Programmed cell death 6

Overview
NameProgrammed cell death 6
Smed IDSMED30017254
Length (bp)739
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Programmed cell death 6 (SMED30017254) t-SNE clustered cells

Violin plots show distribution of expression levels for Programmed cell death 6 (SMED30017254) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Programmed cell death 6 (SMED30017254) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Programmed cell death 6 (SMED30017254) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017254

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30017254SMESG000016908.1 dd_Smed_v4_1457_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017254SMESG000016908.1 dd_Smed_v4_1457_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Programmed cell death 6 vs. Ensembl Human
Match: PDCD6 (programmed cell death 6 [Source:HGNC Symbol;Acc:HGNC:8765])

HSP 1 Score: 196.052 bits (497), Expect = 9.797e-63
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS FGYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 189          
BLAST of Programmed cell death 6 vs. Ensembl Human
Match: PDCD6 (programmed cell death 6 [Source:HGNC Symbol;Acc:HGNC:8765])

HSP 1 Score: 189.889 bits (481), Expect = 2.640e-60
Identity = 94/159 (59.12%), Postives = 117/159 (73.58%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS  GYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS--GYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 187          
BLAST of Programmed cell death 6 vs. Ensembl Human
Match: PDCD6 (programmed cell death 6 [Source:HGNC Symbol;Acc:HGNC:8765])

HSP 1 Score: 137.502 bits (345), Expect = 1.133e-40
Identity = 66/119 (55.46%), Postives = 85/119 (71.43%), Query Frame = 2
Query:  212 MFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS FGYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:    1 MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 119          
BLAST of Programmed cell death 6 vs. Ensembl Human
Match: SRI (sorcin [Source:HGNC Symbol;Acc:HGNC:11292])

HSP 1 Score: 131.339 bits (329), Expect = 6.224e-38
Identity = 61/153 (39.87%), Postives = 95/153 (62.09%), Query Frame = 2
Query:  122 GQINDVELQQALSN----GTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            GQI+  ELQ+ L+     G + PFN+   R M+ M D+D SGT+G NEF++LW  +  W++ F S+D DRSG +D  EL  AL+  G+RL+PQ   ++  ++     G+I FDD++ CC+ L+ LT+SFR  D  + GV+   Y+ F+   ++
Sbjct:    4 GQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRY--STNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMS 154          
BLAST of Programmed cell death 6 vs. Ensembl Human
Match: SRI (sorcin [Source:HGNC Symbol;Acc:HGNC:11292])

HSP 1 Score: 132.109 bits (331), Expect = 7.120e-38
Identity = 63/167 (37.72%), Postives = 100/167 (59.88%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALSN----GTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + +    + GQI+  ELQ+ L+     G + PFN+   R M+ M D+D SGT+G NEF++LW  +  W++ F S+D DRSG +D  EL  AL+  G+RL+PQ   ++  ++     G+I FDD++ CC+ L+ LT+SFR  D  + GV+   Y+ F+   ++
Sbjct:   18 DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRY--STNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMS 182          
BLAST of Programmed cell death 6 vs. Ensembl Celegans
Match: M04F3.4 (pep chromosome:WBcel235:I:4771348:4773070:-1 gene:WBGene00019770.1 transcript:M04F3.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.4)

HSP 1 Score: 197.593 bits (501), Expect = 5.738e-64
Identity = 92/160 (57.50%), Postives = 115/160 (71.88%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            QIF SVDKDRSGQI+  ELQ ALSNGTW PFN    R MIGMFD +  G +   EFQ LW+++ DW   F+ +D D SG ID++EL  AL+QFGYRL+PQF+  LM KFDR    +I FDDF+  C+VLQTLT +FR++D +R GVI +GYEQFL +  +
Sbjct:   10 QIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYINDWTNCFRGFDTDGSGNIDKSELTNALTQFGYRLSPQFYNILMHKFDRSHSNRINFDDFIQLCVVLQTLTAAFRDVDTDRDGVITVGYEQFLTMVFS 169          

HSP 2 Score: 46.2098 bits (108), Expect = 3.653e-6
Identity = 30/82 (36.59%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  287 QRVFQSYDRDRSGFIDQNELMTALSQFGYR-LTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVI 529
            Q++F S D+DRSG I  +EL TALS   +    P+  + ++  FD    G I F +F      +   TN FR  D + SG I
Sbjct:    9 QQIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYINDWTNCFRGFDTDGSGNI 90          
BLAST of Programmed cell death 6 vs. Ensembl Celegans
Match: M04F3.4 (pep chromosome:WBcel235:I:4771348:4773673:-1 gene:WBGene00019770.1 transcript:M04F3.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.4)

HSP 1 Score: 197.593 bits (501), Expect = 5.738e-64
Identity = 92/160 (57.50%), Postives = 115/160 (71.88%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            QIF SVDKDRSGQI+  ELQ ALSNGTW PFN    R MIGMFD +  G +   EFQ LW+++ DW   F+ +D D SG ID++EL  AL+QFGYRL+PQF+  LM KFDR    +I FDDF+  C+VLQTLT +FR++D +R GVI +GYEQFL +  +
Sbjct:   10 QIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYINDWTNCFRGFDTDGSGNIDKSELTNALTQFGYRLSPQFYNILMHKFDRSHSNRINFDDFIQLCVVLQTLTAAFRDVDTDRDGVITVGYEQFLTMVFS 169          

HSP 2 Score: 46.2098 bits (108), Expect = 3.653e-6
Identity = 30/82 (36.59%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  287 QRVFQSYDRDRSGFIDQNELMTALSQFGYR-LTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVI 529
            Q++F S D+DRSG I  +EL TALS   +    P+  + ++  FD    G I F +F      +   TN FR  D + SG I
Sbjct:    9 QQIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYINDWTNCFRGFDTDGSGNI 90          
BLAST of Programmed cell death 6 vs. Ensembl Celegans
Match: M04F3.4 (pep chromosome:WBcel235:I:4771600:4773026:-1 gene:WBGene00019770.1 transcript:M04F3.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.4)

HSP 1 Score: 197.593 bits (501), Expect = 5.738e-64
Identity = 92/160 (57.50%), Postives = 115/160 (71.88%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            QIF SVDKDRSGQI+  ELQ ALSNGTW PFN    R MIGMFD +  G +   EFQ LW+++ DW   F+ +D D SG ID++EL  AL+QFGYRL+PQF+  LM KFDR    +I FDDF+  C+VLQTLT +FR++D +R GVI +GYEQFL +  +
Sbjct:   10 QIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYINDWTNCFRGFDTDGSGNIDKSELTNALTQFGYRLSPQFYNILMHKFDRSHSNRINFDDFIQLCVVLQTLTAAFRDVDTDRDGVITVGYEQFLTMVFS 169          

HSP 2 Score: 46.2098 bits (108), Expect = 3.653e-6
Identity = 30/82 (36.59%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  287 QRVFQSYDRDRSGFIDQNELMTALSQFGYR-LTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVI 529
            Q++F S D+DRSG I  +EL TALS   +    P+  + ++  FD    G I F +F      +   TN FR  D + SG I
Sbjct:    9 QQIFSSVDKDRSGQISSDELQTALSNGTWNPFNPETCRLMIGMFDSNGDGAINFQEFQALWRYINDWTNCFRGFDTDGSGNI 90          
BLAST of Programmed cell death 6 vs. Ensembl Celegans
Match: cal-2 (CALmodulin related genes; Calmodulin-like protein [Source:UniProtKB/TrEMBL;Acc:G5EEG0])

HSP 1 Score: 51.9878 bits (123), Expect = 3.365e-8
Identity = 38/134 (28.36%), Postives = 64/134 (47.76%), Query Frame = 2
Query:   74 IMDPTQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDW------QRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFV 457
            IM+    F+  DKD +G I+  EL  A+ +    P    L+  M+   D D SGT+   EF Q+ K +         +  F+ +DRD +GFI  +E    ++  G + + Q    ++ + D    GQI +++F 
Sbjct:   34 IMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELL-DMVNEVDIDGSGTIDFGEFCQMMKRMNKENDSEMIREAFRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDIDGDGQIDYEEFA 166          
BLAST of Programmed cell death 6 vs. Ensembl Celegans
Match: cal-8 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:Q09980])

HSP 1 Score: 48.9062 bits (115), Expect = 2.983e-7
Identity = 36/131 (27.48%), Postives = 64/131 (48.85%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLW-------KFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVH 460
            ++F+  DK+  G+I   EL+ AL        N S + TMI   D D +G + ++EF  +        K   + + VF  +D++  G I  ++L+  + Q G +LT    + ++ + D    G I F +FV+
Sbjct:   11 EVFREFDKNGDGRITRQELEVALLQLGEKASN-SKIETMIEQADLDGNGCIDIDEFLNVLRRQICDPKEERELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKEMIKQGDLDHDGMIDFQEFVN 140          
BLAST of Programmed cell death 6 vs. Ensembl Fly
Match: Alg-2 (gene:FBgn0086378 transcript:FBtr0301810)

HSP 1 Score: 186.422 bits (472), Expect = 1.961e-59
Identity = 90/162 (55.56%), Postives = 111/162 (68.52%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI 577
            +FQ VDKDRSG I+  ELQ ALSNGTW+ FN   +R MIGMFD++  GTV   +F  LWK+V DWQ  F+S+DRD SG ID+ EL TAL+ FGYRL+      L+ KFDR  RG I FDDF+ CCIVL TLT +FR  D +  G+I + YEQFL +  +  I
Sbjct:   17 VFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSLKI 178          
BLAST of Programmed cell death 6 vs. Ensembl Fly
Match: CG17765 (gene:FBgn0033529 transcript:FBtr0088274)

HSP 1 Score: 136.732 bits (343), Expect = 1.022e-39
Identity = 65/159 (40.88%), Postives = 101/159 (63.52%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFL 565
            Q F  VD+DRSG+IN  ELQ AL NG    F+ +  + MI MFD D SGT+ + EF++L+ ++  W +VF++YD+D SG I++ EL  A +Q G+R +P+F   L+ K D Q   +++ D F+  C+ +Q  T +FR  D  ++G I +G+E FL + +
Sbjct:   37 QWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195          
BLAST of Programmed cell death 6 vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 91.2781 bits (225), Expect = 1.298e-20
Identity = 45/114 (39.47%), Postives = 63/114 (55.26%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRS 520
            F+   VR+M+ M D+DRSG +G  EF+ L   +  W+ VF+ YD  R+G ID   L  AL+  GY L  +    L  ++   R GQI FDDF+ C I ++T    FR  D + S
Sbjct:  796 FSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYG-SREGQIPFDDFLMCAIKVRTFIEMFRERDTDNS 908          
BLAST of Programmed cell death 6 vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0304675)

HSP 1 Score: 91.2781 bits (225), Expect = 1.298e-20
Identity = 45/114 (39.47%), Postives = 63/114 (55.26%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRS 520
            F+   VR+M+ M D+DRSG +G  EF+ L   +  W+ VF+ YD  R+G ID   L  AL+  GY L  +    L  ++   R GQI FDDF+ C I ++T    FR  D + S
Sbjct:  796 FSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYG-SREGQIPFDDFLMCAIKVRTFIEMFRERDTDNS 908          
BLAST of Programmed cell death 6 vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0340532)

HSP 1 Score: 80.4925 bits (197), Expect = 5.197e-17
Identity = 37/126 (29.37%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLH 556
            F+  + R+M+ M D D+SG +G  EF+ L   +  W+ +F+ YD + +G +   +L  AL+  GY L  +    L  ++   R G+IAFDDF+ C + ++T  + F+  D  ++       E+++ 
Sbjct:  714 FSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYG-SRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIE 838          
BLAST of Programmed cell death 6 vs. Ensembl Zebrafish
Match: pdcd6 (programmed cell death 6 [Source:ZFIN;Acc:ZDB-GENE-040426-1307])

HSP 1 Score: 211.46 bits (537), Expect = 5.182e-69
Identity = 98/156 (62.82%), Postives = 123/156 (78.85%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQ+RGQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   25 IFQRVDKDRSGAISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYNTLIEKFDRQKRGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM 180          
BLAST of Programmed cell death 6 vs. Ensembl Zebrafish
Match: sri (sorcin [Source:ZFIN;Acc:ZDB-GENE-040426-1356])

HSP 1 Score: 130.568 bits (327), Expect = 2.628e-37
Identity = 63/167 (37.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + +    + GQI+  ELQ  L+    +G + PFN+   R MI M D+D S ++G NEF++LW  +  W++ F S DRD SG +D  E+  A+S  GYRL+PQ   +++ ++  Q  G+I FDD+V CC+ L++LT+ FR  D+ + G+    Y+ F+H  ++
Sbjct:   25 DPLYGYFTAIAGQDGQISAEELQACLTQANFSGGYRPFNLETCRLMISMLDRDMSYSMGFNEFKELWAVLNGWKQHFMSIDRDMSGTVDPQEMNQAISSMGYRLSPQAMNSIIKRYSSQ--GKITFDDYVACCVKLRSLTDVFRKRDQAQQGMATFQYDDFIHCTMS 189          
BLAST of Programmed cell death 6 vs. Ensembl Zebrafish
Match: pef1 (penta-EF-hand domain containing 1 [Source:NCBI gene;Acc:445249])

HSP 1 Score: 128.257 bits (321), Expect = 1.568e-35
Identity = 69/161 (42.86%), Postives = 96/161 (59.63%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFD-RQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            Q F +VD D+SG IN  EL+QAL N   + FN      M+ MFD+ +SG V +  F  LW F+  W+  FQ +DRDRSG I+ NE+  ALSQ GY L+PQF Q L+ ++  R   G +  D F+  C  LQ++T +FR  D   +G +++ YE FL   +T
Sbjct:  107 QWFSTVDSDQSGYINAKELKQALMNFNNSSFNDETCIMMLNMFDKTKSGRVDVFGFSALWTFLQQWRAAFQQFDRDRSGSINTNEMHQALSQMGYNLSPQFIQELVNRYSVRGGTGVLQLDRFIQVCTQLQSMTQAFREKDTGMTGNVRMSYEDFLSSAIT 267          
BLAST of Programmed cell death 6 vs. Ensembl Zebrafish
Match: GCA (zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3])

HSP 1 Score: 115.931 bits (289), Expect = 1.540e-31
Identity = 52/162 (32.10%), Postives = 98/162 (60.49%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFL 553
            DP   + +    + G+++  ELQ+ L+    +G++TPF++   R MI + D+D +G +G NEF++L+  +  W++ F   DRD SG ++  E+  +++  GYR++P+    ++ ++ R   G+I FDD+V CC+ L+ LT+ FR  D  + G++   Y+ F+
Sbjct:   40 DPMWGYFTAIAGQDGEVDAEELQRCLTQTGISGSYTPFSLETCRIMIALLDRDYTGKMGFNEFKELFGVLNGWKQNFMMVDRDHSGTVEPYEMSQSIANMGYRVSPRVLDAIVKRYSRS--GKIYFDDYVACCVKLKALTDHFRKRDTMQQGMVNFQYDDFI 199          
BLAST of Programmed cell death 6 vs. Ensembl Zebrafish
Match: GCA (zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3])

HSP 1 Score: 113.235 bits (282), Expect = 2.068e-30
Identity = 51/159 (32.08%), Postives = 96/159 (60.38%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYE 544
            DP   + +    + G+++  ELQ+ L+    +G++TPF++   R MI + D+D +G +G NEF++L+  +  W++ F   DRD SG ++  E+  +++  GYR++P+    ++ ++ R   G+I FDD+V CC+ L+ LT+ FR  D  + G++   Y+
Sbjct:   41 DPMWGYFTAIAGQDGEVDAEELQRCLTQTGISGSYTPFSLETCRIMIALLDRDYTGKMGFNEFKELFGVLNGWKQNFMMVDRDHSGTVEPYEMSQSIANMGYRVSPRVLDAIVKRYSRS--GKIYFDDYVACCVKLKALTDHFRKRDTMQQGMVNFQYD 197          
BLAST of Programmed cell death 6 vs. Ensembl Xenopus
Match: pdcd6 (programmed cell death 6 [Source:NCBI gene;Acc:493366])

HSP 1 Score: 204.912 bits (520), Expect = 2.029e-66
Identity = 95/159 (59.75%), Postives = 120/159 (75.47%), Query Frame = 2
Query:   95 FQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTT 571
            F  VD+DRSG I+D ELQQALSNGTWTPFN + V ++I MFD+D  G V  NEF  +WK++ DWQ +F++YDRD SG ID+NEL  ALS FGYRL+ QF+  L+ KFDRQRRGQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  + 
Sbjct:   22 FHRVDRDRSGVISDTELQQALSNGTWTPFNPATVNSIISMFDRDHKGGVNFNEFSGVWKYITDWQNIFRTYDRDNSGLIDKNELKQALSGFGYRLSDQFYDVLIRKFDRQRRGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLTMIFSV 180          
BLAST of Programmed cell death 6 vs. Ensembl Xenopus
Match: pdcd6 (programmed cell death 6 [Source:NCBI gene;Acc:493366])

HSP 1 Score: 201.83 bits (512), Expect = 3.684e-65
Identity = 95/160 (59.38%), Postives = 121/160 (75.62%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTT 571
            +FQ VD+DRSG I+D ELQQALSNGTWTPFN + V ++I MFD+D  G V  NEF  +WK++ DWQ +F++YDRD SG ID+NEL  ALS  GYRL+ QF+  L+ KFDRQRRGQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  + 
Sbjct:   24 VFQRVDRDRSGVISDTELQQALSNGTWTPFNPATVNSIISMFDRDHKGGVNFNEFSGVWKYITDWQNIFRTYDRDNSGLIDKNELKQALS--GYRLSDQFYDVLIRKFDRQRRGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLTMIFSV 181          
BLAST of Programmed cell death 6 vs. Ensembl Xenopus
Match: etfdh (electron transfer flavoprotein dehydrogenase [Source:Xenbase;Acc:XB-GENE-972267])

HSP 1 Score: 135.191 bits (339), Expect = 5.469e-38
Identity = 70/156 (44.87%), Postives = 95/156 (60.90%), Query Frame = 2
Query:   95 FQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKF-DRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            FQ+VD D SG I+  EL+QAL N  W+ FN      M+ MFD+  SG + L  F  LW+F+  W+ +FQ YDRDRSG I+Q EL  AL Q GY+L+PQF Q +M ++  R  +  +  D F+  C  LQ++T +FR  D   SG  +L YE FL +
Sbjct:  122 FQTVDSDHSGYISLKELKQALVNSNWSSFNDETCMMMMNMFDKSNSGRIDLFGFSALWRFIQQWRNLFQQYDRDRSGSINQGELHQALCQMGYQLSPQFVQLVMSRYAQRSVQPGLQLDRFIQICTQLQSMTQAFREKDTGLSGNAKLSYEDFLTM 277          
BLAST of Programmed cell death 6 vs. Ensembl Xenopus
Match: etfdh (electron transfer flavoprotein dehydrogenase [Source:Xenbase;Acc:XB-GENE-972267])

HSP 1 Score: 135.191 bits (339), Expect = 5.722e-38
Identity = 70/156 (44.87%), Postives = 95/156 (60.90%), Query Frame = 2
Query:   95 FQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKF-DRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            FQ+VD D SG I+  EL+QAL N  W+ FN      M+ MFD+  SG + L  F  LW+F+  W+ +FQ YDRDRSG I+Q EL  AL Q GY+L+PQF Q +M ++  R  +  +  D F+  C  LQ++T +FR  D   SG  +L YE FL +
Sbjct:  123 FQTVDSDHSGYISLKELKQALVNSNWSSFNDETCMMMMNMFDKSNSGRIDLFGFSALWRFIQQWRNLFQQYDRDRSGSINQGELHQALCQMGYQLSPQFVQLVMSRYAQRSVQPGLQLDRFIQICTQLQSMTQAFREKDTGLSGNAKLSYEDFLTM 278          
BLAST of Programmed cell death 6 vs. Ensembl Xenopus
Match: sri (sorcin [Source:NCBI gene;Acc:549421])

HSP 1 Score: 124.02 bits (310), Expect = 1.246e-34
Identity = 60/167 (35.93%), Postives = 99/167 (59.28%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + +    + GQI+  ELQ+ L+    +G + PF++   R MI M D+D SG +G NEF++L   +  W++ F +YD DRSG ++ +EL  AL   GYRL+PQ    +  ++     G+I+FDD++ CC+ L+ LT+ FR  D ++ GV+   Y+ F+   ++
Sbjct:   30 DPMYGYFASIAGQDGQIDADELQRCLTQAGLSGGYKPFSLETCRLMIAMLDRDMSGKMGFNEFKELGMVINGWRQHFMTYDGDRSGTVEGHELHAALGAMGYRLSPQALNNIAKRYSTN--GRISFDDYITCCVKLRALTDMFRRRDVSQQGVVNFQYDDFIQSVMS 194          
BLAST of Programmed cell death 6 vs. Ensembl Mouse
Match: Pdcd6 (programmed cell death 6 [Source:MGI Symbol;Acc:MGI:109283])

HSP 1 Score: 194.512 bits (493), Expect = 2.484e-62
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS FGYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 189          
BLAST of Programmed cell death 6 vs. Ensembl Mouse
Match: Pdcd6 (programmed cell death 6 [Source:MGI Symbol;Acc:MGI:109283])

HSP 1 Score: 188.734 bits (478), Expect = 5.559e-60
Identity = 94/159 (59.12%), Postives = 117/159 (73.58%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS  GYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS--GYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 187          
BLAST of Programmed cell death 6 vs. Ensembl Mouse
Match: Sri (sorcin [Source:MGI Symbol;Acc:MGI:98419])

HSP 1 Score: 134.42 bits (337), Expect = 7.835e-39
Identity = 64/167 (38.32%), Postives = 100/167 (59.88%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALSN----GTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + +    + GQI+  ELQ+ L+     G + PFN+   R M+ M D+D SGT+G NEF++LW  +  W++ F S+D DRSG +D  EL  AL+  G+RL+PQ   ++  ++     G+I FDD++ CC+ L+ LT+SFR  D  + GV+   Y+ F+   +T
Sbjct:   18 DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTS--GKITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMT 182          
BLAST of Programmed cell death 6 vs. Ensembl Mouse
Match: Sri (sorcin [Source:MGI Symbol;Acc:MGI:98419])

HSP 1 Score: 134.42 bits (337), Expect = 1.226e-38
Identity = 64/167 (38.32%), Postives = 100/167 (59.88%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALSN----GTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + +    + GQI+  ELQ+ L+     G + PFN+   R M+ M D+D SGT+G NEF++LW  +  W++ F S+D DRSG +D  EL  AL+  G+RL+PQ   ++  ++     G+I FDD++ CC+ L+ LT+SFR  D  + GV+   Y+ F+   +T
Sbjct:   33 DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTS--GKITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMT 197          
BLAST of Programmed cell death 6 vs. Ensembl Mouse
Match: Pef1 (penta-EF hand domain containing 1 [Source:MGI Symbol;Acc:MGI:1915148])

HSP 1 Score: 133.265 bits (334), Expect = 2.026e-37
Identity = 71/156 (45.51%), Postives = 92/156 (58.97%), Query Frame = 2
Query:   95 FQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKF-DRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            FQSVD D SG I+  EL+QAL N  W+ FN      MI MFD+ +SG + +  F  LWKF+  W+ +FQ YDRDRSG I   EL  ALSQ GY L+PQF Q L+ ++  R     +  D F+  C  LQ LT +FR  D    G I+L +E F+ +
Sbjct:  114 FQSVDADHSGYISLKELKQALVNSNWSSFNDETCLMMINMFDKTKSGRIDVAGFSALWKFLQQWRNLFQQYDRDRSGSISSTELQQALSQMGYNLSPQFTQLLVSRYCARSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTM 269          
BLAST of Programmed cell death 6 vs. UniProt/SwissProt
Match: sp|O75340|PDCD6_HUMAN (Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.705e-62
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS FGYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 189          
BLAST of Programmed cell death 6 vs. UniProt/SwissProt
Match: sp|P12815|PDCD6_MOUSE (Programmed cell death protein 6 OS=Mus musculus OX=10090 GN=Pdcd6 PE=1 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 1.737e-61
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID+NEL  ALS FGYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 189          
BLAST of Programmed cell death 6 vs. UniProt/SwissProt
Match: sp|G3V7W1|PDCD6_RAT (Programmed cell death protein 6 OS=Rattus norvegicus OX=10116 GN=Pdcd6 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 7.889e-61
Identity = 94/159 (59.12%), Postives = 118/159 (74.21%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +FQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++    V  +EF  +WK++ DWQ VF++YDRD SG ID++EL  ALS FGYRL+ QF   L+ KFDRQ RGQIAFDDF+  CIVLQ LT+ FR  D ++ G IQ+ YEQ+L +  +
Sbjct:   31 VFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKHELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS 189          
BLAST of Programmed cell death 6 vs. UniProt/SwissProt
Match: sp|Q94743|SORCN_SCHJA (Sorcin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 5.227e-49
Identity = 83/164 (50.61%), Postives = 103/164 (62.80%), Query Frame = 2
Query:   71 LIMDPT---QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFL 553
            ++MD      IF  VD D+SG I+  ELQ +LSNG  TP NI  V+ M+ MFD+D +GT+  NEF  L+K+V DWQ  F+ YDRD SG ID NE   AL  FGY L+PQF   +M +FDR  RG IAFDDF++ C+ LQTLT  F   D    G     +EQFL
Sbjct:    1 MVMDTNSLRHIFSRVDADKSGSISANELQTSLSNGLGTPLNIRTVQLMVAMFDRDMNGTINFNEFLGLFKYVQDWQTCFRRYDRDNSGSIDLNEFSNALISFGYHLSPQFVNLMMRRFDRN-RGSIAFDDFIYACVCLQTLTREFSRYDCRGIGHTVFSFEQFL 163          
BLAST of Programmed cell death 6 vs. UniProt/SwissProt
Match: sp|Q6P069|SORCN_MOUSE (Sorcin OS=Mus musculus OX=10090 GN=Sri PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.574e-38
Identity = 64/167 (38.32%), Postives = 100/167 (59.88%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALSN----GTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + +    + GQI+  ELQ+ L+     G + PFN+   R M+ M D+D SGT+G NEF++LW  +  W++ F S+D DRSG +D  EL  AL+  G+RL+PQ   ++  ++     G+I FDD++ CC+ L+ LT+SFR  D  + GV+   Y+ F+   +T
Sbjct:   33 DPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTS--GKITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMT 197          
BLAST of Programmed cell death 6 vs. TrEMBL
Match: A0A3S1BKU5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_009130 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.801e-70
Identity = 110/167 (65.87%), Postives = 127/167 (76.05%), Query Frame = 2
Query:   77 MDP---TQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            +DP   + IFQSVDKDRSGQI   ELQQAL NGTWTPFN   VR MIGMFD+D SGT+   EFQ LWK+V DWQ  F+SYDRD SG ID+NEL TAL+ FGYRL+P F+  L+ KFDRQ RGQ+AFDDFV C +VLQTLTNSFR  D ++ G IQ+ YEQFL L  +
Sbjct:   13 VDPNYLSGIFQSVDKDRSGQITATELQQALGNGTWTPFNPETVRLMIGMFDRDNSGTINFQEFQSLWKYVTDWQGCFRSYDRDGSGSIDRNELQTALTNFGYRLSPNFYSILIRKFDRQGRGQVAFDDFVQCAVVLQTLTNSFRAYDTDQDGWIQISYEQFLTLVFS 179          
BLAST of Programmed cell death 6 vs. TrEMBL
Match: F7BH23 (programmed cell death protein 6-like OS=Ciona intestinalis OX=7719 GN=LOC100185622 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.719e-68
Identity = 106/161 (65.84%), Postives = 121/161 (75.16%), Query Frame = 2
Query:   86 TQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            + IFQSVDKDRSGQI   ELQQALSNGTW PFN   VR MIGMFD D SGT+G NEF  LWK+V DWQ  F+ YDRD SG ID+NEL TAL  FGYRL+  FF  L+ KFDRQ RG IAFDDF+ CC+VLQTLT+SFR  D N++G I + YEQFL +  +
Sbjct:   45 SAIFQSVDKDRSGQITTNELQQALSNGTWKPFNPETVRLMIGMFDHDHSGTIGFNEFSGLWKYVTDWQSTFRQYDRDNSGTIDKNELKTALVSFGYRLSDNFFTILLRKFDRQNRGTIAFDDFIQCCVVLQTLTSSFRRYDTNQNGWINVSYEQFLTMVFS 205          
BLAST of Programmed cell death 6 vs. TrEMBL
Match: W5UMW7 (Programmed cell death protein 6 OS=Ictalurus punctatus OX=7998 GN=Pdcd6 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.969e-67
Identity = 99/156 (63.46%), Postives = 123/156 (78.85%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD+D  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQR+GQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   23 IFQRVDKDRSGSISDTELQQALSNGTWTPFNPVTVRSIIAMFDRDNKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTSFGYRLSDQFYNTLIEKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM 178          
BLAST of Programmed cell death 6 vs. TrEMBL
Match: A0A556U1A5 (Programmed cell death protein 6 OS=Bagarius yarrelli OX=175774 GN=Baya_6587 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.334e-66
Identity = 99/156 (63.46%), Postives = 123/156 (78.85%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD+D  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQR+GQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   25 IFQRVDKDRSGSISDTELQQALSNGTWTPFNPVTVRSIIAMFDRDNKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYNTLIEKFDRQRKGQVAFDDFIQCCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSM 180          
BLAST of Programmed cell death 6 vs. TrEMBL
Match: K1QIZ7 (Programmed cell death protein 6 OS=Crassostrea gigas OX=29159 GN=CGI_10023297 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.717e-66
Identity = 105/164 (64.02%), Postives = 125/164 (76.22%), Query Frame = 2
Query:   77 MDPT---QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            MDP     IFQ VDKDRSGQI+  ELQ ALSNGTWTPFN   VR MIGMFD+D SGT+   EF  LWK+V DWQ  F+SYDRD SG ID+NEL  AL+ FGYRL+ +F++ L+ KFDRQ RG +AFDDF+ CC+VLQTLT++FR  D ++ G IQ+GYEQFL L
Sbjct:   21 MDPNFLWGIFQRVDKDRSGQISVNELQTALSNGTWTPFNPETVRLMIGMFDKDNSGTINFQEFSSLWKYVTDWQNTFRSYDRDNSGSIDRNELKQALTSFGYRLSDKFYEILIRKFDRQGRGTVAFDDFIQCCVVLQTLTSAFRFYDTDQDGWIQIGYEQFLML 184          
BLAST of Programmed cell death 6 vs. Ensembl Cavefish
Match: pdcd6 (programmed cell death 6 [Source:NCBI gene;Acc:103024788])

HSP 1 Score: 211.46 bits (537), Expect = 3.811e-69
Identity = 98/156 (62.82%), Postives = 123/156 (78.85%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQR+GQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   25 IFQRVDKDRSGAISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYNTLIEKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM 180          
BLAST of Programmed cell death 6 vs. Ensembl Cavefish
Match: pdcd6 (programmed cell death 6 [Source:NCBI gene;Acc:103024788])

HSP 1 Score: 189.119 bits (479), Expect = 2.228e-60
Identity = 91/158 (57.59%), Postives = 119/158 (75.32%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTM--IGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNG  +  +  L+ T+  + MFD++  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQR+GQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   25 IFQRVDKDRSGAISDTELQQALSNGMCSKHSPLLLTTVTNVSMFDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYNTLIEKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM 182          

HSP 2 Score: 45.8246 bits (107), Expect = 8.878e-6
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 2
Query:   74 IMDPTQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFI 331
            I D   IF++ D+D SG I+  EL+QAL+ G     +     T+I  FD+ R G V  ++F Q    +     VF+ YD D+ G+I
Sbjct:   88 ITDWQNIFRTYDRDNSGFIDKNELKQALT-GFGYRLSDQFYNTLIEKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWI 172          
BLAST of Programmed cell death 6 vs. Ensembl Cavefish
Match: sri (sorcin-like [Source:NCBI gene;Acc:103031467])

HSP 1 Score: 127.872 bits (320), Expect = 2.165e-36
Identity = 63/168 (37.50%), Postives = 97/168 (57.74%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTT 571
            DP   + S    + GQI+  ELQ  L+    +G + PFN+   R MI M D+D SG +G NEF++LW  +  W++ F S DRD SG +D  E+  A+   GYRL+PQ    ++ ++     G+I FDD+V CC+ L++LT+ FR  D+ + G     Y+ F+   ++T
Sbjct:   26 DPLFGYFSAVAGQDGQISAEELQACLTQANFSGGYKPFNLETCRLMINMLDRDMSGQMGFNEFKELWAVMNGWKQHFMSIDRDMSGTVDAQEMNQAICSMGYRLSPQAMNIIVKRYSTH--GKITFDDYVACCVKLRSLTDIFRRRDQAQQGAATFQYDDFIQCIMST 191          
BLAST of Programmed cell death 6 vs. Ensembl Cavefish
Match: pef1 (penta-EF-hand domain containing 1 [Source:NCBI gene;Acc:103033186])

HSP 1 Score: 127.487 bits (319), Expect = 3.634e-35
Identity = 66/161 (40.99%), Postives = 97/161 (60.25%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFD-RQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            Q FQ+VD DRSG IN  EL+QAL N   + FN      M+ MFD+ +SG + +  F  LW ++  W+ VF  +DRDRSG I+ +E+  ALSQ GY ++PQF +TL+ ++  R     +  D F+  C  LQ++T +FR  D   +G +++ YE FL   +T
Sbjct:  122 QWFQTVDTDRSGHINLKELKQALLNSNNSAFNDETCLMMLNMFDKTKSGRMDVFGFSALWMYLQQWRAVFNQFDRDRSGSINSSEMHQALSQMGYNMSPQFIETLVSRYCVRGMNNSLQLDRFIQVCTQLQSMTQAFREKDTAMTGNVRMNYEDFLSSAIT 282          
BLAST of Programmed cell death 6 vs. Ensembl Cavefish
Match: zgc:92027 (grancalcin-like [Source:NCBI gene;Acc:103040268])

HSP 1 Score: 119.783 bits (299), Expect = 4.845e-33
Identity = 58/162 (35.80%), Postives = 95/162 (58.64%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFL 553
            DP   + +    + G+++  ELQ+ L+    +G++ PF++   R MI M D D SG +G NEF++L+  +  W++ F   DRD SG ++ +EL  A+   GYRL+PQ    ++ +F R   G+I FDD+V CC+ L+ LT +FR  D  + G +   Y+ F+
Sbjct:   48 DPMWGYFTAIAGQDGEVDAEELQRCLTQTGISGSYMPFSLETCRIMIAMLDTDYSGKMGFNEFKELFTALNGWKQNFMMVDRDNSGTVEPHELSQAIGNMGYRLSPQALGCIIKRFSRG--GKIYFDDYVACCVKLRALTENFRRRDAMQQGAVNFPYDDFI 207          
BLAST of Programmed cell death 6 vs. Ensembl Sea Lamprey
Match: zgc:92027 (grancalcin [Source:HGNC Symbol;Acc:HGNC:15990])

HSP 1 Score: 128.257 bits (321), Expect = 3.222e-37
Identity = 63/167 (37.72%), Postives = 99/167 (59.28%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + S    + GQI+  ELQ+ L+    +GT+ PF+    + MI M D+D SG +G NEF++LW  +  W++ F ++DRD SG +D  EL  AL+  GYRL+PQ    ++ +F R  +  I FDD+V CC+ L+ LT++FR  D  + G +   Y+ F+   ++
Sbjct:   28 DPLFGYFSAVAGQDGQIDAEELQRCLTQSGISGTYQPFSFETCKIMISMLDRDMSGKMGFNEFKELWTALNGWKQNFMAFDRDMSGTVDPGELSQALASMGYRLSPQAINNIVKRFSRDCK--IFFDDYVACCVKLRALTDAFRRRDTAQQGYVNFAYDDFIQCTMS 192          
BLAST of Programmed cell death 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000845.1 (pep scaffold:Pmarinus_7.0:GL481444:15049:20027:-1 gene:ENSPMAG00000000771.1 transcript:ENSPMAT00000000845.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.061e-22
Identity = 43/127 (33.86%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            F++   R M+ + D+D SG +G+ EF  LW+ +  WQ++F+ +D D SG ++  E   AL++ G+RL  Q  QT+  ++  +  G I FD+++ C + L+T+   F+ L+++  G I+L   +FL+L
Sbjct:   39 FSLDACRNMVSLMDRDGSGKLGIKEFNFLWQRIKSWQQIFRQFDMDHSGNMNGYEFRLALAEAGFRLNDQLTQTITMRY-MEENGVIDFDNYLCCLVRLETMFRIFQALNKDGDGTIKLKLPEFLNL 164          
BLAST of Programmed cell death 6 vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 93.2041 bits (230), Expect = 5.234e-22
Identity = 42/127 (33.07%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            F++   RTM+ + D D SG +G N+F+ LW  +  WQ++F+ YD D+SG +   E+  A+++ GY+L  Q +Q +  +   +    I FD+F+ C I L+ +  +F+  D++  G+I+L   ++L L
Sbjct:  682 FSLESCRTMVALMDTDLSGKLGYNDFKYLWDKLKFWQQIFRKYDSDKSGSMTSYEMRLAINEAGYQLNNQLYQIITLRHADENL-NIGFDNFIACLIRLEAMFRAFKAFDKDGDGIIRLNVLEWLQL 807          
BLAST of Programmed cell death 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 6.877e-22
Identity = 52/167 (31.14%), Postives = 92/167 (55.09%), Query Frame = 2
Query:   86 TQIFQSVDKDRSGQINDVELQQALSNGTWT-------PFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFL 565
            TQ+F+ +  +   +I+  ELQ  L+  T          F++   ++M+ + D D SG +GL EF+ LW+ +  WQ +F+ YD DRSG +   E+  AL+  G+ L  Q +Q +  ++  +    I F+D++ C + L+ +   F  LD+++ GVI+LG   +L L +
Sbjct:  562 TQVFKKLAGE-DMEISPRELQDLLNKVTAKLKVFKSDGFSLYACQSMVALMDSDGSGKLGLPEFKLLWEKIKMWQAIFRKYDEDRSGTMSSYEMRAALNAAGFHLNNQMYQLITMRYADESM-TIKFNDYITCMVRLEAMFRIFHALDKDKRGVIRLGLGLWLQLTM 726          
BLAST of Programmed cell death 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000846.1 (pep scaffold:Pmarinus_7.0:GL481444:15725:20048:-1 gene:ENSPMAG00000000771.1 transcript:ENSPMAT00000000846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 3.097e-21
Identity = 43/131 (32.82%), Postives = 77/131 (58.78%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTT 571
            F++   R M+ + D+D SG +G+ EF  LW+ +  WQ++F+ +D D SG ++  E   AL++ G+RL  Q  QT+  ++  +  G I FD+++ C + L+T+   F+ L+++  G I+L   +   L LT 
Sbjct:   46 FSLDACRNMVSLMDRDGSGKLGIKEFNFLWQRIKSWQQIFRQFDMDHSGNMNGYEFRLALAEAGFRLNDQLTQTITMRY-MEENGVIDFDNYLCCLVRLETMFRIFQALNKDGDGTIKLKLPEVSWLPLTN 175          
BLAST of Programmed cell death 6 vs. Ensembl Yeast
Match: PEF1 (Penta-EF-hand protein; required for polar bud growth and cell wall abscission; binds calcium and zinc with different affinity; localizes to bud site in G1, bud neck in G2; binds to Sec31p and modulates COPII coat assembly [Source:SGD;Acc:S000003290])

HSP 1 Score: 73.559 bits (179), Expect = 1.024e-15
Identity = 54/164 (32.93%), Postives = 79/164 (48.17%), Query Frame = 2
Query:   86 TQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDR-----QRRG---QIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFL 553
            TQ+F + D     ++   ELQ  L N   + F IS V  +I +F   R GTV   EF  L+K V  W++V+   D + S  I  +E   +L + GY L P  F+     FD+      R G   ++ FD FV   + L  LT  FR  D N+ G+  + Y+ F+
Sbjct:  163 TQLFHNHDVKGKNRLTAEELQNLLQNDDNSHFCISSVDALINLFGASRFGTVNQAEFIALYKRVKSWRKVYVDNDINGSLTISVSEFHNSLQELGY-LIP--FEVSEKTFDQYAEFINRNGTGKELKFDKFVEALVWLMRLTKLFRKFDTNQEGIATIQYKDFI 323          
BLAST of Programmed cell death 6 vs. Ensembl Nematostella
Match: EDO45947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRG9])

HSP 1 Score: 204.912 bits (520), Expect = 4.127e-67
Identity = 97/166 (58.43%), Postives = 121/166 (72.89%), Query Frame = 2
Query:   80 DP---TQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + IFQ VDKDRSG I+  ELQQALSNGTWTPFN   VR MIGMFD+D +GT+   EF  LWK++ DWQ  F++YDRD SG ID+NEL  AL+ FGYRL+ +F+  L+ KFDR  RG + FDDF+ CC+V+Q LTN+F+  D NR+G I + YEQFL L  +
Sbjct:   13 DPNYLSGIFQRVDKDRSGSISSNELQQALSNGTWTPFNPETVRLMIGMFDRDNNGTINFQEFSSLWKYITDWQTTFRNYDRDSSGTIDKNELQNALTSFGYRLSDKFYSILIKKFDRSGRGVVNFDDFIQCCVVIQMLTNAFQAYDNNRNGWISINYEQFLSLVFS 178          
BLAST of Programmed cell death 6 vs. Ensembl Nematostella
Match: EDO46008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRG8])

HSP 1 Score: 183.341 bits (464), Expect = 1.305e-58
Identity = 87/162 (53.70%), Postives = 112/162 (69.14%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI 577
            IF  +D D++G I   ELQ+ALSNG+W PFN   VR  +GMFD+D SGT+  NEF  LW++V DWQ+ F+SYD D SG ID +EL TAL  FG+RL+ + +  L+ KFDR   G I FDDF+ CC+VLQ LTNSF + D  R GVI + YEQFL +  + N+
Sbjct:   16 IFTRIDADKNGAITGDELQKALSNGSWAPFNPETVRLFMGMFDRDNSGTIEFNEFYSLWQYVTDWQKAFRSYDTDNSGTIDIDELKTALRSFGFRLSDRIYSMLITKFDRTGNGAIRFDDFIQCCVVLQILTNSFSHHDFARRGVITIQYEQFLTMVFSLNL 177          
BLAST of Programmed cell death 6 vs. Ensembl Nematostella
Match: EDO42846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0B4])

HSP 1 Score: 167.162 bits (422), Expect = 2.137e-52
Identity = 76/157 (48.41%), Postives = 106/157 (67.52%), Query Frame = 2
Query:   95 FQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFL 565
            F +VD+DRSG I+  EL+QAL N  W+ FN    R MIG+FD D+SGT+   EFQQLW ++  W+  F  YD DRSG I   EL TA ++ G+R++PQF   ++ KFDR  R  + FDDF+ CC++++ LT++FR  D N +GVIQ+ YE F+ + L
Sbjct:    7 FIAVDRDRSGAISSDELEQALMNNNWSRFNQETCRLMIGLFDHDQSGTINFQEFQQLWSYIQQWKGSFDRYDTDRSGNISGQELHTAFAEMGFRVSPQFISLVLIKFDRAARSSLKFDDFIQCCVMIRMLTDAFRARDTNMNGVIQINYEDFMQMVL 163          
BLAST of Programmed cell death 6 vs. Ensembl Nematostella
Match: EDO38075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE04])

HSP 1 Score: 165.622 bits (418), Expect = 7.730e-52
Identity = 76/153 (49.67%), Postives = 103/153 (67.32%), Query Frame = 2
Query:  101 SVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            +VD+DR+G+I   EL+ AL N  W+ FN    R MIGMFD+D SGT+ + EF  LW+++  W+  F S+DRDRSG ID  EL TA S FGYRL+PQF    + KFDR  R  + FDDF+ CC++L++LT++FR  D  +SG + + YEQ   L
Sbjct:    1 AVDQDRTGKITASELRAALVNSNWSQFNEETCRMMIGMFDKDGSGTIDIYEFAALWQYIQQWKNCFDSFDRDRSGTIDAGELNTAFSTFGYRLSPQFCNLCVQKFDRSDRNTMKFDDFIQCCVMLKSLTDAFRKYDVQQSGQVTISYEQVSTL 153          
BLAST of Programmed cell death 6 vs. Ensembl Nematostella
Match: EDO49093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI54])

HSP 1 Score: 118.242 bits (295), Expect = 1.794e-33
Identity = 61/160 (38.12%), Postives = 91/160 (56.88%), Query Frame = 2
Query:   77 MDPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYE 544
            MDP   + S    +  QI+  ELQ  L+    +G++ PF+I   R MI M D+D SG +G NEF++LW  +  W+  F  YD DRSG ++ +EL  AL+ FGYRL+P     +  ++       I++DDFV CC+ L+ LT+ FR  D  ++G     Y+
Sbjct:    1 MDPLWGYFSAVAGQDQQIDCKELQDCLTRSGISGSYQPFSIETCRLMITMLDRDYSGKMGFNEFKELWAALNQWKTTFMQYDSDRSGTMEPHELNNALNAFGYRLSPACLAGITKRY--AINNCISYDDFVACCVRLRALTDQFRRRDTAQNGYANFAYD 158          
BLAST of Programmed cell death 6 vs. Ensembl Medaka
Match: pdcd6 (programmed cell death 6 [Source:NCBI gene;Acc:101159541])

HSP 1 Score: 208.764 bits (530), Expect = 4.404e-68
Identity = 98/156 (62.82%), Postives = 123/156 (78.85%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNGTWTPFN   VR++I MFD++  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQR+GQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   25 IFQRVDKDRSGVISDSELQQALSNGTWTPFNPVTVRSIISMFDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYGTLIDKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM 180          
BLAST of Programmed cell death 6 vs. Ensembl Medaka
Match: pdcd6 (programmed cell death 6 [Source:NCBI gene;Acc:101159541])

HSP 1 Score: 189.504 bits (480), Expect = 1.347e-60
Identity = 92/156 (58.97%), Postives = 121/156 (77.56%), Query Frame = 2
Query:   92 IFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHL 559
            IFQ VDKDRSG I+D ELQQALSNGT  P +++ + T++ MFD++  G V  NEF  +WK++ DWQ +F++YDRD SGFID+NEL  AL+ FGYRL+ QF+ TL+ KFDRQR+GQ+AFDDF+ CCIVLQ LT+ FR  D ++ G IQ+ YEQ+L +
Sbjct:   25 IFQRVDKDRSGVISDSELQQALSNGT--PLSVTNI-TLMSMFDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYGTLIDKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM 177          
BLAST of Programmed cell death 6 vs. Ensembl Medaka
Match: pef1 (penta-EF-hand domain containing 1 [Source:NCBI gene;Acc:101155780])

HSP 1 Score: 135.961 bits (341), Expect = 1.151e-38
Identity = 75/161 (46.58%), Postives = 95/161 (59.01%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFD-RQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            Q FQSVD DRSG IN  EL+QAL N  W+ FN      MI MFD+ RSG + L  F  LW ++  W+ +FQ YDRD SG I   EL  AL Q GY L+PQF + ++ +F  R  R  I  D F+  C  LQT+T  FR  D + +G ++L YE FL   +T
Sbjct:  100 QWFQSVDTDRSGFINHSELKQALVNSNWSTFNDETCLMMINMFDRTRSGRIDLYGFSALWDYMQRWRALFQQYDRDGSGSISGTELHQALVQMGYNLSPQFSEAVVQRFTIRGVRPGIQLDRFIQVCTQLQTMTQQFREKDTSMTGNVRLSYEDFLSGAMT 260          
BLAST of Programmed cell death 6 vs. Ensembl Medaka
Match: ENSORLT00000041617.1 (sorcin-like [Source:NCBI gene;Acc:101157587])

HSP 1 Score: 127.102 bits (318), Expect = 4.535e-36
Identity = 66/167 (39.52%), Postives = 97/167 (58.08%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLT 568
            DP   + S    + GQI   ELQ  L+    +GT+ PF++   R MI M D+D SGT+G NEF+ LW+ +  W+  F S+DRD+SG I+  EL  A+   GY L+PQ    +M ++     G+I FDDFV C + L+ LT+ FR  D N+SG     Y+ F+ + ++
Sbjct:   20 DPLYGYFSAVAGQDGQITADELQACLTQSGISGTYKPFSLETCRLMINMLDRDMSGTMGFNEFRDLWQALNGWKGTFVSFDRDQSGTIEGQELQQAIRTLGYNLSPQAMNCIMMRYSNH--GKIPFDDFVSCSVKLRALTDQFRRRDTNQSGGALFQYDDFIQVTMS 184          
BLAST of Programmed cell death 6 vs. Ensembl Medaka
Match: zgc:92027 (sorcin [Source:NCBI gene;Acc:101162581])

HSP 1 Score: 114.39 bits (285), Expect = 8.589e-31
Identity = 54/162 (33.33%), Postives = 100/162 (61.73%), Query Frame = 2
Query:   80 DPTQIFQSVDKDRSGQINDVELQQALS----NGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFL 553
            DP   + +    + G+++  ELQ+ L+     G+++PF++   R MI M D+D +G +G NEF++L+  +  W++ F  +D+DRSG ++  EL  A++  G+R++PQ    ++ ++++   G+I FDD+V CC+ L+TLT +FR  D  + G +   Y+ F+
Sbjct:   58 DPMWGYFTAIAGQDGEVDAEELQKCLTQAGFTGSYSPFSLESCRIMIAMLDRDYTGKMGFNEFKELFVALNGWKQNFMMFDQDRSGTVEPRELSQAINAMGFRVSPQALNVIIQRYNKG--GRIFFDDYVACCVKLRTLTENFRRRDTMQQGSVTFQYDDFI 217          
BLAST of Programmed cell death 6 vs. Planmine SMEST
Match: SMESG000016908.1 (SMESG000016908.1)

HSP 1 Score: 340.887 bits (873), Expect = 1.415e-120
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 2
Query:   77 MDPTQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI 577
            MDPTQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI
Sbjct:    1 MDPTQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI 167          
BLAST of Programmed cell death 6 vs. Planmine SMEST
Match: SMESG000036586.1 (SMESG000036586.1)

HSP 1 Score: 218.779 bits (556), Expect = 3.301e-72
Identity = 108/169 (63.91%), Postives = 125/169 (73.96%), Query Frame = 2
Query:   80 DPT---QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI 577
            DP    Q+FQ VDKDRSG IN  ELQQALSNGTWTPFN   VR MIGMFD+D +G +  NEFQQLWK+VGDWQ  F+SYDRD SG ID+NEL  AL+ FGYRL+  FF  L+ KFDRQ RG IAFDDF+  C+ LQTLTN+FR  D +  G IQ+ YEQFL L  + N+
Sbjct:    9 DPNWLYQVFQKVDKDRSGAINQYELQQALSNGTWTPFNPETVRLMIGMFDRDNNGQISFNEFQQLWKYVGDWQNTFRSYDRDGSGTIDRNELKMALTSFGYRLSDNFFNLLIRKFDRQGRGTIAFDDFIQSCVSLQTLTNAFRGFDTDLDGWIQINYEQFLTLVYSLNV 177          
BLAST of Programmed cell death 6 vs. Planmine SMEST
Match: SMESG000068256.1 (SMESG000068256.1)

HSP 1 Score: 192.2 bits (487), Expect = 7.913e-62
Identity = 90/163 (55.21%), Postives = 118/163 (72.39%), Query Frame = 2
Query:   89 QIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGVIQLGYEQFLHLFLTTNI 577
            ++F  VD+D++GQI+  ELQ ALSNGTWTPFN   VR MIGMFD+D +G +G +EF+ LW ++  WQ+ FQ +D D SG ID +EL  AL+ FGYRL+  FF+ L+ KFDRQ  G +AFDDF+  C+ LQTLTN FR+ D +  G+I +GYEQFL L  + NI
Sbjct:   13 EMFNKVDRDKNGQISQQELQSALSNGTWTPFNPETVRLMIGMFDRDNNGQIGFDEFESLWTYIIHWQQTFQRFDLDNSGSIDFHELKNALTSFGYRLSDNFFRLLIRKFDRQAHGTVAFDDFIQACVSLQTLTNGFRHYDTDLDGIITIGYEQFLTLVYSLNI 175          
BLAST of Programmed cell death 6 vs. Planmine SMEST
Match: SMESG000017238.1 (SMESG000017238.1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.826e-20
Identity = 43/107 (40.19%), Postives = 65/107 (60.75%), Query Frame = 2
Query:  179 FNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFR 499
            F I   R+M+ M D D SG +G  EFQ +W  +  W+ VF+  D+D SG +   EL T L+  G+R++ + F  L+ +F   + G I FDDFVHCC+ L+T+  +F+
Sbjct:  640 FTIDTCRSMVAMMDIDLSGRLGFEEFQVMWLDLKLWKTVFKKEDKDGSGSLSSYELRTLLNAIGFRVSNKIFTNLVVRF-ATKDGTIEFDDFVHCCVRLKTVFQTFK 745          
BLAST of Programmed cell death 6 vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.328e-18
Identity = 40/131 (30.53%), Postives = 77/131 (58.78%), Query Frame = 2
Query:  125 QINDVELQQALSNG-----TWTPFNISLVRTMIGMFDQDRSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYRLTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRN 502
            +I+  ELQ  L+        +  F+I   ++M+ M D D+SG +G +EF+ LW  +  W+  F+ +D+D+SG  +  EL   L+  G+RL+ +   +L+ +F   + G + FDD++ CC+ L+T+  ++++
Sbjct:  619 EIDAYELQDILNTAFKKDFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRF-ANKEGLVLFDDYILCCVRLKTIFETYKS 748          
The following BLAST results are available for this feature:
BLAST of Programmed cell death 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDCD69.797e-6359.75programmed cell death 6 [Source:HGNC Symbol;Acc:HG... [more]
PDCD62.640e-6059.12programmed cell death 6 [Source:HGNC Symbol;Acc:HG... [more]
PDCD61.133e-4055.46programmed cell death 6 [Source:HGNC Symbol;Acc:HG... [more]
SRI6.224e-3839.87sorcin [Source:HGNC Symbol;Acc:HGNC:11292][more]
SRI7.120e-3837.72sorcin [Source:HGNC Symbol;Acc:HGNC:11292][more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
M04F3.45.738e-6457.50pep chromosome:WBcel235:I:4771348:4773070:-1 gene:... [more]
M04F3.45.738e-6457.50pep chromosome:WBcel235:I:4771348:4773673:-1 gene:... [more]
M04F3.45.738e-6457.50pep chromosome:WBcel235:I:4771600:4773026:-1 gene:... [more]
cal-23.365e-828.36CALmodulin related genes; Calmodulin-like protein ... [more]
cal-82.983e-727.48CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alg-21.961e-5955.56gene:FBgn0086378 transcript:FBtr0301810[more]
CG177651.022e-3940.88gene:FBgn0033529 transcript:FBtr0088274[more]
CalpB1.298e-2039.47gene:FBgn0025866 transcript:FBtr0076343[more]
CalpB1.298e-2039.47gene:FBgn0025866 transcript:FBtr0304675[more]
CalpA5.197e-1729.37gene:FBgn0012051 transcript:FBtr0340532[more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd65.182e-6962.82programmed cell death 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
sri2.628e-3737.72sorcin [Source:ZFIN;Acc:ZDB-GENE-040426-1356][more]
pef11.568e-3542.86penta-EF-hand domain containing 1 [Source:NCBI gen... [more]
GCA1.540e-3132.10zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3][more]
GCA2.068e-3032.08zgc:92027 [Source:ZFIN;Acc:ZDB-GENE-040930-3][more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd62.029e-6659.75programmed cell death 6 [Source:NCBI gene;Acc:4933... [more]
pdcd63.684e-6559.38programmed cell death 6 [Source:NCBI gene;Acc:4933... [more]
etfdh5.469e-3844.87electron transfer flavoprotein dehydrogenase [Sour... [more]
etfdh5.722e-3844.87electron transfer flavoprotein dehydrogenase [Sour... [more]
sri1.246e-3435.93sorcin [Source:NCBI gene;Acc:549421][more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdcd62.484e-6259.75programmed cell death 6 [Source:MGI Symbol;Acc:MGI... [more]
Pdcd65.559e-6059.12programmed cell death 6 [Source:MGI Symbol;Acc:MGI... [more]
Sri7.835e-3938.32sorcin [Source:MGI Symbol;Acc:MGI:98419][more]
Sri1.226e-3838.32sorcin [Source:MGI Symbol;Acc:MGI:98419][more]
Pef12.026e-3745.51penta-EF hand domain containing 1 [Source:MGI Symb... [more]
back to top
BLAST of Programmed cell death 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75340|PDCD6_HUMAN4.705e-6259.75Programmed cell death protein 6 OS=Homo sapiens OX... [more]
sp|P12815|PDCD6_MOUSE1.737e-6159.75Programmed cell death protein 6 OS=Mus musculus OX... [more]
sp|G3V7W1|PDCD6_RAT7.889e-6159.12Programmed cell death protein 6 OS=Rattus norvegic... [more]
sp|Q94743|SORCN_SCHJA5.227e-4950.61Sorcin OS=Schistosoma japonicum OX=6182 PE=2 SV=1[more]
sp|Q6P069|SORCN_MOUSE8.574e-3838.32Sorcin OS=Mus musculus OX=10090 GN=Sri PE=1 SV=1[more]
back to top
BLAST of Programmed cell death 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BKU54.801e-7065.87Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
F7BH231.719e-6865.84programmed cell death protein 6-like OS=Ciona inte... [more]
W5UMW75.969e-6763.46Programmed cell death protein 6 OS=Ictalurus punct... [more]
A0A556U1A52.334e-6663.46Programmed cell death protein 6 OS=Bagarius yarrel... [more]
K1QIZ72.717e-6664.02Programmed cell death protein 6 OS=Crassostrea gig... [more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd63.811e-6962.82programmed cell death 6 [Source:NCBI gene;Acc:1030... [more]
pdcd62.228e-6057.59programmed cell death 6 [Source:NCBI gene;Acc:1030... [more]
sri2.165e-3637.50sorcin-like [Source:NCBI gene;Acc:103031467][more]
pef13.634e-3540.99penta-EF-hand domain containing 1 [Source:NCBI gen... [more]
zgc:920274.845e-3335.80grancalcin-like [Source:NCBI gene;Acc:103040268][more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:920273.222e-3737.72grancalcin [Source:HGNC Symbol;Acc:HGNC:15990][more]
ENSPMAT00000000845.11.061e-2233.86pep scaffold:Pmarinus_7.0:GL481444:15049:20027:-1 ... [more]
capn3a5.234e-2233.07calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
ENSPMAT00000003998.16.877e-2231.14pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
ENSPMAT00000000846.13.097e-2132.82pep scaffold:Pmarinus_7.0:GL481444:15725:20048:-1 ... [more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PEF11.024e-1532.93Penta-EF-hand protein; required for polar bud grow... [more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO459474.127e-6758.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460081.305e-5853.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428462.137e-5248.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380757.730e-5249.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490931.794e-3338.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Programmed cell death 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd64.404e-6862.82programmed cell death 6 [Source:NCBI gene;Acc:1011... [more]
pdcd61.347e-6058.97programmed cell death 6 [Source:NCBI gene;Acc:1011... [more]
pef11.151e-3846.58penta-EF-hand domain containing 1 [Source:NCBI gen... [more]
ENSORLT00000041617.14.535e-3639.52sorcin-like [Source:NCBI gene;Acc:101157587][more]
zgc:920278.589e-3133.33sorcin [Source:NCBI gene;Acc:101162581][more]
back to top
BLAST of Programmed cell death 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016908.11.415e-120100.00SMESG000016908.1[more]
SMESG000036586.13.301e-7263.91SMESG000036586.1[more]
SMESG000068256.17.913e-6255.21SMESG000068256.1[more]
SMESG000017238.12.826e-2040.19SMESG000017238.1[more]
SMESG000039299.11.328e-1830.53SMESG000039299.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017254 ID=SMED30017254|Name=Programmed cell death 6|organism=Schmidtea mediterranea sexual|type=transcript|length=739bp
AGTAAACGTTACATTTCAAATTCAAGTATTTCAATTATTATTTTATACAA
TTCTTGAACTAAAATAATTTTTAATCATGGATCCTACACAAATTTTCCAA
TCTGTTGATAAAGATCGCAGTGGCCAAATAAATGATGTGGAGTTACAGCA
AGCTCTGTCAAATGGAACATGGACACCATTTAATATTTCCCTCGTGCGAA
CAATGATTGGCATGTTTGATCAAGATCGCAGTGGAACTGTCGGCTTGAAT
GAATTCCAACAACTATGGAAATTCGTCGGCGATTGGCAAAGAGTATTTCA
AAGTTATGATAGAGACAGATCTGGATTTATCGACCAAAATGAATTAATGA
CTGCATTATCGCAATTCGGGTACAGATTGACTCCTCAATTCTTTCAAACG
TTAATGTGGAAATTCGACCGACAACGACGGGGACAAATCGCATTTGATGA
TTTTGTTCATTGCTGCATAGTTCTACAGACCTTGACAAATTCATTTCGAA
ACTTGGACCGAAACCGAAGCGGGGTCATTCAACTGGGCTATGAGCAATTC
CTTCATTTGTTTCTAACAACCAACATTTGAATTTCGGAACTCCCTTGACA
ATTTTCATATTTCTTGCGACTCTATGCCTATTGTGAATGTCCATGAAGTC
TTATAGGATCCTTTTTTCACATTGTATCGATATGCTTACAATTTTAGATT
GATTTTTTTGAAATATATAATTTGTTCTTTCGAAAAAAA
back to top

protein sequence of SMED30017254-orf-1

>SMED30017254-orf-1 ID=SMED30017254-orf-1|Name=SMED30017254-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
MDPTQIFQSVDKDRSGQINDVELQQALSNGTWTPFNISLVRTMIGMFDQD
RSGTVGLNEFQQLWKFVGDWQRVFQSYDRDRSGFIDQNELMTALSQFGYR
LTPQFFQTLMWKFDRQRRGQIAFDDFVHCCIVLQTLTNSFRNLDRNRSGV
IQLGYEQFLHLFLTTNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 39..67
e-value: 0.91
score: 18.1
coord: 2..30
e-value: 1.5
score: 16.2
coord: 105..133
e-value: 150.0
score: 0.2
coord: 69..97
e-value: 3.1E-5
score: 33.4
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 71..128
e-value: 7.4E-11
score: 42.3
coord: 5..64
e-value: 2.1E-8
score: 34.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 35..63
score: 6.201
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1..33
score: 9.325
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 65..100
score: 13.174
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 101..136
score: 5.308
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 3..165
e-value: 2.4E-50
score: 172.4
NoneNo IPR availablePANTHERPTHR46212FAMILY NOT NAMEDcoord: 4..161
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 11..23
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 78..90
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 5..162