CSC  GYR +  +   C         L +L    Q  I ++       + + +  + +V +D D   +   +FW      K+ ++++D    ++E+   +    + D        D++ DW    ++WT   + +I V   T      L + GL+ PR+I VDP    +YW D G    + RIE   M+ D   R +++S  L  P  L ID   ++LYW+D     I    LD  +  + I      +PF+I VFEN +++TDW +++  +  ++K T    T++ +V+ P + IQVL+ + QP +       + C  N   GCSH+CL   +         K+ C CP    +  D  TC
Sbjct:  219 CVLGHWRCDGEKDCSDGSDEKGCRKSNCASSEFTCANG-QCIPSSQRCDGTSNCRDSSDEKACVTPPPC---MPGEFKCQSTGR-CIPESKVCDGTRDCQDGEDEPLRCNIDECKDH------NGHCSQKCNDLTLGYNCSCFSGYKLQG-ARLCVDIDEC-AEYGTCSQVCENRKGSFKCSCLPGYRID-GDGRTCRAN----GTLPSLVYSSQFSIRNVTVSGAISQAIVSGRKGVVGLDYDYKSN--LIFWTDAKAEKINRARLD-GSGSVEE--IVGDVKVPD--------DVTVDWSGRKIYWTDGEQNMIEVAELTGAHRMTLFSSGLDEPRAIVVDPSAGYLYWTDWGY---NARIERAGMDGDASTRTIIISGELGWPNGLTIDYTIKRLYWADARLKRIESSRLDGSDR-RLIADIAPQHPFAITVFENYLYYTDWNRDERALRRVNKFTGGERTIVKRVLWPHMDIQVLHPLKQPYL------PNRCGDNN-GGCSHLCLLAAAPR-------KFSCKCPNGMNMSSDGKTC 711          

HSP 2 Score: 61.6178 bits (148), Expect = 8.686e-10
Identity = 43/115 (37.39%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  254 EDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVD--KSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            E ++   CI   W CDG  DC  G DE    PK CL ++F C +G +CI     CDG   C D  +SDE NC      +     +F C+     CI  S  CD +++CG N DE+
Sbjct:    7 ECVSDQKCIVLRWRCDGEDDCSDGSDEQG-SPKTCLQDQFTCRNG-KCIQATWKCDGEDDCRDGYRSDESNCGNVTCGA----DEFMCSN--RKCISRSWTCDNQDDCGDNSDED 113          

HSP 3 Score: 59.6918 bits (143), Expect = 3.064e-9
Identity = 40/105 (38.10%), Postives = 50/105 (47.62%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CIS+ W CD   DC    DE     + C  N+F C +G  CI     CDG   C D SDE+  +    KSC  I++F C      CIP    CD  N+C  + DE
Sbjct:   93 CISRSWTCDNQDDCGDNSDEDRNVQRTCASNQFTCSNG-DCISNSWTCDGDNDCNDGSDEKE-SLCASKSC-KITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDE 194          
BLAST of Low-density lipoprotein receptor vs. Ensembl Nematostella
Match: EDO48069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ9])

HSP 1 Score: 220.705 bits (561), Expect = 2.016e-62
Identity = 177/563 (31.44%), Postives = 267/563 (47.42%), Query Frame = 2
Query:  227 CTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSIS-----QFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDN-RTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTD--NRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITS-DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICL--PFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C SS+Y      +   CI K W CDG  DC +  DE+NC    C  ++F C +  +CIP    C+G   C+D SDE +C    + +    S     +F C    + CIP S+VCD   +C  + DE      DNC  N+CK   NG C H+C +  T   C C  GYK+  D+ ++C D+DEC A P  C+Q+C N+ GSY+C+C +GYR  + + + C    GD+  L+  N  RQ +  L   S  +  +     + + +D D   +   ++W       +  + ++   N       +N   L+ D I       + DW+   L+WT +   +I V N        L+  GL+ PR+I V P    ++W D G +   P+IE   MN D   R  +V+ N+  P  L ID    K++W+D    +I   NLD     + I S+ + +PF+I VF++ I+WTDW +  I   +K    D   V + +  P+ I V  +  QPK       S+ C +N   GCSH CL  P P +         + C CP +  L  D  TC
Sbjct:  122 CKSSEY----QCSTGECIHKSWVCDGEFDCLNKSDENNCHSSACHISQFTC-ANKRCIPMRDRCNGNNDCLDNSDEADCRMFSLLATKPPSICKDGEFQCGSSKQ-CIPESKVCDGSVDCTNSADEP-----DNCFINECK-DNNGPCQHYCNDTKTGYFCSCRPGYKVALDDPKSCRDVDEC-AIPGSCSQMCFNSKGSYKCTCMEGYRL-EPDKKTC-KALGDKPFLLFTN--RQDIRRLVMDSSDFTQVVPKLRAAIALDYDF--ATGVIYWSDVIEASIKSAPLN---NGSAVETIVNMSLLTPDGI-------AVDWVNRKLYWTDTGTDVIEVANLDGRERMRLITTGLQEPRAIVVYPAIGYMFWTDWGEE---PKIERCGMNGDPKTRLQIVNTNILWPNALTIDYTIDKIWWADAKEHTIECANLDGTAR-RVITSDSVHHPFAITVFQDYIYWTDWVKESIYKANKFNGKDRSLVCSGLYSPMDIHVYQQQKQPKF------SNPCGENN-GGCSHTCLLAPLPKS---------HTCHCPPNINLLEDSATC 635          
BLAST of Low-density lipoprotein receptor vs. Ensembl Nematostella
Match: EDO43938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB8])

HSP 1 Score: 215.698 bits (548), Expect = 3.074e-60
Identity = 169/552 (30.62%), Postives = 255/552 (46.20%), Query Frame = 2
Query:  251 CEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDS----ISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKI--DLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVS-KNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLA-KVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C D N   C+ + W CDG +DC  G DE+ C    C  +EF C +  +CIP    CDGT +C D SDE+ C K+   +          F C     ICI  S+VCD   +C   +DE       NC  ++CK   NG C   CTN  T   C C  GY+L  D ++C DI+EC   P  C+Q C NT GS++CSC +GY   + +   C        +L T     +L++   T    YK      +    +  D+ +S   ++W  ++   + ++K+  D  +  + +   +    L            + DW+   ++W       I V+    + T  L++ GL+ P ++ +DP    +YW D G      +IE   M+   R+VL+S ++L +P  L ID   R+LYW D     I   NL+     + +I+  +  P +I VFE++I+WTD R  +I   +K T  + TVL      P    + +   QP       T+ +    R  GCSH+CL      I+ N+  KY C CPKD  LQ D   C
Sbjct:  173 CADGNG--CVHRRWICDGERDCLDGSDEAGCGTIGCSSDEFTC-TNQKCIPLPQKCDGTDNCGDGSDEKMCRKYLFSTQPGQVCPRDHFRCGS-STICIANSKVCDATPHCPHGEDER------NCDIDECKSF-NGHCLQLCTNTKTSFYCSCFSGYELMDDRKSCRDINECEI-PGMCSQKCYNTKGSFKCSCMEGYVL-EPDGRRCKALGPRPYVLFTDRNSIRLIM---TDGKEYKQAVQGLKDARTLGFDVKES--MLYWTDKAATAIQKAKMVPDTTIETVHETGLVEPAGL------------AIDWVGRKMYWADPGANTIEVSELDGSNTMTLISSGLDKPSAVVLDPTEGFIYWTDWG---DPAKIERASMDGTARKVLISGEHLERPAGLAIDYSTRRLYWIDSKLDVIKHCNLNG-TEVRVVINTGIDNPTAITVFEDHIYWTDSR--KIYKANKFTGKNMTVLVNNAASPEDAHIYHPQRQP-------TASSPCAIRNGGCSHLCL------ISSNKN-KYSCNCPKDLFLQLDGKIC 674          

HSP 2 Score: 64.3142 bits (155), Expect = 1.154e-10
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  233 SSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE-----PGNSVDNCQRNDCKLIPNGGCSH 661
            S++   C+D     CI+  + CD   DC    DE  C  K C   EF C    +CIP    CD    C+D SDE+NC ++  K+C+ ++   C ++G  C+    +CD  ++CG + DE+     P      C++N+       GC H
Sbjct:   40 SANEFRCDD---GRCITSTFRCDREFDCTDRSDERGCVNKTCAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDEQNC-QNAAKTCNPVTDHTC-RNGR-CVLKEWLCDGMDDCGDSSDEDNCLTRPTPPPVKCRKNERMCADGNGCVH 181          

HSP 3 Score: 61.2326 bits (147), Expect = 1.235e-9
Identity = 41/106 (38.68%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            C+   + CDG  DC    DES  P   C  NEF C  G +CI     CD  F C D+SDER C     K+C +  +F C   G  CIP    CD +++C    DE+
Sbjct:   13 CVPNSFRCDGENDCGDRSDESE-PTTTCSANEFRCDDG-RCITSTFRCDREFDCTDRSDERGCVN---KTC-APYEFTCAFSGR-CIPGRFRCDHRSDCLDGSDEQ 111          
BLAST of Low-density lipoprotein receptor vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 210.305 bits (534), Expect = 1.021e-58
Identity = 154/520 (29.62%), Postives = 243/520 (46.73%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIK----SC--------------------DSISQFDCNKDG-----------EICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVL-VSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTII---SNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVL-AKVVKPLAIQVLNKVIQPK 1714
            CI   W CDG+ DC  G DE  CPPK C D++F C +G QCI     CDG   C DKSDERNCT    K    +C                    D   + DC  +              CI  S+VCD + +C    DE PG  +D C  N      NGGC+  C +    ++C C  G+ L  DN+TC DI+EC  S S C+Q C NT GS+ C C  GYR  + +   C   +  R  L   +  R++       S  Y        + + ID D  +  + ++W          S +  KV +   +     ++L  D +      ++ DW+   L+W+      I V+        VLL++ +E+PR + +D     ++W D GT   SPR+E   ++  NR V+     +  P  L +DL  +++YW  ID    + ++ +   + K I+   S ++ +PF++ +FE+ ++WTDW+   ++ + K+  ++ T+L A V KP+ I  ++ + QP+
Sbjct:  137 CIPLRWRCDGDGDCSDGADERGCPPKNCTDSQFSCSNG-QCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGRHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDEGPGCGLDQCHSN------NGGCAQLCMDVPEGVQCSCRPGFTLASDNKTCEDINECLNS-SSCSQRCFNTRGSFSCKCVQGYRL-EPDKRRCKAADSIRPFLY-FSTRREIRKLGLPPSQSYTFAVRRLRNTIGIDFDWRE--KRLYW----------SDVYKKVISRSYFNGTGREDLITDAL-ITAEGVAVDWIGRNLYWSDMRSDRIEVSTLEGKWRRVLLSEDVESPRGLVLDSNAGYLFWTDWGT---SPRVERSWLDGSNRFVISFGIKIVWPNGLTLDLATKRVYW--IDAKLDHIVSCEYDGSSKRIVLSGSRQINHPFAMTLFEDYLYWTDWQNKHVLRVSKLHGENVTLLSAGVSKPMDIHAVHPLRQPR 628          

HSP 2 Score: 60.8474 bits (146), Expect = 1.491e-9
Identity = 43/112 (38.39%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  272 NCISKDWWCDGNQDCESGKDE---SNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCV--DKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            +CIS  W CDG  DC    DE   + C    C  +EF C +  +CIP    CDG + C+  D SDE NC+   + +  S S F C  +G+ C P   VCD  ++CG   DE+
Sbjct:   12 HCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCS---VATNCSASMFRC-ANGQ-CKPRDWVCDGFDDCGDGSDEK 118          
BLAST of Low-density lipoprotein receptor vs. Ensembl Nematostella
Match: EDO49499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB1])

HSP 1 Score: 182.956 bits (463), Expect = 1.776e-48
Identity = 161/600 (26.83%), Postives = 256/600 (42.67%), Query Frame = 2
Query:  272 NCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDE-RNCTKHEIKSCDSISQFDCN-----------------KDGE---------------------ICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQ----LCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVK-PLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC-----HFANHRQQKITSIH 1924
             CI+  W CDG+ DC    DE NC    C   +FLC +G  CIPK  +CDG   C D SDE  NC+ H    CD   +F C                   DG                       CIP+S VCD  N+CG N DE       +C   DCK      CS  C       +C C  GY +  D  TC DI+ECS S  +C+  C NTPGSY+C+C +GY   + ++   +       I       RQ+ +D   G+ +   + N   +   I VD     + ++W             D++ N I +  +    +     + +    +   ++ DW+   L++  S  + IYV+    ++ + L+   L  PR IAVDP    ++W D      + RIE   M+  +R +L   N+     L +D   + +YW +     I  ++ D     +   +  +++PF IA++ N +F++DW ++ IISI+K T +  T L   ++ P+ +Q+L+   QP +      S+        GC  +CL    +           C C    +L  D+ +C          R+ +I+++H
Sbjct:  173 GCIASRWVCDGDNDCGDNSDELNCTRLTCPPTKFLCANG-MCIPKSAVCDGENDCGDMSDEPSNCSAH---ICDPKLEFQCANGRCINKKWRCDGMKDCADGSDESTCGEGTCRPDEWHCIGTSRCIPLSRVCDGTNDCGDNYDEG-----SHCLDLDCK---KKNCSQRCVQTPRGGECRCFPGYTISKDLITCKDINECS-SIGRCDHFCYNTPGSYKCACDEGYVLERPHTCKPVGPYKPWLIFSNCKDIRQVSLD---GTQYDLLIRNLTRA---ISVDFDWLEKKVYW------------TDVRENAIYRQNYTWASSSFATTVIRTGLAMPVGLAVDWVGRNLYFVESSVRRIYVSKLDGSMRTSLITTDLSKPRGIAVDPRVGYLFWTDW----EAHRIERANMDGSSRVILAKTNVYWANTLTLDYTLQTVYWVEAHLDYIGAMSYDGLKRREVRHNGDIIHPFGIAIYRNELFFSDWVRHAIISINKFTGNGTTKLVSNLEVPMGLQILHPSRQPAMPNPCSPSNC-------GCQQLCLVTVESGCT--------CRCQTGYQLAPDQKSCVEIDTFLLYARRTEISAVH 722          
BLAST of Low-density lipoprotein receptor vs. Ensembl Medaka
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:100125475])

HSP 1 Score: 251.136 bits (640), Expect = 2.194e-71
Identity = 183/539 (33.95%), Postives = 275/539 (51.02%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNK-LLYPFSIAVFENNIFWTDWRQNQIISIDKIT-SDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH 1885
            CI K W CDG+ DC+ G DE+NCP + C  ++F C  G+ CIP    C+G   C D SDE +C    +  C    +F C + GE CI +S+VC+K  +C    DE     +  C  N+C L+ NGGCSH C +     +C C  G +L  D++TC DI+EC  +P  C+QIC N  G Y+C C++GY+ +           G    LI  N  R+ +  L      Y  +     + V +D D +Q  QT+FW       LGQ  I   V + ++     HK + ++   Q    ++ DW+    +WT    K I V+N    +  VL NQGL+ P SIAVDP++  +YW D G      +IE   MN  +R+VLV  +++ P  + +DL + +LYW D     +  ++L+  N  K + S + L +PF++ VFE+ +FWTD     I   +K + SD  T+ + +  P  I V +++IQ        T+    +    GCS +CLP P   +N +  PKY C+CP+  +L  D   C 
Sbjct:  251 CIHKKWRCDGDPDCKDGSDEANCPVRTCGPDQFKCEDGS-CIPGSRQCNGIRDCTDGSDEVDC--KNLSQCSGPEKFKC-RSGE-CIDMSKVCNKVRDCPDWSDE----PIKECNVNEC-LLNNGGCSHICKDMVIGFECDCTPGLQL-IDHKTCGDINEC-MNPGICSQICINLKGGYKCECHNGYQMDPTTG--VCKAVGKEPCLIFTN--RRDVRRLGLERKEYTQIVKQQRNAVALDADFNQ--QTIFW-----ADLGQKAIFSTVLD-KRGDVGTHKTVIENV--QTPVGIAVDWIYRNFYWTDLGTKTISVSNFNGTIQKVLFNQGLKEPASIAVDPLSGFLYWSDWG---EPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRKKVLQSPEYLAHPFALTVFEDRVFWTDGENQAIYGANKFSGSDVVTLASNLNDPQDIIVYHELIQLS-----GTNWCTERGVNGGCSFMCLPAP--QVNKHS-PKYTCVCPEGQELAADGFRCR 752          

HSP 2 Score: 74.3294 bits (181), Expect = 2.956e-13
Identity = 42/105 (40.00%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            CI   W CDG  DC  G DE +C  K C + +F+C +G QC+PK   CDG   C D SDE     H +++C  +++F C      CIP+S  CD + +C    DE
Sbjct:   45 CIPSIWQCDGEDDCTDGSDEKSCVQKTCAEVDFVCRNG-QCVPKRWHCDGEPDCEDGSDESLEICH-MRTC-RVNEFSCGAGTTQCIPVSWKCDGEKDCDNGDDE 146          
BLAST of Low-density lipoprotein receptor vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 245.743 bits (626), Expect = 3.753e-69
Identity = 183/539 (33.95%), Postives = 268/539 (49.72%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISN--KLLYPFSIAVFENNIFWTDWRQNQIISIDKITS-DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C+  +W CDG+ DC+   DE+NCP   C  +EF C  GT CI     C+    C D SDE  C    I  CD   +F C K+GE CI  S+VCD   +C    DE P      C  N+C    NGGCSH C +     +C CP GYKL  D +TC DIDEC  +P  C+QIC N  G Y+C CY+GY  +   S+ C    G+   L+  N      IDL      Y  +  + ++ V +DVD+  S   MFW    + K+  + I+   ++ ++   ++  +  +         ++ DW+   ++WT S  K I V         VL+   L  PR+IAVDP    +YW D G      +IE   MN  +R+VLVS ++  P  + +DL  R+LYW D     ++ ++L +  N K ++S+   L +PF++ VFE+ +FWTD  +  I S++++T  D   V   +  PL + V ++  QPK    D  +   L N   GC ++CL  P  +   +  PKY C CP   +L  D   C
Sbjct:  197 CVHMNWKCDGDADCKDKSDEANCPLLTCRPDEFQCGDGT-CIHGTKQCNKVHDCPDYSDEAGCVN--ITKCDGPRKFRC-KNGE-CIDSSKVCDNVKDCKDWSDEPP----KECGLNEC-ADNNGGCSHICRDRRIGHECDCPSGYKLL-DKKTCGDIDECE-NPDACSQICINYKGDYKCECYEGYEMDP-ASKTC-KAVGNSPYLMFTNRHEIRRIDLLRSE--YTQVVPTLKNAVALDVDV--STNKMFWCDLYHRKIYSAYINKASDSSQQVTLIDSLHSPE--------GLAVDWVHKNIYWTDSGNKSISVATGDGRKRKVLIATELSEPRAIAVDPHQGFMYWSDWGEHA---KIEKAGMNGVDRQVLVSDHIEWPNGITLDLSNRRLYWVDSKLHLLSSVDL-SGGNRKVLLSSHHHLGHPFALTVFEDRVFWTDLEEEAIYSVNRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKA--PDTCNMGSLPN--GGCEYLCLKAPQIT---DHSPKYTCACPDGMELGPDMRRC 698          

HSP 2 Score: 65.4698 bits (158), Expect = 1.642e-10
Identity = 45/122 (36.89%), Postives = 57/122 (46.72%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDESNCP--PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRN 625
            A  C+S  W CDG +DCE+G DE  C    K C   +F C +G +CI    +CDG   C D SDE  C+     +C    +F CN     CIP    CD   +C    DE    S + C R 
Sbjct:   67 ASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG-KCIGPTFVCDGDNDCGDSSDEEKCSS---PTCGQ-HEFRCNN--SECIPALWSCDGDPDCKDKSDE----SAERCSRG 177          

HSP 3 Score: 56.9954 bits (136), Expect = 6.540e-8
Identity = 38/109 (34.86%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESN--CPPKVCLDNEFLC-HSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            C+   W CDG  +C  G DE++  C  + C   +F C  + ++C+     CDG   C + +DE  C   + K+C S   F C ++G+ CI  + VCD  N+CG + DEE
Sbjct:   27 CLPSKWRCDGEPECADGSDEADAICSRQTCPPEKFDCGGAASKCVSLSWRCDGERDCENGADEEQCAA-DAKACAS-KDFQC-RNGK-CIGPTFVCDGDNDCGDSSDEE 131          
BLAST of Low-density lipoprotein receptor vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 245.743 bits (626), Expect = 4.604e-69
Identity = 183/539 (33.95%), Postives = 268/539 (49.72%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISN--KLLYPFSIAVFENNIFWTDWRQNQIISIDKITS-DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C+  +W CDG+ DC+   DE+NCP   C  +EF C  GT CI     C+    C D SDE  C    I  CD   +F C K+GE CI  S+VCD   +C    DE P      C  N+C    NGGCSH C +     +C CP GYKL  D +TC DIDEC  +P  C+QIC N  G Y+C CY+GY  +   S+ C    G+   L+  N      IDL      Y  +  + ++ V +DVD+  S   MFW    + K+  + I+   ++ ++   ++  +  +         ++ DW+   ++WT S  K I V         VL+   L  PR+IAVDP    +YW D G      +IE   MN  +R+VLVS ++  P  + +DL  R+LYW D     ++ ++L +  N K ++S+   L +PF++ VFE+ +FWTD  +  I S++++T  D   V   +  PL + V ++  QPK    D  +   L N   GC ++CL  P  +   +  PKY C CP   +L  D   C
Sbjct:  223 CVHMNWKCDGDADCKDKSDEANCPLLTCRPDEFQCGDGT-CIHGTKQCNKVHDCPDYSDEAGCVN--ITKCDGPRKFRC-KNGE-CIDSSKVCDNVKDCKDWSDEPP----KECGLNEC-ADNNGGCSHICRDRRIGHECDCPSGYKLL-DKKTCGDIDECE-NPDACSQICINYKGDYKCECYEGYEMDP-ASKTC-KAVGNSPYLMFTNRHEIRRIDLLRSE--YTQVVPTLKNAVALDVDV--STNKMFWCDLYHRKIYSAYINKASDSSQQVTLIDSLHSPE--------GLAVDWVHKNIYWTDSGNKSISVATGDGRKRKVLIATELSEPRAIAVDPHQGFMYWSDWGEHA---KIEKAGMNGVDRQVLVSDHIEWPNGITLDLSNRRLYWVDSKLHLLSSVDL-SGGNRKVLLSSHHHLGHPFALTVFEDRVFWTDLEEEAIYSVNRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKA--PDTCNMGSLPN--GGCEYLCLKAPQIT---DHSPKYTCACPDGMELGPDMRRC 724          

HSP 2 Score: 65.4698 bits (158), Expect = 1.547e-10
Identity = 45/122 (36.89%), Postives = 57/122 (46.72%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDESNCP--PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRN 625
            A  C+S  W CDG +DCE+G DE  C    K C   +F C +G +CI    +CDG   C D SDE  C+     +C    +F CN     CIP    CD   +C    DE    S + C R 
Sbjct:   93 ASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG-KCIGPTFVCDGDNDCGDSSDEEKCSS---PTCGQ-HEFRCNN--SECIPALWSCDGDPDCKDKSDE----SAERCSRG 203          
BLAST of Low-density lipoprotein receptor vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 243.817 bits (621), Expect = 7.472e-69
Identity = 174/540 (32.22%), Postives = 271/540 (50.19%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILI--TLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISN-KLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVK-PLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            CI   W CDG  DC+   DE NC   VCL+ +F C  G+ C+   L C+    C D SDE +C+     +CD+ S+F C+  GE CI +  VCDK  +C    DE P +S   C  N+C    NGGCSH C +      C CP GYKL+ D R C DI+EC A    C+QIC N PGSY+C C  GY+ +   S  C  + G    L+  T +  R++++D +        L N+      +D+D+ Q  +T++W   S  K+   +++L  ++ +    ++    + + I       + DW+ G ++WT S  K I V +T       L+ + L+ PR+I +DP+N  VYW D G      +IE   +N   R  LV++N+  P  + +D+  ++LYW D    ++  I+++     + ++ N +  +PFS+ VFE+ +FWTD     I S  ++T  + T +A  +  P  I + + + QP      +  + C   +   C  +CLP P  +      PKY C CP D  L  D  +C
Sbjct:  208 CIPGSWRCDGGIDCDDRSDELNCSRPVCLEGQFQCGDGS-CLQGNLKCNSVRDCSDGSDETDCST----ACDAPSEFKCSS-GE-CISMENVCDKTKDCSDGSDE-PESS---CGINECS-TANGGCSHHCNDLKIGFNCSCPAGYKLKADQRNCEDINEC-AEADTCSQICINLPGSYKCDCEWGYKIDPV-SNTCKAESGTVPALLFTTRHDVRKILVDHSEYVQVIPGLKNA----AALDMDMAQ--KTLYWSDVSLKKI--FRLNLADSSSKPVTVIDSGIETPEGI-------AVDWVHGNIYWTDSTLKTISVASTDGTKRKTLIRENLDKPRAITIDPVNNFVYWTDWGHHA---KIEKSGLNGAGRVALVTENIVSPNGITLDMVNQRLYWVDSKLHTVFSIDVNGGTRHRVVVINQRPSHPFSLTVFEDKVFWTDTGLRGIYSASRLTGRNLTQIAGDLDHPEDIILYHNLKQP------IGINWCNSGK-DSCEFLCLPAPQANTT---SPKYSCACPDDMSLGPDMRSC 705          

HSP 2 Score: 74.7146 bits (182), Expect = 2.683e-13
Identity = 44/107 (41.12%), Postives = 57/107 (53.27%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEP 595
            C+ K W CDG  DC +G DE NC  K C ++EF C +G QCI    +CD    C D SDE  C+K    +C+ +S F CN    +C+P    CD   +C    DE P
Sbjct:   85 CVPKSWHCDGKADCSNGADEKNCTVKQCKNDEFRCANG-QCISLSFVCDNDNDCSDGSDETTCSK---PTCNPLS-FQCNN--SVCVPSLWRCDGDEDCADGSDEWP 184          

HSP 3 Score: 72.7886 bits (177), Expect = 8.250e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDE--SNCPPKVCLDNEFLCHSG-TQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDE 589
            C+++ W CDG  DC  G DE  S C  K CL ++F C +   QC+PK   CDG   C + +DE+NCT  + K+     +F C  +G+ CI +S VCD  N+C    DE
Sbjct:   42 CVTRRWICDGTDDCGDGTDELLSTCASKTCLPSQFNCGAPINQCVPKSWHCDGKADCSNGADEKNCTVKQCKN----DEFRC-ANGQ-CISLSFVCDNDNDCSDGSDE 143          
BLAST of Low-density lipoprotein receptor vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 245.358 bits (625), Expect = 9.393e-69
Identity = 183/539 (33.95%), Postives = 268/539 (49.72%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISN--KLLYPFSIAVFENNIFWTDWRQNQIISIDKITS-DSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 1882
            C+  +W CDG+ DC+   DE+NCP   C  +EF C  GT CI     C+    C D SDE  C    I  CD   +F C K+GE CI  S+VCD   +C    DE P      C  N+C    NGGCSH C +     +C CP GYKL  D +TC DIDEC  +P  C+QIC N  G Y+C CY+GY  +   S+ C    G+   L+  N      IDL      Y  +  + ++ V +DVD+  S   MFW    + K+  + I+   ++ ++   ++  +  +         ++ DW+   ++WT S  K I V         VL+   L  PR+IAVDP    +YW D G      +IE   MN  +R+VLVS ++  P  + +DL  R+LYW D     ++ ++L +  N K ++S+   L +PF++ VFE+ +FWTD  +  I S++++T  D   V   +  PL + V ++  QPK    D  +   L N   GC ++CL  P  +   +  PKY C CP   +L  D   C
Sbjct:  264 CVHMNWKCDGDADCKDKSDEANCPLLTCRPDEFQCGDGT-CIHGTKQCNKVHDCPDYSDEAGCVN--ITKCDGPRKFRC-KNGE-CIDSSKVCDNVKDCKDWSDEPP----KECGLNEC-ADNNGGCSHICRDRRIGHECDCPSGYKLL-DKKTCGDIDECE-NPDACSQICINYKGDYKCECYEGYEMDPA-SKTC-KAVGNSPYLMFTNRHEIRRIDLLRSE--YTQVVPTLKNAVALDVDV--STNKMFWCDLYHRKIYSAYINKASDSSQQVTLIDSLHSPE--------GLAVDWVHKNIYWTDSGNKSISVATGDGRKRKVLIATELSEPRAIAVDPHQGFMYWSDWGEHA---KIEKAGMNGVDRQVLVSDHIEWPNGITLDLSNRRLYWVDSKLHLLSSVDL-SGGNRKVLLSSHHHLGHPFALTVFEDRVFWTDLEEEAIYSVNRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKA--PDTCNMGSLPN--GGCEYLCLKAPQIT---DHSPKYTCACPDGMELGPDMRRC 765          

HSP 2 Score: 65.0846 bits (157), Expect = 2.084e-10
Identity = 45/122 (36.89%), Postives = 57/122 (46.72%), Query Frame = 2
Query:  266 AVNCISKDWWCDGNQDCESGKDESNCP--PKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRN 625
            A  C+S  W CDG +DCE+G DE  C    K C   +F C +G +CI    +CDG   C D SDE  C+     +C    +F CN     CIP    CD   +C    DE    S + C R 
Sbjct:  134 ASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG-KCIGPTFVCDGDNDCGDSSDEEKCSS---PTCGQ-HEFRCNN--SECIPALWSCDGDPDCKDKSDE----SAERCSRG 244          

HSP 3 Score: 56.6102 bits (135), Expect = 1.085e-7
Identity = 32/89 (35.96%), Postives = 43/89 (48.31%), Query Frame = 2
Query:  332 ESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERN--CTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEE 592
            E NCP K C   +F C +G QC+P    CDG   C D SDE +  C++          +FDC      C+ +S  CD + +C    DEE
Sbjct:   74 EENCPKKTCATTDFTCKNG-QCLPSKWRCDGEPECADGSDEADAICSRQTCPP----EKFDCGGAASKCVSLSWRCDGERDCENGADEE 157          
BLAST of Low-density lipoprotein receptor vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 1293.1 bits (3345), Expect = 0.000e+0
Identity = 662/667 (99.25%), Postives = 664/667 (99.55%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANH-RQQKITSIHSKRLKIILGVXXXXXXXXXXXXXXXCVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA 2215
            NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCL+NEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEM+LMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN  RQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA
Sbjct:   19 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCMKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANQDRQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA 685          
BLAST of Low-density lipoprotein receptor vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 1262.67 bits (3266), Expect = 0.000e+0
Identity = 649/666 (97.45%), Postives = 651/666 (97.75%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKIILGVXXXXXXXXXXXXXXXCVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA 2215
            NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCL+NEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEM+LMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQ              LSELLASDVSSTATA
Sbjct:   19 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCMKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQ--------------LSELLASDVSSTATA 670          
BLAST of Low-density lipoprotein receptor vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 1255.74 bits (3248), Expect = 0.000e+0
Identity = 648/667 (97.15%), Postives = 650/667 (97.45%), Query Frame = 2
Query:  218 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANH-RQQKITSIHSKRLKIILGVXXXXXXXXXXXXXXXCVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA 2215
            NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCL+NEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEM+LMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFAN  RQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQ              LSELLASDVSSTATA
Sbjct:   19 NENCTSSDYLNCEDINAVNCISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCMKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCHFANQDRQQKITSIHSKRLKIILGVSISLLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCNSHSSQ--------------LSELLASDVSSTATA 671          
BLAST of Low-density lipoprotein receptor vs. Planmine SMEST
Match: SMESG000062507.1 (SMESG000062507.1)

HSP 1 Score: 259.996 bits (663), Expect = 1.842e-76
Identity = 166/520 (31.92%), Postives = 282/520 (54.23%), Query Frame = 2
Query:  275 CISKDWWCDGNQDCESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEI-CIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCI--TKEGDRSILITLNGGRQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMF-WIQQSNGKLGQSKIDLKVNNIEKY--RFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPN--NPKT--IISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVL----NKVIQPKIHESDVTSHACLKNRMHGCSHICLP 1789
            CISK W CD NQDC+   DE NCPP +C  N+F C     CIP+  LCDG   C++  DE NCT   I SC+  + ++C    ++ CI I ++C+   NC  N+D     S++NC+ + CK   N  CSH C N ++   C CP   +L  DNR C  I++C  +P  C+Q C++   SY C CYDGY +N      C+  T+E + ++L +       +   N   H+  K ++   + + ++DV+L+++    +  +   +  L  SK+     N++ Y     N +N+  +         + D  R LLF+T   +  IYV N TS     ++++    P +I +DP+   ++WIDLG + + P+I+M  M+   +  L+ K +++P  L ID++E++LYW+D  P +I +I++++ +  N KT  +++ +  +PFSI +F N I+W+D ++++I S  KIT     V+ K VKP+ ++++    N+ +  KI+E  +  +      ++ C   CLP
Sbjct:   36 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT--NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-----SLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTENDQK---CVPTTEENEINLLYSSFSSIYSVSIFNLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYC--SGVINTCRGSCLP 542          
BLAST of Low-density lipoprotein receptor vs. Planmine SMEST
Match: SMESG000013396.1 (SMESG000013396.1)

HSP 1 Score: 245.743 bits (626), Expect = 1.525e-69
Identity = 183/572 (31.99%), Postives = 279/572 (48.78%), Query Frame = 2
Query:  251 CEDINAVNCISKDWWCDGNQDC-ESGKDESNCPPKVCL-DNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCT---KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRT-CVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQ-QSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTS-SIEKIIYXXXXXXXXXXXXXXQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTCH-FANHRQQKITSIHSKRLK 1939
            C   + V CI+K+W CDG+ DC E+ +DE NC    C  D    C +   C      CDG   C D SDE+ C+   +H++ SCD  ++F C K+   CI    VCDK N+CG   DE PG   +NC +N CK I NG C   C NF+++ KC C  GY++   N T C+DIDEC A    C+  C N  GSY+C C++G+  ++ N + C+       +  T N  R+L +  +     Y P  N   + + I +D     + +FW Q + N ++ Q    +      K R L H  +           +++DW+ GLLFW+     +I  +  T     +++        RSI V P    ++W D G +   P+IE M M+  +R+VL+   L  P  L +D     LYW D     I+  NL T    + ++S+   + F I VFE+ ++ +DW   +II I K T     +L    KP+ +++ +++ QP   E     +AC+    H C ++CLP    S+N     K++C+CP  S L  D  TC    +   +K  S+ S  LK
Sbjct:  213 CGSGSTVPCIAKEWRCDGSYDCPETYRDELNCTNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEKFCSNPSQHDV-SCDPFNEFKCVKNN-TCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCK-INNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDEC-ADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQ-CLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSP-KNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVHSRIHSP------VGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE---PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQR-RDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPKPMGVKLFHQLAQPVNIE-----NACIN---HTCQYLCLP---TSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTISVSSSSLK 756          
The following BLAST results are available for this feature:
BLAST of Low-density lipoprotein receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRP81.708e-6731.93LDL receptor related protein 8 [Source:HGNC Symbol... [more]
VLDLR3.919e-6531.38very low density lipoprotein receptor [Source:HGNC... [more]
LRP84.116e-6531.86LDL receptor related protein 8 [Source:HGNC Symbol... [more]
VLDLR8.920e-6531.37very low density lipoprotein receptor [Source:HGNC... [more]
LDLR1.166e-6429.72low density lipoprotein receptor [Source:HGNC Symb... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T13C2.61.023e-4929.39pep chromosome:WBcel235:II:6783427:6788255:1 gene:... [more]
T13C2.61.186e-4929.39pep chromosome:WBcel235:II:6783427:6788255:1 gene:... [more]
lrp-12.322e-4427.32Low-density lipoprotein receptor-related protein ... [more]
lrp-22.053e-4126.77Low-density lipoprotein RecePtor related [Source:... [more]
rme-24.443e-3925.13Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LpR13.353e-7632.74gene:FBgn0066101 transcript:FBtr0113480[more]
LpR11.107e-7532.74gene:FBgn0066101 transcript:FBtr0335238[more]
LpR11.181e-7532.74gene:FBgn0066101 transcript:FBtr0335237[more]
LpR11.247e-7532.74gene:FBgn0066101 transcript:FBtr0301466[more]
LpR11.585e-7532.74gene:FBgn0066101 transcript:FBtr0335235[more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldlrb5.510e-7433.21low density lipoprotein receptor b [Source:ZFIN;Ac... [more]
vldlr1.420e-7034.32very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr1.606e-7034.24very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr1.685e-7034.24very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr4.467e-7034.32very low density lipoprotein receptor [Source:ZFIN... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRP82.484e-7332.21LDL receptor related protein 8 [Source:NCBI gene;A... [more]
LRP82.223e-7232.21LDL receptor related protein 8 [Source:NCBI gene;A... [more]
LRP81.017e-7132.04LDL receptor related protein 8 [Source:NCBI gene;A... [more]
LRP81.841e-7132.04LDL receptor related protein 8 [Source:NCBI gene;A... [more]
LRP83.733e-7132.59LDL receptor related protein 8 [Source:NCBI gene;A... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrp88.214e-7132.19low density lipoprotein receptor-related protein 8... [more]
Lrp84.475e-6932.00low density lipoprotein receptor-related protein 8... [more]
Lrp84.475e-6932.00low density lipoprotein receptor-related protein 8... [more]
Lrp83.092e-6830.92low density lipoprotein receptor-related protein 8... [more]
Vldlr1.217e-6631.56very low density lipoprotein receptor [Source:MGI ... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98931|LRP8_CHICK3.960e-7034.14Low-density lipoprotein receptor-related protein 8... [more]
sp|Q924X6|LRP8_MOUSE3.131e-6832.00Low-density lipoprotein receptor-related protein 8... [more]
sp|P20063|LDLR_RABIT4.826e-6631.18Low-density lipoprotein receptor (Fragment) OS=Ory... [more]
sp|P98165|VLDLR_CHICK1.847e-6531.49Very low-density lipoprotein receptor OS=Gallus ga... [more]
sp|P98156|VLDLR_MOUSE5.658e-6531.55Very low-density lipoprotein receptor OS=Mus muscu... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMJ90.000e+097.30Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A0P8ZZH46.715e-8133.39Uncharacterized protein, isoform H OS=Drosophila a... [more]
A0A0P8XYT37.127e-8133.39Uncharacterized protein, isoform C OS=Drosophila a... [more]
A0A0P8YF167.446e-8133.39Uncharacterized protein, isoform I OS=Drosophila a... [more]
A0A0P9AR647.610e-8133.39Uncharacterized protein, isoform K OS=Drosophila a... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldlrb1.518e-7533.64low-density lipoprotein receptor [Source:NCBI gene... [more]
ldlrb5.090e-7532.91low-density lipoprotein receptor [Source:NCBI gene... [more]
vldlr2.359e-6933.15very low density lipoprotein receptor [Source:NCBI... [more]
vldlr8.604e-6932.61very low density lipoprotein receptor [Source:NCBI... [more]
vldlr3.497e-6833.21very low density lipoprotein receptor [Source:NCBI... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp2a8.687e-6230.30low density lipoprotein receptor-related protein 2... [more]
LRP81.652e-5831.14LDL receptor related protein 8 [Source:HGNC Symbol... [more]
lrp1ab1.232e-5730.49low density lipoprotein receptor-related protein 1... [more]
ENSPMAT00000001137.17.428e-5128.79pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
ENSPMAT00000005343.16.525e-3230.94pep scaffold:Pmarinus_7.0:GL479201:37125:45319:-1 ... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437262.530e-6331.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480692.016e-6231.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439383.074e-6030.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494981.021e-5829.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494991.776e-4826.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vldlr2.194e-7133.95very low density lipoprotein receptor [Source:NCBI... [more]
lrp83.753e-6933.95low-density lipoprotein receptor-related protein 8... [more]
lrp84.604e-6933.95low-density lipoprotein receptor-related protein 8... [more]
ldlrb7.472e-6932.22low-density lipoprotein receptor [Source:NCBI gene... [more]
lrp89.393e-6933.95low-density lipoprotein receptor-related protein 8... [more]
back to top
BLAST of Low-density lipoprotein receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034068.10.000e+099.25SMESG000034068.1[more]
SMESG000034068.10.000e+097.45SMESG000034068.1[more]
SMESG000034068.10.000e+097.15SMESG000034068.1[more]
SMESG000062507.11.842e-7631.92SMESG000062507.1[more]
SMESG000013396.11.525e-6931.99SMESG000013396.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017256 ID=SMED30017256|Name=Low-density lipoprotein receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=2316bp
TTTAAAACTACTTTTTTATAAACTATGAAACTTGAATGGGTATAAGATTT
TAGTTTTTTATTTATATTATGAAATAATACAATTTATCGGACAACTCTTC
AAAAATTCAAATATATGACAATTTCGCTTTGCAAATTTAATTTTTTATTA
TAGAAGTTGAATCATGTTGATTTTGGATTTATTACTAGGTTTAATTTTGT
ATGACGTAGTGCTAGGCAATGAGAATTGCACATCAAGCGATTATTTGAAT
TGTGAAGATATAAATGCTGTTAATTGCATATCAAAAGATTGGTGGTGTGA
TGGTAATCAAGACTGTGAGTCTGGAAAAGACGAATCAAATTGTCCACCGA
AAGTCTGTCTAGATAATGAATTTCTATGTCACTCTGGTACACAGTGTATT
CCTAAATTATTATTATGCGATGGTACATTTCATTGTGTCGATAAATCCGA
TGAAAGAAACTGTACGAAACATGAAATAAAGTCATGTGATAGTATAAGTC
AGTTTGACTGTAATAAAGATGGAGAAATTTGCATTCCTATCTCAGAAGTC
TGCGATAAGAAAAACAATTGTGGGCGTAACCAAGATGAGGAGCCAGGAAA
TTCTGTGGATAATTGCCAAAGAAATGACTGTAAATTGATTCCAAATGGCG
GTTGTAGCCATTTTTGCACTAATTTTTTTACATATATTAAGTGCCACTGT
CCTCTTGGCTATAAACTGCAGCCAGATAATAGGACATGTGTCGATATCGA
CGAATGCTCCGCATCACCAAGTAAATGCAATCAGATATGCAAAAATACAC
CTGGCAGCTATGAGTGCTCTTGTTATGATGGGTATCGGCAAAATCAACAT
AATTCAGAATATTGTATTACTAAAGAAGGTGACAGATCAATTTTGATAAC
ACTTAATGGAGGTAGACAATTGATGATAGATTTGAATACTGGATCCCATT
TTTACAAACCTTTATATAATTCACACGAATCATTGGTGAATATAGATGTT
GATTTGCATCAATCTCCTCAAACAATGTTTTGGATCCAGCAATCGAATGG
TAAACTAGGTCAAAGTAAAATCGACTTAAAAGTGAATAATATTGAAAAGT
ATCGATTTTTAAATCATAAAAATTTATCGGATGATCACATTGGCCAATTG
TGCACCGATATGAGTTTTGATTGGTTGAGAGGCCTTTTATTTTGGACCAG
TTCTATAGAAAAAATTATTTACGTTACAAACACAACATCTAATGTTACAA
GCGTGCTTCTGAACCAAGGTTTAGAAAATCCTAGAAGTATCGCTGTCGAT
CCTATTAACACAGGGGTTTATTGGATTGACTTGGGAACTAAAAAATCTTC
GCCAAGAATAGAAATGATGTTAATGAATACTGACAATAGACGAGTCTTAG
TGTCTAAAAATTTGAGACAACCCCTTGATTTGTTGATAGACTTACAAGAA
CGAAAGCTTTACTGGAGTGACATTGATCCTGGATCTATAAACTTTATAAA
TCTGGATACACCCAATAATCCTAAAACTATAATATCAAACAAATTACTAT
ATCCATTTTCCATCGCTGTTTTCGAAAATAATATCTTCTGGACGGATTGG
CGGCAAAACCAAATCATTTCAATTGATAAAATCACAAGTGATAGTTACAC
GGTATTGGCAAAAGTTGTGAAACCACTAGCAATTCAAGTGCTCAATAAAG
TTATCCAACCTAAAATACATGAGTCGGATGTAACAAGTCACGCTTGTCTG
AAGAATAGGATGCACGGTTGTTCTCATATCTGTTTACCTTTTCCATCGAA
TTCTATCAATCCAAACGAAGGGCCCAAATACAAATGTTTATGTCCAAAGG
ATTCAAAGTTGCAAGGTGATAAGTTAACGTGCCATTTTGCGAATCATCGG
CAACAGAAAATTACCTCAATTCATTCAAAACGTCTGAAAATAATTTTGGG
AGTATCTATAAGCCTTTTATTCATTCTTTGCCTGTCGTTGACAATTATCT
GTGTTTATGCGTGTCGACATAGGAATTGGGCCAATTCCAATAAATGCTTC
AATAGAAGAGCTTTTAACCATCCAATAGTTACTGGGGATTTGATGTTTAT
ATTCAAATGTAATAGCCATTCAAGCCAGAATTCTCACCACACGGAAATCG
CGTTTCTCTCAGACAACAGCTTGTCTGAACTTCTAGCAAGTGATGTCAGC
AGCACTGCGACAGCTTAGAAAAGGAACAATTTATGTAAAAAGAGCATTTA
TTTATGAATATTTACAAATTATATAACTTTATGATAAAAAAACTGTTATA
AGACGACAGATCGGAA
back to top

protein sequence of SMED30017256-orf-1

>SMED30017256-orf-1 ID=SMED30017256-orf-1|Name=SMED30017256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=685bp
MLILDLLLGLILYDVVLGNENCTSSDYLNCEDINAVNCISKDWWCDGNQD
CESGKDESNCPPKVCLDNEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNC
TKHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDN
CQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSA
SPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGG
RQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQQSNGKLGQ
SKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEK
IIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIE
MMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTP
NNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAK
VVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINP
NEGPKYKCLCPKDSKLQGDKLTCHFANHRQQKITSIHSKRLKIILGVSIS
LLFILCLSLTIICVYACRHRNWANSNKCFNRRAFNHPIVTGDLMFIFKCN
SHSSQNSHHTEIAFLSDNSLSELLASDVSSTATA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005768endosome
GO:0005769early endosome
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005905clathrin-coated pit
GO:0009986cell surface
GO:0034362low-density lipoprotein particle
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006869lipid transport
GO:0006897endocytosis
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR040093LRAD1
IPR002172LDrepeatLR_classA_rpt
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR000033LDLR_classB_rpt
IPR0110426-blade_b-propeller_TolB-like
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR018097EGF_Ca-bd_CS
IPR023415LDLR_class-A_CS
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 121..142
score: 36.59
coord: 76..97
score: 46.23
coord: 36..57
score: 47.67
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 107..153
e-value: 0.024
score: 18.7
coord: 21..62
e-value: 1.0E-4
score: 31.7
coord: 64..102
e-value: 1.9E-12
score: 57.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 65..100
e-value: 1.4E-10
score: 41.2
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 107..152
score: 10.1
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 21..61
score: 11.663
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 64..101
score: 11.725
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 38..60
e-value: 4.1868E-5
score: 39.1122
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 65..100
e-value: 5.05626E-9
score: 49.8978
IPR000033LDLR class B repeatSMARTSM00135LY_2coord: 410..452
e-value: 3.8E-5
score: 33.1
coord: 363..409
e-value: 4.0E-8
score: 43.0
coord: 319..361
e-value: 41.0
score: 4.9
coord: 454..494
e-value: 0.004
score: 26.4
IPR000033LDLR class B repeatPFAMPF00058Ldl_recept_bcoord: 385..426
e-value: 1.3E-4
score: 22.3
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 340..382
score: 10.875
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 383..429
score: 10.759
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 430..473
score: 12.036
IPR000742EGF-like domainSMARTSM00181egf_5coord: 155..193
e-value: 13.0
score: 14.7
coord: 527..574
e-value: 0.45
score: 19.6
coord: 197..235
e-value: 0.085
score: 22.0
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 152..193
e-value: 0.089
score: 10.3
coord: 194..235
e-value: 3.4E-8
score: 43.2
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 194..234
e-value: 9.8E-8
score: 32.1
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 199..231
e-value: 2.3E-11
score: 45.3
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 152..198
e-value: 2.1E-14
score: 55.1
NoneNo IPR availablePFAMPF14670FXa_inhibitioncoord: 156..192
e-value: 4.3E-9
score: 36.5
NoneNo IPR availableGENE3DG3DSA:4.10.1220.10coord: 37..65
e-value: 1.0E-7
score: 33.4
NoneNo IPR availablePANTHERPTHR22722FAMILY NOT NAMEDcoord: 19..570
NoneNo IPR availableCDDcd00054EGF_CAcoord: 194..225
e-value: 3.5256E-6
score: 42.2386
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.878
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 254..492
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 160..201
NoneNo IPR availableTMHMMTMhelixcoord: 593..615
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 66..104
e-value: 1.3E-12
score: 49.2
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 105..145
e-value: 5.3E-5
score: 25.3
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 108..144
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 56..101
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 23..60
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 232..582
e-value: 1.8E-66
score: 226.7
IPR040093Low-density lipoprotein receptor class A domain-containing protein 1PANTHERPTHR22722:SF5LOW-DENSITY LIPOPROTEIN RECEPTOR CLASS A DOMAIN-CONTAINING PROTEIN 1-RELATEDcoord: 19..570
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 78..100
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 209..220
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 194..218
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 150..573