Nuclear transcription factor, X-box binding 1

Overview
NameNuclear transcription factor, X-box binding 1
Smed IDSMED30017251
Length (bp)3092
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear transcription factor, X-box binding 1 (SMED30017251) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear transcription factor, X-box binding 1 (SMED30017251) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear transcription factor, X-box binding 1 (SMED30017251) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear transcription factor, X-box binding 1 (SMED30017251) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017251

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30017251h1SMcG0009883 SmedASXL_016726SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30017251h1SMcG0009883 dd_Smed_v4_4795_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Human
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:HGNC Symbol;Acc:HGNC:7803])

HSP 1 Score: 442.58 bits (1137), Expect = 4.108e-137
Identity = 288/746 (38.61%), Postives = 395/746 (52.95%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKL----VDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLE--SKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQ-----TYYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A +T+ C C RT+ T +C     ++ C + CE  LNCG H+C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CGNH C  VCH   C+ C   P  +  C C +  + ++   GS  R +C+D VPSCG VC + L    +D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGL C   L    H C R+CH+G C +D   C QPC+  R DC HPC  PCH S+   V + C A+V + C C  R   +IC      Y+   AIS      +++     E   LI         L CD EC    R  +LA+AF IS  S         + +SDSLK  A+++  F+  VEK +  L+      K+SK    F  ++ +    I+  A  + + S S  ++ ++  +   I   +VC
Sbjct:  346 SLIEQLTTEKYECMVCCELVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECGRTRHTVRC-GQAVSVHCSNPCENILNCGQHQCAELCHGGQCQPCQIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGNHTCSQVCHPQPCQQCPRLPQLVRCCPCGQTPLSQLLELGSSSRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHEFRSNIPCHLVDISCGLPCSATLPCGMHKCQRLCHKGECLVDEP-CKQPCTTPRADCGHPCMAPCHTSSPCPVTA-CKAKVELQCECGRRKEMVICSEASSTYQRIAAISMASKITDMQLGGSVEISKLITKKEVHQARLECDEECSALERKKRLAEAFHISEDSDPFNIRSSGSKFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKSHSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVC 1067          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Human
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:HGNC Symbol;Acc:HGNC:7803])

HSP 1 Score: 338.961 bits (868), Expect = 3.253e-101
Identity = 207/485 (42.68%), Postives = 276/485 (56.91%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKL----VDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHK 2145
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A +T+ C C RT+ T +C     ++ C + CE  LNCG H+C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CGNH C  VCH   C+ C   P  +  C C +  + ++   GS  R +C+D VPSCG VC + L    +D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+
Sbjct:  346 SLIEQLTTEKYECMVCCELVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECGRTRHTVRC-GQAVSVHCSNPCENILNCGQHQCAELCHGGQCQPCQIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGNHTCSQVCHPQPCQQCPRLPQLVRCCPCGQTPLSQLLELGSSSRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHE 808          

HSP 2 Score: 54.6842 bits (130), Expect = 1.050e-6
Identity = 81/315 (25.71%), Postives = 112/315 (35.56%), Query Frame = 1
Query: 1549 SHHRNSCVDAVP-SCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQ-QSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR--------PVCSNNCSREHSCS-----HAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFR-----PVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC 2430
            + H   C  AV   C N CE  +++CG H C+++CH G C PC +  + VC CG ++   +    + +S       C K+C K L CG                           +H C + C H   C  CP +      C CG   L   +  G S         P C   C +   C      H     CH E  C PC+     SC  + +T + +PC           C   C +      H C  IC    C     KC   C +K     H C  PCH  NCQ        ++   C   +   P+ C
Sbjct:  482 TRHTVRCGQAVSVHCSNPCE-NILNCGQHQCAELCHGGQCQPCQIILNQVCYCGSTSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCG---------------------------NHTCSQVC-HPQPCQQCPRLPQLVRCCPCGQTPLSQLLELGSSSRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCH-EGDCGPCSRTSVISCRCSFRTKE-LPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEIC----CVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPC 761          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Human
Match: NFXL1 (nuclear transcription factor, X-box binding like 1 [Source:HGNC Symbol;Acc:HGNC:18726])

HSP 1 Score: 221.861 bits (564), Expect = 2.679e-59
Identity = 217/671 (32.34%), Postives = 297/671 (44.26%), Query Frame = 1
Query:  685 DLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTK-ITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAV--RHNCHSESTCPPCTELVSKS-------CP------------GAHK----------------TLDNVPCFRPVA--------------------TCGLVCGRPLTGCEHSCIRICHQ-------------GPCALDATKCIQPCSQKRT-DCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            +LE   Q  +   Q       C+IC+  ++   + WSC  C+ IFH+ CI KWA        +  D D  K +    CP C+ EY   R+ TP         +Y C+CGK  +P +     LVPHSC  VC + ++   C H C L+CHPGPCPPC  +VT  C+C++ K I  +C+A E +  C   C + L CG H+CEN CHAG C  C     QKC C +K + +        +  ++ C   C + L CGNH CE VCH G C  C  +  R C C   K  +             C + VP+CG+ C+ K+++CG H CSQ CH GPC  C    +  CRCGK     M C        +   C   C K   C +H+C  +CC      C   CGRTL C++H+C   C H GSC  CP     ++ C CG  K+   + CG+ R    P C   CSR  +C H    +H CH  S CPPC +   K        CP            G H+                 L   PC  P+                     +C  VCGR L    H+C++ CH+             GP   +   C + CS+ R   C HPC + CH   C      C+  + + C CK+ S+ + C K+  A
Sbjct:  141 ELERTKQYVNEAFQAG--AMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEY--KRSETPS--------RYYCYCGKVEDPPLDPW--LVPHSCGQVCEREFK-PPCGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKEWS--CQLPCGQKLLCGQHKCENPCHAGSCQPCPRVSRQKCVCGKKVAER------SCASPLWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRFCPCQKSKFSL------------PCTEDVPTCGDSCD-KVLECGIHRCSQRCHRGPCETCRQEVEKHCRCGKHT-KRMPC-------HKPYLCETKCVKMRDCQKHQCRRKCCPGNCPPCDQNCGRTLGCRNHKCPSVC-HRGSCYPCPETV--DVKCNCGNTKVT--VPCGRERTTRPPKCKEQCSRPPTCHHTSQEKHRCHFGS-CPPCHQPCQKVLEKCGHLCPAPCHDQALIKQTGRHQPTGPWEQPSEPAFIQTALPCPPCQVPIPMECLGKHEVSPLPCHAVGPYSCKRVCGRILDCQNHTCMKECHKVTKTDGCTGKNKAGP---ECLHCEEGCSKSRPLGCLHPCILRCHPGEC----PPCVQMLRIKCHCKITSLYVECRKITTA 754          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Human
Match: NFXL1 (nuclear transcription factor, X-box binding like 1 [Source:HGNC Symbol;Acc:HGNC:18726])

HSP 1 Score: 221.861 bits (564), Expect = 2.679e-59
Identity = 217/671 (32.34%), Postives = 297/671 (44.26%), Query Frame = 1
Query:  685 DLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTK-ITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAV--RHNCHSESTCPPCTELVSKS-------CP------------GAHK----------------TLDNVPCFRPVA--------------------TCGLVCGRPLTGCEHSCIRICHQ-------------GPCALDATKCIQPCSQKRT-DCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            +LE   Q  +   Q       C+IC+  ++   + WSC  C+ IFH+ CI KWA        +  D D  K +    CP C+ EY   R+ TP         +Y C+CGK  +P +     LVPHSC  VC + ++   C H C L+CHPGPCPPC  +VT  C+C++ K I  +C+A E +  C   C + L CG H+CEN CHAG C  C     QKC C +K + +        +  ++ C   C + L CGNH CE VCH G C  C  +  R C C   K  +             C + VP+CG+ C+ K+++CG H CSQ CH GPC  C    +  CRCGK     M C        +   C   C K   C +H+C  +CC      C   CGRTL C++H+C   C H GSC  CP     ++ C CG  K+   + CG+ R    P C   CSR  +C H    +H CH  S CPPC +   K        CP            G H+                 L   PC  P+                     +C  VCGR L    H+C++ CH+             GP   +   C + CS+ R   C HPC + CH   C      C+  + + C CK+ S+ + C K+  A
Sbjct:  141 ELERTKQYVNEAFQAG--AMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEY--KRSETPS--------RYYCYCGKVEDPPLDPW--LVPHSCGQVCEREFK-PPCGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKEWS--CQLPCGQKLLCGQHKCENPCHAGSCQPCPRVSRQKCVCGKKVAER------SCASPLWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRFCPCQKSKFSL------------PCTEDVPTCGDSCD-KVLECGIHRCSQRCHRGPCETCRQEVEKHCRCGKHT-KRMPC-------HKPYLCETKCVKMRDCQKHQCRRKCCPGNCPPCDQNCGRTLGCRNHKCPSVC-HRGSCYPCPETV--DVKCNCGNTKVT--VPCGRERTTRPPKCKEQCSRPPTCHHTSQEKHRCHFGS-CPPCHQPCQKVLEKCGHLCPAPCHDQALIKQTGRHQPTGPWEQPSEPAFIQTALPCPPCQVPIPMECLGKHEVSPLPCHAVGPYSCKRVCGRILDCQNHTCMKECHKVTKTDGCTGKNKAGP---ECLHCEEGCSKSRPLGCLHPCILRCHPGEC----PPCVQMLRIKCHCKITSLYVECRKITTA 754          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Human
Match: NFXL1 (nuclear transcription factor, X-box binding like 1 [Source:HGNC Symbol;Acc:HGNC:18726])

HSP 1 Score: 221.861 bits (564), Expect = 2.679e-59
Identity = 217/671 (32.34%), Postives = 297/671 (44.26%), Query Frame = 1
Query:  685 DLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTK-ITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAV--RHNCHSESTCPPCTELVSKS-------CP------------GAHK----------------TLDNVPCFRPVA--------------------TCGLVCGRPLTGCEHSCIRICHQ-------------GPCALDATKCIQPCSQKRT-DCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            +LE   Q  +   Q       C+IC+  ++   + WSC  C+ IFH+ CI KWA        +  D D  K +    CP C+ EY   R+ TP         +Y C+CGK  +P +     LVPHSC  VC + ++   C H C L+CHPGPCPPC  +VT  C+C++ K I  +C+A E +  C   C + L CG H+CEN CHAG C  C     QKC C +K + +        +  ++ C   C + L CGNH CE VCH G C  C  +  R C C   K  +             C + VP+CG+ C+ K+++CG H CSQ CH GPC  C    +  CRCGK     M C        +   C   C K   C +H+C  +CC      C   CGRTL C++H+C   C H GSC  CP     ++ C CG  K+   + CG+ R    P C   CSR  +C H    +H CH  S CPPC +   K        CP            G H+                 L   PC  P+                     +C  VCGR L    H+C++ CH+             GP   +   C + CS+ R   C HPC + CH   C      C+  + + C CK+ S+ + C K+  A
Sbjct:  141 ELERTKQYVNEAFQAG--AMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEY--KRSETPS--------RYYCYCGKVEDPPLDPW--LVPHSCGQVCEREFK-PPCGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKEWS--CQLPCGQKLLCGQHKCENPCHAGSCQPCPRVSRQKCVCGKKVAER------SCASPLWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRFCPCQKSKFSL------------PCTEDVPTCGDSCD-KVLECGIHRCSQRCHRGPCETCRQEVEKHCRCGKHT-KRMPC-------HKPYLCETKCVKMRDCQKHQCRRKCCPGNCPPCDQNCGRTLGCRNHKCPSVC-HRGSCYPCPETV--DVKCNCGNTKVT--VPCGRERTTRPPKCKEQCSRPPTCHHTSQEKHRCHFGS-CPPCHQPCQKVLEKCGHLCPAPCHDQALIKQTGRHQPTGPWEQPSEPAFIQTALPCPPCQVPIPMECLGKHEVSPLPCHAVGPYSCKRVCGRILDCQNHTCMKECHKVTKTDGCTGKNKAGP---ECLHCEEGCSKSRPLGCLHPCILRCHPGEC----PPCVQMLRIKCHCKITSLYVECRKITTA 754          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Celegans
Match: nfx-1 (Transcriptional repressor NF-X1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18034])

HSP 1 Score: 430.639 bits (1106), Expect = 4.911e-133
Identity = 286/768 (37.24%), Postives = 387/768 (50.39%), Query Frame = 1
Query:  607 GPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHI--GCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQ--CNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPND----SSVF-----LICDSECKKNARNIKLADAFDISLTSSNLQTY-----YSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKN--------LDENKADFINRYAACFKINSKSV 2814
            G SR      R+++      + + KI L     RE L+  L +NKYEC IC   I      WSC+ CYHIFHI  GCI+ WA +   S DK+G     RCP CQ E +      P N        Y CFCG+  NP  + G   VPHSC + CG + R   C H C+ +CHPGPC  C+   T++C+C +TK + +C +D+  ++C   C K L+CG H CE  CH+G+CG C+V +EQ CFC  K+ ++V C     + E +SCG+ C+ M  CG H C   CH  +C  C+   +RI  C C +  +  +G      R  C D VP+C +VC+ K + CG     H+C + CHEGPC PC L+  V+CRCG S    + C    +  + + +  C K C KK SCG H+C E CC  + H C   C + LSC  H CE  C H G C  C   SFDE  C CG    +PPI CG   PVCS  C R HSC H+V H CH E  CPPCT+L  K C G H+   N+PC     +CG+VC +PL    H C R CH   C  +  KC + C   R  C+HPCA+PCH  S C+   S C A V ++C C        C ++   I         E      +  +        S+ F     + CD ECKK  RN K+A+A ++      +        +   LK   + N DF+  VEK L+DL+    +   + +        +   K  F++ YA  F I S+SV
Sbjct:  189 GNSRRGQGARRREQKEEPLTEEETKI-LADKPLREGLVYLLENNKYECAICYTRITTRQGVWSCKTCYHIFHISTGCITDWARS---SRDKEGAN-TWRCPTCQTENET----MPYN--------YYCFCGRMRNPNFRVGE--VPHSCGETCGGA-RKFGCPHPCTELCHPGPCIECKLFTTKSCNCGKTKKSVRCGSDQE-VMCETVCGKQLSCGQHNCERICHSGDCGECTVILEQDCFCG-KTPKEVSCNP--CAHEKYSCGSECDGMFSCGIHHCTKKCHDKECGECETGANRIRTCPCGRNTLQSLGVT----RKKCTDMVPTCDSVCD-KWLTCGTPGKNHHCREKCHEGPCPPCNLNTSVICRCGTSK-GVIPCDEYLQIMKTTGEYLCTKRCRKKKSCGMHKCQEVCCIQDEHFCLQMCNKRLSCGIHTCENVC-HAGQCRPCLQASFDEQFCHCGHTVRMPPIPCGARLPVCSQPCVRPHSCDHSVSHKCHGEQNCPPCTQLTEKMCYGGHRVRKNIPCHIDSVSCGVVCKKPLKCGVHVCQRTCHGEECEKEGEKCTKKCETIRELCEHPCALPCHEDSPCEP--SPCKASVRISCECGRIKKDAPCCEVDKMILSKLEKEEEEKSESDGEEKVVKEGILKRSTSFSQLNCMKCDDECKKLERNRKVAEALEVDTDEYGMNKLAPTISFPCYLKEMVRTNIDFVKSVEKILIDLVIQILSGEAYHDTFRAHLPAMSIEKRRFVHEYANFFNIASESV 923          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Fly
Match: stc (gene:FBgn0001978 transcript:FBtr0332473)

HSP 1 Score: 471.855 bits (1213), Expect = 1.342e-148
Identity = 301/854 (35.25%), Postives = 430/854 (50.35%), Query Frame = 1
Query:  397 NNYQDKVHGYKDFHEQRGNKGNYR----TNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCN-------EKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKL---QNAISFIKFSNNLESKRES----LDLIISP-NDSSVFLICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSV-RNQNQKINMSAEINR 2859
            N  Q +   Y+D  E R  + + R        D   S+    +  R R   N F +   ++ + N +       + +  +  P RG                     D E ++QRE L+  +   + EC++CV  I++   TWSC NCYH+ H+ C   WA++  + V         RCPACQ   +V +++  D         Y CFCGK  NP V R    + HSC +VC    R E C H C+L+CHPGPCPPC+A V R+C C R+  T +C   E  L CG+ C+K LNCG HRC+  CH+G+C  CS ++ Q+C C  K  RKV C      +  +SC + C + L CG+HKC+  CH G C PC+ +P++I  C C KM +       +  R+SC+D +P+C  +C R L  CG     H C   CH G C PCP    V CRCG      + CR +  ++    +C + C KK SCG+H+CN  CC    H C   C RTLSC  H+C++ C H G+CP C   SF+EL+CECGAE + PP+ CG  +P+C   CSR H C H  +HNCHS  TCPPC    +K C G H+    +PC +P  +CG+ CG+PL    H CI+ CH+GPC      C Q C++ R  C H CA  CH   C +  + C   V V C C  R     C +L    + I+ I+ ++++          L  I++P   S+  L C+ EC+   RN +LA A     S T     T YS+ ++ +AK+N      V +TL DL+K +K   +      F  ++  K   ++     F I S S  +  N+ +  +A  +R
Sbjct:  262 NTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPL---------------PPADNEKLSQREKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEV-------GWRCPACQ---NVLQDLPRD---------YLCFCGKLKNPPVSR--TELAHSCGEVC---CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVL-CGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCG-KQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITSCPCGKMPVP------AGQRSSCLDPIPTCEGICSRTL-RCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGH-MDQMIKCRQLC-NRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSCGKHKCDQPC-HRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPE--TPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRRLAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDR 1062          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Fly
Match: stc (gene:FBgn0001978 transcript:FBtr0080706)

HSP 1 Score: 471.085 bits (1211), Expect = 2.408e-148
Identity = 301/854 (35.25%), Postives = 430/854 (50.35%), Query Frame = 1
Query:  397 NNYQDKVHGYKDFHEQRGNKGNYR----TNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCN-------EKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKL---QNAISFIKFSNNLESKRES----LDLIISP-NDSSVFLICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSV-RNQNQKINMSAEINR 2859
            N  Q +   Y+D  E R  + + R        D   S+    +  R R   N F +   ++ + N +       + +  +  P RG                     D E ++QRE L+  +   + EC++CV  I++   TWSC NCYH+ H+ C   WA++  + V         RCPACQ   +V +++  D         Y CFCGK  NP V R    + HSC +VC    R E C H C+L+CHPGPCPPC+A V R+C C R+  T +C   E  L CG+ C+K LNCG HRC+  CH+G+C  CS ++ Q+C C  K  RKV C      +  +SC + C + L CG+HKC+  CH G C PC+ +P++I  C C KM +       +  R+SC+D +P+C  +C R L  CG     H C   CH G C PCP    V CRCG      + CR +  ++    +C + C KK SCG+H+CN  CC    H C   C RTLSC  H+C++ C H G+CP C   SF+EL+CECGAE + PP+ CG  +P+C   CSR H C H  +HNCHS  TCPPC    +K C G H+    +PC +P  +CG+ CG+PL    H CI+ CH+GPC      C Q C++ R  C H CA  CH   C +  + C   V V C C  R     C +L    + I+ I+ ++++          L  I++P   S+  L C+ EC+   RN +LA A     S T     T YS+ ++ +AK+N      V +TL DL+K +K   +      F  ++  K   ++     F I S S  +  N+ +  +A  +R
Sbjct:  266 NTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPL---------------PPADNEKLSQREKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEV-------GWRCPACQ---NVLQDLPRD---------YLCFCGKLKNPPVSR--TELAHSCGEVC---CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVL-CGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCG-KQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITSCPCGKMPVP------AGQRSSCLDPIPTCEGICSRTL-RCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGH-MDQMIKCRQLC-NRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSCGKHKCDQPC-HRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPE--TPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRRLAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDR 1066          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Fly
Match: stc (gene:FBgn0001978 transcript:FBtr0332474)

HSP 1 Score: 471.085 bits (1211), Expect = 2.501e-148
Identity = 301/854 (35.25%), Postives = 430/854 (50.35%), Query Frame = 1
Query:  397 NNYQDKVHGYKDFHEQRGNKGNYR----TNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCN-------EKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKL---QNAISFIKFSNNLESKRES----LDLIISP-NDSSVFLICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSV-RNQNQKINMSAEINR 2859
            N  Q +   Y+D  E R  + + R        D   S+    +  R R   N F +   ++ + N +       + +  +  P RG                     D E ++QRE L+  +   + EC++CV  I++   TWSC NCYH+ H+ C   WA++  + V         RCPACQ   +V +++  D         Y CFCGK  NP V R    + HSC +VC    R E C H C+L+CHPGPCPPC+A V R+C C R+  T +C   E  L CG+ C+K LNCG HRC+  CH+G+C  CS ++ Q+C C  K  RKV C      +  +SC + C + L CG+HKC+  CH G C PC+ +P++I  C C KM +       +  R+SC+D +P+C  +C R L  CG     H C   CH G C PCP    V CRCG      + CR +  ++    +C + C KK SCG+H+CN  CC    H C   C RTLSC  H+C++ C H G+CP C   SF+EL+CECGAE + PP+ CG  +P+C   CSR H C H  +HNCHS  TCPPC    +K C G H+    +PC +P  +CG+ CG+PL    H CI+ CH+GPC      C Q C++ R  C H CA  CH   C +  + C   V V C C  R     C +L    + I+ I+ ++++          L  I++P   S+  L C+ EC+   RN +LA A     S T     T YS+ ++ +AK+N      V +TL DL+K +K   +      F  ++  K   ++     F I S S  +  N+ +  +A  +R
Sbjct:  269 NTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPL---------------PPADNEKLSQREKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEV-------GWRCPACQ---NVLQDLPRD---------YLCFCGKLKNPPVSR--TELAHSCGEVC---CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVL-CGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCG-KQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITSCPCGKMPVP------AGQRSSCLDPIPTCEGICSRTL-RCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGH-MDQMIKCRQLC-NRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSCGKHKCDQPC-HRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPE--TPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRRLAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDR 1069          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Fly
Match: stc (gene:FBgn0001978 transcript:FBtr0080705)

HSP 1 Score: 471.085 bits (1211), Expect = 2.771e-148
Identity = 301/854 (35.25%), Postives = 430/854 (50.35%), Query Frame = 1
Query:  397 NNYQDKVHGYKDFHEQRGNKGNYR----TNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCN-------EKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKL---QNAISFIKFSNNLESKRES----LDLIISP-NDSSVFLICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSV-RNQNQKINMSAEINR 2859
            N  Q +   Y+D  E R  + + R        D   S+    +  R R   N F +   ++ + N +       + +  +  P RG                     D E ++QRE L+  +   + EC++CV  I++   TWSC NCYH+ H+ C   WA++  + V         RCPACQ   +V +++  D         Y CFCGK  NP V R    + HSC +VC    R E C H C+L+CHPGPCPPC+A V R+C C R+  T +C   E  L CG+ C+K LNCG HRC+  CH+G+C  CS ++ Q+C C  K  RKV C      +  +SC + C + L CG+HKC+  CH G C PC+ +P++I  C C KM +       +  R+SC+D +P+C  +C R L  CG     H C   CH G C PCP    V CRCG      + CR +  ++    +C + C KK SCG+H+CN  CC    H C   C RTLSC  H+C++ C H G+CP C   SF+EL+CECGAE + PP+ CG  +P+C   CSR H C H  +HNCHS  TCPPC    +K C G H+    +PC +P  +CG+ CG+PL    H CI+ CH+GPC      C Q C++ R  C H CA  CH   C +  + C   V V C C  R     C +L    + I+ I+ ++++          L  I++P   S+  L C+ EC+   RN +LA A     S T     T YS+ ++ +AK+N      V +TL DL+K +K   +      F  ++  K   ++     F I S S  +  N+ +  +A  +R
Sbjct:  273 NTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPL---------------PPADNEKLSQREKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEV-------GWRCPACQ---NVLQDLPRD---------YLCFCGKLKNPPVSR--TELAHSCGEVC---CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVL-CGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCG-KQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITSCPCGKMPVP------AGQRSSCLDPIPTCEGICSRTL-RCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGH-MDQMIKCRQLC-NRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSCGKHKCDQPC-HRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPE--TPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRRLAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDR 1073          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Fly
Match: CG15011 (gene:FBgn0035518 transcript:FBtr0073244)

HSP 1 Score: 207.223 bits (526), Expect = 4.439e-55
Identity = 167/515 (32.43%), Postives = 233/515 (45.24%), Query Frame = 1
Query:  658 NNFKHDKKIDLEGMNQRESLILQ--LNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATT---------------------CGNSVDKDGLK-MNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACH-AGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQ---SRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTEL 2115
             N+K            R S  L+  L+     C+IC+  IR   + WSCE+CY  FH+ CI +WA                        G  V     K ++  CP C+++Y      T          QY CFCGK++NP  +    LVPHSC + CGK  +  KC H C L+CHPGPCPPC      +C C ++   +     ++   C   C++ L CG H+C   CH  G+C  C+ +  Q C C R+S        +  S+  + C N C     CG H CE VCH G C   +  P ++  C C K          +     C +   +CG+ C+ KL+ CG H C+Q CH GPC  CP+     CRCG      + C        +   C   C +   CG+H CN +CC  +   C   CG+ LSC  H+C+  C H G C  C   S  +++C CG  K   P  CG+   +R VC   C     C HA++H CH +  CPPC ++
Sbjct:   43 KNYKPSDNAGSSKEAARTSTFLENTLHSGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAEQQNGQGHYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPT----------QYNCFCGKEVNP--ENQPFLVPHSCGEHCGKLLQ-PKCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSSPRSV-RCIDKQWTCQQTCKELLACGKHKCNQVCHQPGKCPPCTSKSLQPCECQRESK------MVNCSDRKWKCQNVCGAPFACGLHICEKVCHAGPCGDGE-CPLQVRSCPCGK----------NTQVRPCNETEETCGDTCQ-KLLSCGQHTCTQRCHRGPCISCPIRTKKKCRCGLHE-KELPC-------SKEFACETKCKQMRDCGKHACNRKCCGDQCPPCEKICGKQLSCNKHKCQSVC-HNGPCYPCKLES--QINCRCGKTKKSVP--CGRERSARIVCLELCRITPKCHHAIKHRCH-KGDCPPCGQV 511          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Zebrafish
Match: NFX1 (si:dkey-10f23.2 [Source:ZFIN;Acc:ZDB-GENE-160728-101])

HSP 1 Score: 456.447 bits (1173), Expect = 7.949e-143
Identity = 272/744 (36.56%), Postives = 384/744 (51.61%), Query Frame = 1
Query:  715 LILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKL----VDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLESKRESLDL--IISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTY---YSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            LI QL   KYECM+C  +IR  +  WSC++C+H+FH+ CI KWA +  +  D D  +   RCPACQ            +   K    Y CFCGK  NP  +R    +PHSC D+CGK     +C H C+++CHPGPCP C A +T++C C +     +C +    L+C + C   LNC  H C   CH+G C  C + ++Q CFC     R+V CG+     +    FSC   C +MLDC +H+C+  CH G+C+PC  +P  +  C C +  + ++   G   R +C D +PSCG  C + L     D  H C ++CHE  C PC L+  + CRCG S    + C +I   +     C K C KK  CGRH+C E CC    H C   CG  LSC  H+C+  C H G+C  C   SFDEL C CG   L PPI CG   P C N C+R+H C H V H+CH+E  CPPCT L  K C G H+   N+PC     +CGLVC + L    H C RICH+G C  +  +C QPC+  R  C HPC  PCH G+ C  + + C A+V + C C  +   + C      Y+   AIS     ++++   ES+D+  +         L CD EC    RN +LA+A  I  +    ++    Y+DSLK  A+++F F+  +E+ + +L+      K  K    F  +  +    I+  A  + + S S  N+ ++  +   I   + C
Sbjct:  309 LIEQLTEEKYECMVCCEVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADGDSSE-GWRCPACQ------------HVALKAPNSYTCFCGKVSNPEFQR--TEIPHSCGDMCGKKRSGGECNHPCNILCHPGPCPQCPAFITKSCVCGKMSKQVRC-SQTGPLLCEEVCGTLLNCSQHSCAQVCHSGPCQPCQLRVQQVCFCG-VVFREVACGTDSKKFDGSGYFSCCKPCGKMLDCQSHRCQQSCHPGECQPCPLSPKLVRSCSCGQTPLSKLLDLGYPERKACTDPIPSCGKTCNKPLPCGDADSVHLCEKLCHEDSCGPCSLTSSIKCRCG-SNTKEVPCAAIQTEEDMVFTCEKRCTKKRLCGRHKCGELCCVDMEHKCSMICGYKLSCGLHRCQDLC-HRGNCQPCWQTSFDELTCYCGETVLFPPIPCGTRPPECKNVCTRDHDCDHPVFHSCHNEEKCPPCTYLTKKWCMGNHEQRSNIPCHLQDISCGLVCEKLLPCGSHRCKRICHRGECQAEG-ECKQPCTHPRPGCGHPCGAPCHPGTPC--IPTVCSAKVALQCDCGRKKETVPCADAASSYQRYAAISVASKLSDMQLG-ESVDIGQLTKKEQKKARLECDQECATLERNRRLAEALQIDPSVDPFKSTSSKYTDSLKEDARKDFKFVSEIEEEIRNLVELANKGKQPKRSHCFPPMKRDHRRIIHELAEVYGVESVSYDNEPKRNVVITAIRGKSAC 1029          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Zebrafish
Match: nfxl1 (nuclear transcription factor, X-box binding-like 1 [Source:ZFIN;Acc:ZDB-GENE-110411-178])

HSP 1 Score: 217.624 bits (553), Expect = 3.455e-58
Identity = 212/665 (31.88%), Postives = 287/665 (43.16%), Query Frame = 1
Query:  715 LILQLNHNKYE--------CMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERT-KITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAV--RHNCHSESTCPPCTELVSKS-------CPG----------------------------AHKTLDNVPCFRPVAT--------------------CGLVCGRPLTGCEHSCIRICH---------QGPCALDATKCIQPCSQKR-TDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            L+ Q  H  +E        C+IC+  +R     WSC  CY IFHI CI KWA        +  D+D  K +    CP C+ EY  ++  T          +Y C+CGK+  P       L+PHSC  VCG+ ++   C H C L+CHPGPCPPC  +V+ +C C ++ ++  +C+A  +   C   C + L C  H C N CHAGEC  C     Q C C R+ + +  C S E     + C   C R L CGNHKCE VCH G C  C    +R C C   K ++             C   VP+CG+ C + L DCG H CS  CH G C  C    +  CRCG+ +   + C        +   C   CNK  +C RH+C  +CC      C   CGR L C++H+C   C H GSC  CP +   ++ CECG+  +  P  CG+ R    P C   C +  SC HA   +H CH    CPPC +    +       CP                                 L   PC  P+ T                    CG +CGR L+   H C   CH         +     +  +C + C + R   C HPC +PCH S C      C   +   C CK+ S+ + C K  +A
Sbjct:  105 LLEQTRHYLHEVCQSGGVTCLICIASVRRTQPVWSCVGCYCIFHITCIQKWAKDSIFLVSSVTDEDFGKKDHPWPCPKCRHEYSPHQTPT----------RYYCYCGKEAEPAPDPW--LLPHSCGQVCGREFK-PSCGHRCLLLCHPGPCPPCPQMVSVSCLCGKSSRVPRRCSA--KAWSCTKICGRKLPCRTHTCANTCHAGECAACPRVSLQACACGRQRAERP-CASPE-----WHCDQVCGRPLSCGNHKCERVCHAGVCGECPRAGNRSCSCGKTKSVLP------------CTVDVPTCGDTCGKNL-DCGLHTCSMRCHRGACETCRQEVEKTCRCGRYS-KLLPC-------HKEYLCESKCNKTRACSRHQCKRKCCPGNCPPCDMNCGRMLGCRNHKCPSVC-HQGSCYPCPEMV--KVGCECGSTVISVP--CGRERSTKPPRCKELCKKPPSCHHASQEKHRCHF-GPCPPCKQPCQLTLAGCVHLCPAPCHDQVLVKATDRANLAGPWEQPSTPAFVRTALPCPPCLVPIPTACLGEHEVSPVPCHARGPFSCGRLCGRTLSCGNHKCSLECHHVTPTPNSDKTMAGQECVRCEEGCVKPRPAGCAHPCVLPCHRSAC----PPCQLMLRQRCHCKISSLYIECLKFTSA 717          

HSP 2 Score: 103.219 bits (256), Expect = 7.328e-22
Identity = 139/501 (27.74%), Postives = 183/501 (36.53%), Query Frame = 1
Query: 1045 CDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSS-----RKVICGSLEASEEIFS---------------CGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRI-CRCWCEKMLIDEIGG---------------------DGSHHRNSC-VDAVPSCGNVCERKLVDCGHNCSQVCH-----------------EGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNC--SREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFR----------PVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQ-PCSQKRTDCDHPCA 2328
            CD VCG+        H C  +CH G C  C     R+C C +TK    C  D  T  CGD C K L+CGLH C   CH G C  C  E+E+ C C R S      ++ +C S        S               C   C RML C NHKC SVCHQG C PC   P+ +   C C   +I    G                       S  ++ C     P C   C+  L  C H C   CH                 E P  P  +   + C         +    + E +   V C+       SCGR                  CGRTLSC +H+C  EC HV   P+              ++K +     GQ    C   C   R   C+H     CH  S CPPC  ++ + C     +L  + C +           + +C   C + L  C H C  +CH G C  +  + ++  C  KR   D PC+
Sbjct:  325 CDQVCGRPLSCGN--HKCERVCHAGVCGECPRAGNRSCSCGKTKSVLPCTVDVPT--CGDTCGKNLDCGLHTCSMRCHRGACETCRQEVEKTCRCGRYSKLLPCHKEYLCESKCNKTRACSRHQCKRKCCPGNCPPCDMNCGRMLGCRNHKCPSVCHQGSCYPC---PEMVKVGCECGSTVISVPCGRERSTKPPRCKELCKKPPSCHHASQEKHRCHFGPCPPCKQPCQLTLAGCVHLCPAPCHDQVLVKATDRANLAGPWEQPSTPAFVRTALPC---PPCLVPIPTACLGEHEVSPVPCHA--RGPFSCGR-----------------LCGRTLSCGNHKCSLECHHVTPTPN--------------SDKTMA----GQECVRCEEGCVKPRPAGCAHPCVLPCH-RSACPPCQLMLRQRCHCKISSL-YIECLKFTSADEQDKQLLMSCQNQCPKQLL-CGHRCKLLCHAGDCDQNCGQKVKIRCPCKRIKKDFPCS 775          

HSP 3 Score: 61.2326 bits (147), Expect = 6.608e-9
Identity = 42/133 (31.58%), Postives = 71/133 (53.38%), Query Frame = 1
Query: 1045 CDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKC----NADER----TLVCGDRCEKYLNCGLHRCENACHAGECGI-CSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERM 1416
            C++ C K  R   C H C L CH   CPPC+ ++ + CHC+ + +  +C    +ADE+     + C ++C K L CG HRC+  CHAG+C   C  +++ +C C R   +   C  +++ + +  C   C+ +
Sbjct:  664 CEEGCVKP-RPAGCAHPCVLPCHRSACPPCQLMLRQRCHCKISSLYIECLKFTSADEQDKQLLMSCQNQCPKQLLCG-HRCKLLCHAGDCDQNCGQKVKIRCPCKR-IKKDFPCSRVQSQDGLLVCDETCQTL 793          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Zebrafish
Match: nfxl1 (nuclear transcription factor, X-box binding-like 1 [Source:ZFIN;Acc:ZDB-GENE-110411-178])

HSP 1 Score: 213.386 bits (542), Expect = 3.932e-57
Identity = 211/665 (31.73%), Postives = 287/665 (43.16%), Query Frame = 1
Query:  715 LILQLNHNKYE--------CMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERT-KITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAV--RHNCHSESTCPPCTELVSKS-------CPG----------------------------AHKTLDNVPCFRPVAT--------------------CGLVCGRPLTGCEHSCIRICH---------QGPCALDATKCIQPCSQKR-TDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            L+ Q  H  +E        C+IC+  +R     WSC  CY IFHI CI KWA        +  D+D  K +    CP C+ EY  ++  T          +Y C+CGK+  P       L+PHSC  VCG+ ++   C H C L+CHPGPCPPC  +V+ +C C ++ ++  +C+A  +   C   C + L C  H C N CHAGEC  C     Q C C R+ + +  C S E     + C   C R L CGNHKCE VCH G C  C    +R C C   K ++             C   VP+CG+ C + L DCG H CS  CH G C  C    +  CRCG+ +   + C        +   C   CNK  +C RH+C  +CC      C   CGR L C++H+C   C H GSC  CP +   ++ CECG+  +   + CG+ R    P C   C +  SC HA   +H CH    CPPC +    +       CP                                 L   PC  P+ T                    CG +CGR L+   H C   CH         +     +  +C + C + R   C HPC +PCH S C      C   +   C CK+ S+ + C K  +A
Sbjct:  105 LLEQTRHYLHEVCQSGGVTCLICIASVRRTQPVWSCVGCYCIFHITCIQKWAKDSIFLVSSVTDEDFGKKDHPWPCPKCRHEYSPHQTPT----------RYYCYCGKEAEPAPDPW--LLPHSCGQVCGREFK-PSCGHRCLLLCHPGPCPPCPQMVSVSCLCGKSSRVPRRCSA--KAWSCTKICGRKLPCRTHTCANTCHAGECAACPRVSLQACACGRQRAERP-CASPE-----WHCDQVCGRPLSCGNHKCERVCHAGVCGECPRAGNRSCSCGKTKSVLP------------CTVDVPTCGDTCGKNL-DCGLHTCSMRCHRGACETCRQEVEKTCRCGRYS-KLLPC-------HKEYLCESKCNKTRACSRHQCKRKCCPGNCPPCDMNCGRMLGCRNHKCPSVC-HQGSCYPCPEMV--KVGCECGSTVIS--VPCGRERSTKPPRCKELCKKPPSCHHASQEKHRCHF-GPCPPCKQPCQLTLAGCVHLCPAPCHDQVLVKATDRANLAGPWEQPSTPAFVRTALPCPPCLVPIPTACLGEHEVSPVPCHARGPFSCGRLCGRTLSCGNHKCSLECHHVTPTPNSDKTMAGQECVRCEEGCVKPRPAGCAHPCVLPCHRSACPP----CQLMLRQRCHCKISSLYIECLKFTSA 717          

HSP 2 Score: 60.4622 bits (145), Expect = 1.078e-8
Identity = 42/133 (31.58%), Postives = 71/133 (53.38%), Query Frame = 1
Query: 1045 CDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKC----NADER----TLVCGDRCEKYLNCGLHRCENACHAGECGI-CSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERM 1416
            C++ C K  R   C H C L CH   CPPC+ ++ + CHC+ + +  +C    +ADE+     + C ++C K L CG HRC+  CHAG+C   C  +++ +C C R   +   C  +++ + +  C   C+ +
Sbjct:  664 CEEGCVKP-RPAGCAHPCVLPCHRSACPPCQLMLRQRCHCKISSLYIECLKFTSADEQDKQLLMSCQNQCPKQLLCG-HRCKLLCHAGDCDQNCGQKVKIRCPCKR-IKKDFPCSRVQSQDGLLVCDETCQTL 793          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Xenopus
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:100488254])

HSP 1 Score: 416.387 bits (1069), Expect = 5.543e-128
Identity = 269/742 (36.25%), Postives = 374/742 (50.40%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVC-RCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRS---IPMICYKLQNAISFIKFSNNLESKR--ESLDL---IISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTY----YSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  + DG     RCPACQ            N  ++    Y CFC K  NP   R  + +PHSC ++CGK      C HLC+++CHPGPCP C A VT++C C +T  + +C     T  C + C   LNC  H C + CHAGEC  C   I Q C+C   SSR V+CG+ + + +    FSC  +C + L+CG H C  VCH   C+PC   P  +  C C +  + ++   G   R  C D +PSCG  C + L  CG +      +  C  CP    + C   G   F                 C+K CNKK  CGRH+CNE CC    H C   CG  L+C  H+C+  C H G+CP+C   SFDEL C CG   + PPIACG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+  +N+PC     +CGL C + L    H C RICH+G C ++   C QPC  +R DC HPC  PCH +      S C A+V + C C  R    +  +   +   I+ I  +  L   +  +S+D+   +         L CD EC    RN +LA+A +IS  S    T     Y+DSLK  A+++  F+  +EK +  L+      K +K    F  ++ +    I+  A  + + S S  ++ ++  +   I   ++C
Sbjct:  324 SLIEQLTAEKYECMVCCEVVRVMAPVWSCQSCYHVFHLNCIKKWARSPASQAE-DG-NSGWRCPACQ------------NVSSRAPNSYTCFCSKVNNPEWNR--NEIPHSCGELCGKKRSGLDCPHLCNILCHPGPCPSCPAFVTKSCQCGKTSQSVRC-GQSTTFHCTNVCGNLLNCAEHSCTHVCHAGECQSCQQIIHQACYCG-GSSRDVLCGTDKDNYDGFGNFSCQKQCGKKLNCGKHGCTEVCHPQPCQPCPRLPQVVRFCPCGQTPLSKLLELGCIDRKICTDPIPSCGKTCGKPL-PCGSHAKICLPKIQCLCCPRVSLIFCFFVGDFTFV----------------CDKRCNKKRQCGRHKCNEICCVDTDHKCSLICGHKLNCGLHRCDEPC-HRGNCPNCWQTSFDELTCYCGEAVIFPPIACGTRPPECKKPCTRQHECDHPVFHSCHSEEKCPPCTYLTQKWCMGKHELRNNIPCHLSDISCGLRCNQLLKCDMHKCKRICHKGECLINE-DCKQPCDLQRPDCGHPCMTPCHPAE-PCPPSVCNAKVDLQCECGRRKESVVCSVASSVYQRITAITMATKLTEMQLGDSVDIARFVTKKEMKQTRLQCDEECMALERNRRLAEALNISENSDPFNTRSGSKYTDSLKEDARKDLKFVSEIEKEIKALVDAVNKGKQTKKSHCFPPMNRDHRKLIHDLAEVYCVESVSYDSEPKRNVVITAIKGKSMC 1027          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Xenopus
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:100488254])

HSP 1 Score: 414.846 bits (1065), Expect = 2.941e-127
Identity = 292/886 (32.96%), Postives = 421/886 (47.52%), Query Frame = 1
Query:  349 DRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCS-HSSGFFSNKGRQRGNYNNFEKFDSNV----ISKNCNEKE--FYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQR---------------ESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSN-CQDVMSNCMAQVIVTCLCKLR------SIPMICYKLQNAISFIKFSNNLESKRESLDL---IISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTY----YSDSLKAYAKQNFDFLLLVE---KTLLDLMKSSKNIIE---FKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            D F+ +   + GK  S+  +      +      G++   R  F     H S    ++      + + EK    V    +S  C E +   + +G S G+ ++ RK   H     H  K  ++    R                SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  + DG     RCPACQ            N  ++    Y CFC K  NP   R  + +PHSC ++CGK      C HLC+++CHPGPCP C A VT++C C +T  + +C     T  C + C   LNC  H C + CHAGEC  C   I Q C+C   SSR V+CG+ + + +    FSC  +C + L+CG H C  VCH   C+PC   P  +  C C +  + ++   G   R  C D +PSCG  C + L  CG +                       G+S   ++    +  +   +  C+K CNKK  CGRH+CNE CC    H C   CG  L+C  H+C+  C H G+CP+C   SFDEL C CG   + PPIACG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+  +N+PC     +CGL C + L    H C RICH+G C ++   C QPC  +R DC HPC  PCH +  C    S C A+V + C C  R      S+    Y+   AI+       ++   +S+D+   +         L CD EC    RN +LA+A +IS  S    T     Y+DSLK  A+++  F+  +E   K L+D +   K   +   F  ++ +    I+  A  + + S S  ++ ++  +   I   ++C
Sbjct:  206 DMFENIPPQDGGKSVSSKEEIFKTRLESHDGAVGSEKKKRPQFKPLEPHGSKTSQHENTPAAAFTSKEKKTYRVKESCVSNICQEPKHHVHRWG-SDGDKHSGRK--QHSQTQDHMTKKSMQQGWSRPWNKNEVPKNKETHTSSLIEQLTAEKYECMVCCEVVRVMAPVWSCQSCYHVFHLNCIKKWARSPASQAE-DG-NSGWRCPACQ------------NVSSRAPNSYTCFCSKVNNPEWNR--NEIPHSCGELCGKKRSGLDCPHLCNILCHPGPCPSCPAFVTKSCQCGKTSQSVRC-GQSTTFHCTNVCGNLLNCAEHSCTHVCHAGECQSCQQIIHQACYCG-GSSRDVLCGTDKDNYDGFGNFSCQKQCGKKLNCGKHGCTEVCHPQPCQPCPRLPQVVRFCPCGQTPLSKLLELGCIDRKICTDPIPSCGKTCGKPL-PCGSH-----------------------GRSIVNSL----MPSTGDFTFVCDKRCNKKRQCGRHKCNEICCVDTDHKCSLICGHKLNCGLHRCDEPC-HRGNCPNCWQTSFDELTCYCGEAVIFPPIACGTRPPECKKPCTRQHECDHPVFHSCHSEEKCPPCTYLTQKWCMGKHELRNNIPCHLSDISCGLRCNQLLKCDMHKCKRICHKGECLINE-DCKQPCDLQRPDCGHPCMTPCHPAEPCPP--SVCNAKVDLQCECGRRKESVVCSVASSVYQRITAITMATKLTEMQLG-DSVDIARFVTKKEMKQTRLQCDEECMALERNRRLAEALNISENSDPFNTRSGSKYTDSLKEDARKDLKFVSEIEKEIKALVDAVNKGKQTKKSHCFPPMNRDHRKLIHDLAEVYCVESVSYDSEPKRNVVITAIKGKSMC 1037          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Xenopus
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:100488254])

HSP 1 Score: 402.905 bits (1034), Expect = 3.075e-123
Identity = 261/734 (35.56%), Postives = 366/734 (49.86%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVC-RCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTY----YSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  + DG     RCPACQ            N  ++    Y CFC K  NP   R  + +PHSC ++CGK      C HLC+++CHPGPCP C A VT++C C +T  + +C     T  C + C   LNC  H C + CHAGEC  C   I Q C+C   SSR V+CG+ + + +    FSC  +C + L+CG H C  VCH   C+PC   P  +  C C +  + ++   G   R  C D +PSCG  C + L  CG +      +  C  CP    + C   G   F                 C+K CNKK  CGRH+CNE CC    H C   CG  L+C  H+C+  C H G+CP+C   SFDEL C CG   + PPIACG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+  +N+PC     +CGL C + L    H C RICH+G C ++   C QPC  +R DC HPC  PCH +      S C A+V  + L     I  I   +   ++ ++  ++++  R                +   E K+  R   LA+A +IS  S    T     Y+DSLK  A+++  F+  +EK +  L+      K +K    F  ++ +    I+  A  + + S S  ++ ++  +   I   ++C
Sbjct:  322 SLIEQLTAEKYECMVCCEVVRVMAPVWSCQSCYHVFHLNCIKKWARSPASQAE-DG-NSGWRCPACQ------------NVSSRAPNSYTCFCSKVNNPEWNR--NEIPHSCGELCGKKRSGLDCPHLCNILCHPGPCPSCPAFVTKSCQCGKTSQSVRC-GQSTTFHCTNVCGNLLNCAEHSCTHVCHAGECQSCQQIIHQACYCG-GSSRDVLCGTDKDNYDGFGNFSCQKQCGKKLNCGKHGCTEVCHPQPCQPCPRLPQVVRFCPCGQTPLSKLLELGCIDRKICTDPIPSCGKTCGKPL-PCGSHAKICLPKIQCLCCPRVSLIFCFFVGDFTFV----------------CDKRCNKKRQCGRHKCNEICCVDTDHKCSLICGHKLNCGLHRCDEPC-HRGNCPNCWQTSFDELTCYCGEAVIFPPIACGTRPPECKKPCTRQHECDHPVFHSCHSEEKCPPCTYLTQKWCMGKHELRNNIPCHLSDISCGLRCNQLLKCDMHKCKRICHKGECLINE-DCKQPCDLQRPDCGHPCMTPCHPAE-PCPPSVCNAKVSYSILVVHYRITAI--TMATKLTEMQLGDSVDIAR---------------FVTKKEMKQTRR---LAEALNISENSDPFNTRSGSKYTDSLKEDARKDLKFVSEIEKEIKALVDAVNKGKQTKKSHCFPPMNRDHRKLIHDLAEVYCVESVSYDSEPKRNVVITAIKGKSMC 997          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Xenopus
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:100488254])

HSP 1 Score: 387.111 bits (993), Expect = 1.004e-117
Identity = 254/729 (34.84%), Postives = 358/729 (49.11%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVE---KTLLDLMKSSKNIIE---FKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  + DG     RCPACQ            N  ++    Y CFC K  NP   R  + +PHSC ++CGK      C HLC+++CHPGPCP C A VT++C C +T  + +C     T  C + C   LNC  H C + CHAGEC  C   I Q C+C   SSR V+CG+ + + +    FSC  +C + L+CG H C  VCH   C+PC   P  +  C C +  + ++   G   R  C D +PSCG  C + L  CG +                       G+S   ++    +  +   +  C+K CNKK  CGRH+CNE CC    H C   CG  L+C  H+C+  C H G+CP+C   SFDEL C CG   + PPIACG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+  +N+PC     +CGL C + L    H C RICH+G C ++   C QPC  +R DC HPC  PCH +      S C A+V + C C  R                  ++++  +R +  L IS N                     +D F+    S      Y+DSLK  A+++  F+  +E   K L+D +   K   +   F  ++ +    I+  A  + + S S  ++ ++  +   I   ++C
Sbjct:  315 SLIEQLTAEKYECMVCCEVVRVMAPVWSCQSCYHVFHLNCIKKWARSPASQAE-DG-NSGWRCPACQ------------NVSSRAPNSYTCFCSKVNNPEWNR--NEIPHSCGELCGKKRSGLDCPHLCNILCHPGPCPSCPAFVTKSCQCGKTSQSVRC-GQSTTFHCTNVCGNLLNCAEHSCTHVCHAGECQSCQQIIHQACYCG-GSSRDVLCGTDKDNYDGFGNFSCQKQCGKKLNCGKHGCTEVCHPQPCQPCPRLPQVVRFCPCGQTPLSKLLELGCIDRKICTDPIPSCGKTCGKPL-PCGSH-----------------------GRSIVNSL----MPSTGDFTFVCDKRCNKKRQCGRHKCNEICCVDTDHKCSLICGHKLNCGLHRCDEPC-HRGNCPNCWQTSFDELTCYCGEAVIFPPIACGTRPPECKKPCTRQHECDHPVFHSCHSEEKCPPCTYLTQKWCMGKHELRNNIPCHLSDISCGLRCNQLLKCDMHKCKRICHKGECLINE-DCKQPCDLQRPDCGHPCMTPCHPAE-PCPPSVCNAKVDLQCECGRR----------KESVVCSVASSVYQRRLAEALNISEN---------------------SDPFNTRSGSK-----YTDSLKEDARKDLKFVSEIEKEIKALVDAVNKGKQTKKSHCFPPMNRDHRKLIHDLAEVYCVESVSYDSEPKRNVVITAIKGKSMC 958          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Xenopus
Match: NFX1 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:100488254])

HSP 1 Score: 379.793 bits (974), Expect = 5.215e-116
Identity = 227/570 (39.82%), Postives = 301/570 (52.81%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLR 2412
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  + DG     RCPACQ            N  ++    Y CFC K  NP   R  + +PHSC ++CGK      C HLC+++CHPGPCP C A VT++C C +T  + +C     T  C + C   LNC  H C + CHAGEC  C   I Q C+C   SSR V+CG+ + + +    FSC  +C + L+CG H C  VCH   C+PC   P  +  C C +  + ++   G   R  C D +PSCG  C + L  CG +                       G+S   ++    +  +   +  C+K CNKK  CGRH+CNE CC    H C   CG  L+C  H+C+  C H G+CP+C   SFDEL C CG   + PPIACG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+  +N+PC     +CGL C + L    H C RICH+G C ++   C QPC  +R DC HPC  PCH +      S C A+V + C C  R
Sbjct:  299 SLIEQLTAEKYECMVCCEVVRVMAPVWSCQSCYHVFHLNCIKKWARSPASQAE-DG-NSGWRCPACQ------------NVSSRAPNSYTCFCSKVNNPEWNR--NEIPHSCGELCGKKRSGLDCPHLCNILCHPGPCPSCPAFVTKSCQCGKTSQSVRC-GQSTTFHCTNVCGNLLNCAEHSCTHVCHAGECQSCQQIIHQACYCG-GSSRDVLCGTDKDNYDGFGNFSCQKQCGKKLNCGKHGCTEVCHPQPCQPCPRLPQVVRFCPCGQTPLSKLLELGCIDRKICTDPIPSCGKTCGKPL-PCGSH-----------------------GRSIVNSL----MPSTGDFTFVCDKRCNKKRQCGRHKCNEICCVDTDHKCSLICGHKLNCGLHRCDEPC-HRGNCPNCWQTSFDELTCYCGEAVIFPPIACGTRPPECKKPCTRQHECDHPVFHSCHSEEKCPPCTYLTQKWCMGKHELRNNIPCHLSDISCGLRCNQLLKCDMHKCKRICHKGECLINE-DCKQPCDLQRPDCGHPCMTPCHPAE-PCPPSVCNAKVDLQCECGRR 819          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Mouse
Match: Nfx1 (nuclear transcription factor, X-box binding 1 [Source:MGI Symbol;Acc:MGI:1921414])

HSP 1 Score: 436.417 bits (1121), Expect = 5.695e-135
Identity = 285/746 (38.20%), Postives = 395/746 (52.95%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLE--SKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNL-----QTYYSDSLKAYAKQNFDFLLLVEK---TLLDLMKSSKNIIE---FKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  +++  +  WSC++C+H+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A  T+ C C RT+ T +C     ++ C + CE  LNCG H C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CG+H C  VCH   C+PC   P  +  C C +  + ++   GS+ R +C+D VPSCG VC + L     D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGL C   L    H C R+CH+G C +D   C QPC+  R DC HPC  PCH S    V + C A+V + C C  R   +IC      Y+   AIS      +++     E   LI         L CD EC    R  +LA+AFDI+  S         + +SDSLK  A+++  F+  VEK   TL++ +   KN  +   F  ++ +    I+  A  + + S S  ++ ++  +   +   +VC
Sbjct:  340 SLIEQLTTEKYECMVCCELVQVTAPVWSCQSCFHVFHLNCIKKWARSPASHADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTRHTVRC-GQPVSVHCSNACENILNCGQHHCAELCHGGQCQPCRIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARIHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHELRSNIPCHLVDISCGLPCSAMLPCGMHKCQRLCHKGECLVDEA-CKQPCTTPRGDCGHPCMAPCHPSLPCPVTA-CKAKVELQCECGRRKEMVICSEASGTYQRIVAISMASKITDMQLGDSVEISKLITKKEVQQARLQCDEECAALERRKRLAEAFDITDDSDPFNVRSSASKFSDSLKDDARKDLKFVSDVEKEMETLVEAVNKGKNNKKSHCFPPMNRDHRRIIHDLAQVYGLESISYDSEPKRNVVVTAVRGKSVC 1061          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Mouse
Match: Nfx1 (nuclear transcription factor, X-box binding 1 [Source:MGI Symbol;Acc:MGI:1921414])

HSP 1 Score: 339.347 bits (869), Expect = 9.719e-102
Identity = 206/487 (42.30%), Postives = 276/487 (56.67%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTL 2151
            SLI QL   KYECM+C  +++  +  WSC++C+H+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A  T+ C C RT+ T +C     ++ C + CE  LNCG H C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CG+H C  VCH   C+PC   P  +  C C +  + ++   GS+ R +C+D VPSCG VC + L     D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+ L
Sbjct:  340 SLIEQLTTEKYECMVCCELVQVTAPVWSCQSCFHVFHLNCIKKWARSPASHADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTRHTVRC-GQPVSVHCSNACENILNCGQHHCAELCHGGQCQPCRIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARIHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHEEL 804          

HSP 2 Score: 58.5362 bits (140), Expect = 4.424e-8
Identity = 77/301 (25.58%), Postives = 109/301 (36.21%), Query Frame = 1
Query: 1588 CGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQ-QSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPI--------ACGQSRPVCSNNCSREHSCS-----HAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFR-----PVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC 2430
            C N CE  +++CG H+C+++CH G C PC +  + VC CG ++   +    + +S       C K+C K L CG                           SH C + C H   C  CP +     +C CG   L   +         C    P C   C +  +C      H     CH E  C PC+     SC  + +T + +PC           C   C +      H C  IC    C     KC   C +K     H C  PCH  NCQ        ++   C   +   P+ C
Sbjct:  490 CSNACE-NILNCGQHHCAELCHGGQCQPCRIILNQVCYCGSTSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCG---------------------------SHTCSQVC-HPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCH-EGDCGPCSRTSVISCRCSFRTKE-LPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEIC----CVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPC 755          

HSP 3 Score: 56.225 bits (134), Expect = 2.556e-7
Identity = 58/203 (28.57%), Postives = 79/203 (38.92%), Query Frame = 1
Query: 1027 DLVPHSCDDVCGKSYR--NEKCLHLCSLMCHPGPCPPCEAIVTRNCHCE-RTKIT--TKCNADERTLVCGDRCEKY---------------------------LNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGD-CEPCQWTPDRICRCWCEKMLIDEI 1536
            D VP SC  VCGK     +   +H C  +CH G C PC      +C C  RTK    T   +++ T +C  RC K                            L CGLHRCE  CH G C  C      +  C   +S  VI   +        C   C R+ +C +H     CH  + C PC +   + C    E++ I ++
Sbjct:  611 DPVP-SCGKVCGKPLACGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRTKELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGAS--VIYPPVPCGTRPPECTQTCARIHEC-DHPVYHSCHSEEKCPPCTFLTQKWCMGKHEELTIKKL 809          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Mouse
Match: Nfx1 (nuclear transcription factor, X-box binding 1 [Source:MGI Symbol;Acc:MGI:1921414])

HSP 1 Score: 337.421 bits (864), Expect = 4.294e-101
Identity = 205/485 (42.27%), Postives = 275/485 (56.70%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHK 2145
            SLI QL   KYECM+C  +++  +  WSC++C+H+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A  T+ C C RT+ T +C     ++ C + CE  LNCG H C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CG+H C  VCH   C+PC   P  +  C C +  + ++   GS+ R +C+D VPSCG VC + L     D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+
Sbjct:  340 SLIEQLTTEKYECMVCCELVQVTAPVWSCQSCFHVFHLNCIKKWARSPASHADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTRHTVRC-GQPVSVHCSNACENILNCGQHHCAELCHGGQCQPCRIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARIHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHE 802          

HSP 2 Score: 58.151 bits (139), Expect = 5.970e-8
Identity = 77/301 (25.58%), Postives = 109/301 (36.21%), Query Frame = 1
Query: 1588 CGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQ-QSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPI--------ACGQSRPVCSNNCSREHSCS-----HAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFR-----PVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC 2430
            C N CE  +++CG H+C+++CH G C PC +  + VC CG ++   +    + +S       C K+C K L CG                           SH C + C H   C  CP +     +C CG   L   +         C    P C   C +  +C      H     CH E  C PC+     SC  + +T + +PC           C   C +      H C  IC    C     KC   C +K     H C  PCH  NCQ        ++   C   +   P+ C
Sbjct:  490 CSNACE-NILNCGQHHCAELCHGGQCQPCRIILNQVCYCGSTSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCG---------------------------SHTCSQVC-HPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCH-EGDCGPCSRTSVISCRCSFRTKE-LPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEIC----CVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPC 755          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Mouse
Match: Nfxl1 (nuclear transcription factor, X-box binding-like 1 [Source:MGI Symbol;Acc:MGI:1923646])

HSP 1 Score: 223.402 bits (568), Expect = 5.038e-60
Identity = 212/650 (32.62%), Postives = 292/650 (44.92%), Query Frame = 1
Query:  748 CMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTK-ITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAV--RHNCHSESTCPPCTELVSKS-------CP------------GAHK----------------TLDNVPCFRPVA--------------------TCGLVCGRPLTGCEHSCIRICHQ-------------GPCALDATKCIQPCSQKR-TDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            C+IC+  ++   + WSC  C+ IFH+ CI KWA        +  D D  K +    CP C+ EY   R+ TP         +Y C+CGK  +P +     LVPHSC  VC + ++   C H C L+CHPGPCPPC  +VT  C+C++ K I  +C+A + +  C   C + L CG H+CEN CHAG C  C     QKC C +K + +        +  ++ C   C + L CGNH CE VCH G C  C  +  R C C   K  +             C + VP+CG+ C+ K+++CG H CSQ CH GPC  C    +  CRCGK     M C        +   C   C K   C +H+C  +CC      C   CGRTL C++H+C   C H GSC  CP     ++ C CG  K+   + CG+ R    P C   CSR  +C HA   +H CH    CPPC +   K        CP            G H+                 L   PC  P+                     +C  +CGR L    H+C++ CH+             GP   +   C + CS+ R   C HPC +PCH   C      C+  + + C CK+ S+ + C K+  A
Sbjct:  167 CLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDYPWPCPKCRFEY--KRSETPS--------RYYCYCGKVEDPPLDPW--LVPHSCGQVCEREFKPS-CGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKQWS--CQLPCGRKLLCGHHKCENPCHAGNCQPCPRVSRQKCVCGKKVAER------SCASPVWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRSCPCQKSKFSL------------PCTEDVPTCGDSCD-KILECGIHRCSQRCHRGPCETCRQEVEKQCRCGKHT-KRMPC-------HKPYLCETKCVKMRDCQKHQCRRKCCPGNCPPCDQNCGRTLGCRNHKCPSVC-HRGSCYPCPETV--DVKCNCGNAKVT--VPCGRERTTRPPKCKELCSRPPTCHHASQEKHRCHF-GPCPPCHQPCQKVLEKCGHLCPESCHDQALVKQTGRHQPSGPWEQPAEPAFIQTALPCPPCQVPIPVECLGKHEVSPLPCHAVGPYSCKRLCGRMLRCQNHTCMKECHKVTEVDSSTGKNKAGP---ECFHCEEGCSKSRPAGCPHPCVLPCHPGKC----PPCVQMLRIKCHCKITSLYVECRKITTA 761          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Mouse
Match: Nfxl1 (nuclear transcription factor, X-box binding-like 1 [Source:MGI Symbol;Acc:MGI:1923646])

HSP 1 Score: 163.696 bits (413), Expect = 2.700e-42
Identity = 133/381 (34.91%), Postives = 185/381 (48.56%), Query Frame = 1
Query:  706 RESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTK-ITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNER 1824
            ++ L          C+IC+  ++   + WSC  C+ IFH+ CI KWA        +  D D  K +    CP C+ EY   R+ TP         +Y C+CGK  +P +     LVPHSC  VC + ++   C H C L+CHPGPCPPC  +VT  C+C++ K I  +C+A + +  C   C + L CG H+CEN CHAG C  C     QKC C +K + +        +  ++ C   C + L CGNH CE VCH G C  C  +  R C C   K  +             C + VP+CG+ C+ K+++CG H CSQ CH GPC  C    +  CRCGK     M C        +   C   C K   C +H+C  +
Sbjct:  153 KQYLNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDYPWPCPKCRFEY--KRSETPS--------RYYCYCGKVEDPPLDPW--LVPHSCGQVCEREFKPS-CGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKQWS--CQLPCGRKLLCGHHKCENPCHAGNCQPCPRVSRQKCVCGKKVAER------SCASPVWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRSCPCQKSKFSL------------PCTEDVPTCGDSCD-KILECGIHRCSQRCHRGPCETCRQEVEKQCRCGKHT-KRMPC-------HKPYLCETKCVKMRDCQKHQCRRK 491          

HSP 2 Score: 81.6481 bits (200), Expect = 1.861e-15
Identity = 67/204 (32.84%), Postives = 88/204 (43.14%), Query Frame = 1
Query: 1375 SEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICR--CWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERC-------CSSEL------------------HLCWNQCGRTLSCKSHQCERE 1905
            S + +SC   C R L CG+HKCE+ CH G+C+PC     R+ R  C C K + +           SC   V  C  VC + L    H C QVCH G C  CP S    C C KS F+      +         C   C+K L CG HRC++RC       C  E+                  +LC  +C +   C+ HQC R+
Sbjct:  309 SAKQWSCQLPCGRKLLCGHHKCENPCHAGNCQPC----PRVSRQKCVCGKKVAE----------RSCASPVWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRSCPCQKSKFSLPCTEDVPT-------CGDSCDKILECGIHRCSQRCHRGPCETCRQEVEKQCRCGKHTKRMPCHKPYLCETKCVKMRDCQKHQCRRK 491          

HSP 3 Score: 57.7658 bits (138), Expect = 5.222e-8
Identity = 54/163 (33.13%), Postives = 72/163 (44.17%), Query Frame = 1
Query: 1774 KLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCS-HAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPC 2259
            K+      C + +   R CS++   C   CGR L C  H+CE  C H G+C  CP VS  +  C CG  K +   +C      C   C +   C  H     CH    C  C     +SCP   K+  ++PC   V TCG  C + L    H C + CH+GPC
Sbjct:  290 KMVTTTCYCKKAKPIPRRCSAKQWSCQLPCGRKLLCGHHKCENPC-HAGNCQPCPRVSRQK--CVCG--KKVAERSCASPVWHCDQVCGKTLPCGNHTCEQVCHV-GACGECPRSGKRSCP-CQKSKFSLPCTEDVPTCGDSCDKILECGIHRCSQRCHRGPC 445          
BLAST of Nuclear transcription factor, X-box binding 1 vs. UniProt/SwissProt
Match: sp|P40798|STC_DROME (Protein shuttle craft OS=Drosophila melanogaster OX=7227 GN=stc PE=1 SV=2)

HSP 1 Score: 471.085 bits (1211), Expect = 2.777e-147
Identity = 301/854 (35.25%), Postives = 430/854 (50.35%), Query Frame = 1
Query:  397 NNYQDKVHGYKDFHEQRGNKGNYR----TNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCN-------EKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKL---QNAISFIKFSNNLESKRES----LDLIISP-NDSSVFLICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSV-RNQNQKINMSAEINR 2859
            N  Q +   Y+D  E R  + + R        D   S+    +  R R   N F +   ++ + N +       + +  +  P RG                     D E ++QRE L+  +   + EC++CV  I++   TWSC NCYH+ H+ C   WA++  + V         RCPACQ   +V +++  D         Y CFCGK  NP V R    + HSC +VC    R E C H C+L+CHPGPCPPC+A V R+C C R+  T +C   E  L CG+ C+K LNCG HRC+  CH+G+C  CS ++ Q+C C  K  RKV C      +  +SC + C + L CG+HKC+  CH G C PC+ +P++I  C C KM +       +  R+SC+D +P+C  +C R L  CG     H C   CH G C PCP    V CRCG      + CR +  ++    +C + C KK SCG+H+CN  CC    H C   C RTLSC  H+C++ C H G+CP C   SF+EL+CECGAE + PP+ CG  +P+C   CSR H C H  +HNCHS  TCPPC    +K C G H+    +PC +P  +CG+ CG+PL    H CI+ CH+GPC      C Q C++ R  C H CA  CH   C +  + C   V V C C  R     C +L    + I+ I+ ++++          L  I++P   S+  L C+ EC+   RN +LA A     S T     T YS+ ++ +AK+N      V +TL DL+K +K   +      F  ++  K   ++     F I S S  +  N+ +  +A  +R
Sbjct:  273 NTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPL---------------PPADNEKLSQREKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEV-------GWRCPACQ---NVLQDLPRD---------YLCFCGKLKNPPVSR--TELAHSCGEVC---CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKEEVL-CGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQCHCG-KQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITSCPCGKMPVP------AGQRSSCLDPIPTCEGICSRTL-RCGKPAHPHQCGSKCHLGQCPPCPKQTGVKCRCGH-MDQMIKCRQLC-NRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSCGKHKCDQPC-HRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPE--TPCKELVEVQCECGNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRRLAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDR 1073          
BLAST of Nuclear transcription factor, X-box binding 1 vs. UniProt/SwissProt
Match: sp|Q12986|NFX1_HUMAN (Transcriptional repressor NF-X1 OS=Homo sapiens OX=9606 GN=NFX1 PE=1 SV=2)

HSP 1 Score: 442.58 bits (1137), Expect = 1.973e-136
Identity = 288/746 (38.61%), Postives = 395/746 (52.95%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKL----VDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLE--SKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQ-----TYYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A +T+ C C RT+ T +C     ++ C + CE  LNCG H+C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CGNH C  VCH   C+ C   P  +  C C +  + ++   GS  R +C+D VPSCG VC + L    +D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGL C   L    H C R+CH+G C +D   C QPC+  R DC HPC  PCH S+   V + C A+V + C C  R   +IC      Y+   AIS      +++     E   LI         L CD EC    R  +LA+AF IS  S         + +SDSLK  A+++  F+  VEK +  L+      K+SK    F  ++ +    I+  A  + + S S  ++ ++  +   I   +VC
Sbjct:  346 SLIEQLTTEKYECMVCCELVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECGRTRHTVRC-GQAVSVHCSNPCENILNCGQHQCAELCHGGQCQPCQIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGNHTCSQVCHPQPCQQCPRLPQLVRCCPCGQTPLSQLLELGSSSRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHEFRSNIPCHLVDISCGLPCSATLPCGMHKCQRLCHKGECLVDEP-CKQPCTTPRADCGHPCMAPCHTSSPCPVTA-CKAKVELQCECGRRKEMVICSEASSTYQRIAAISMASKITDMQLGGSVEISKLITKKEVHQARLECDEECSALERKKRLAEAFHISEDSDPFNIRSSGSKFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKSHSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVC 1067          
BLAST of Nuclear transcription factor, X-box binding 1 vs. UniProt/SwissProt
Match: sp|A6QLA0|NFX1_BOVIN (Transcriptional repressor NF-X1 OS=Bos taurus OX=9913 GN=NFX1 PE=2 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 3.670e-134
Identity = 285/746 (38.20%), Postives = 394/746 (52.82%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGS-LEASEEI--FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKL----VDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLE--SKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQ-----TYYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  ++R  +  WSC++CYH+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC +    + C H C+L+CHPGPCPPC A +T+ C C RT+ T +C     ++ C + C+  LNCG H C   CH G C  C V + Q C+C   +SR V+CG+ +  S+    F C   C + L CGNH C  VCH   C+PC   P  +  C C +  + ++   GS  R +C+D VPSCG VC + L    +D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGL CG  L    H C R+CH+G C  D   C QPC+  R +C HPC  PCH S    V + C A++ + C C  R   M+C      Y+   AIS      +++     E   LI         L CD EC    R  +LA+AF IS  S         + +SDSLK  A+++  F+  +EK +  L+      KSSK    F  ++ +    I+  A  + + S S  ++ ++  +   +   ++C
Sbjct:  343 SLIEQLTTEKYECMVCCELVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRRKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECGRTRHTVRC-GQAVSVHCSNPCDNILNCGQHHCAELCHGGPCQPCRVILNQVCYCG-STSRDVLCGTDIGKSDGFGDFGCLKICGKDLKCGNHTCSQVCHPQPCQPCPRLPQLVRYCPCGQTPLSQLLELGSSGRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVYHSCHSEDKCPPCTFLTQKWCMGKHELRSNIPCHLVDISCGLPCGATLPCGMHKCQRLCHKGECLGDEI-CKQPCTTSRANCGHPCMAPCHLSLPCPV-TTCKAKIELQCECGRRKEIMVCSEASSTYQRIAAISMASKITDMQLGDSVEISKLITKKEIHQARLECDEECSALERKKRLAEAFHISDDSDPFNVRSSGSKFSDSLKEDARKDLRFVSDIEKEMEALVEAVNKGKSSKKSHCFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAVRGKSIC 1064          
BLAST of Nuclear transcription factor, X-box binding 1 vs. UniProt/SwissProt
Match: sp|B1AY10|NFX1_MOUSE (Transcriptional repressor NF-X1 OS=Mus musculus OX=10090 GN=Nfx1 PE=1 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 3.983e-134
Identity = 285/746 (38.20%), Postives = 395/746 (52.95%), Query Frame = 1
Query:  712 SLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEE---IFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLE--SKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNL-----QTYYSDSLKAYAKQNFDFLLLVEK---TLLDLMKSSKNIIE---FKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            SLI QL   KYECM+C  +++  +  WSC++C+H+FH+ CI KWA +  +  D    +   RCPACQ   +V+ +V P+         Y CFCGK  NP   R  + +PHSC +VC K    + C H C+L+CHPGPCPPC A  T+ C C RT+ T +C     ++ C + CE  LNCG H C   CH G+C  C + + Q C+C   +SR V+CG+     +    FSC   C + L CG+H C  VCH   C+PC   P  +  C C +  + ++   GS+ R +C+D VPSCG VC + L     D  H C ++CHEG C PC  +  + CRC       + C S+ +S+  +  C+K CNKK  CGRH+CNE CC  + H C   CGR L C  H+CE  C H G+C +C   SFDEL C CGA  + PP+ CG   P C+  C+R H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGL C   L    H C R+CH+G C +D   C QPC+  R DC HPC  PCH S    V + C A+V + C C  R   +IC      Y+   AIS      +++     E   LI         L CD EC    R  +LA+AFDI+  S         + +SDSLK  A+++  F+  VEK   TL++ +   KN  +   F  ++ +    I+  A  + + S S  ++ ++  +   +   +VC
Sbjct:  340 SLIEQLTTEKYECMVCCELVQVTAPVWSCQSCFHVFHLNCIKKWARSPASHADG---QSGWRCPACQ---NVSAHV-PNT--------YTCFCGKVKNPEWSR--NEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTRHTVRC-GQPVSVHCSNACENILNCGQHHCAELCHGGQCQPCRIILNQVCYCG-STSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPCQPCPRLPHLVRYCPCGQTPLSQLLEHGSNARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRT-KELPCTSL-KSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPC-HRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARIHECDHPVYHSCHSEEKCPPCTFLTQKWCMGKHELRSNIPCHLVDISCGLPCSAMLPCGMHKCQRLCHKGECLVDEA-CKQPCTTPRGDCGHPCMAPCHPSLPCPVTA-CKAKVELQCECGRRKEMVICSEASGTYQRIVAISMASKITDMQLGDSVEISKLITKKEVQQARLQCDEECAALERRKRLAEAFDITDDSDPFNVRSSASKFSDSLKDDARKDLKFVSDVEKEMETLVEAVNKGKNNKKSHCFPPMNRDHRRIIHDLAQVYGLESISYDSEPKRNVVVTAVRGKSVC 1061          
BLAST of Nuclear transcription factor, X-box binding 1 vs. UniProt/SwissProt
Match: sp|Q18034|NFX1_CAEEL (Transcriptional repressor NF-X1 homolog OS=Caenorhabditis elegans OX=6239 GN=nfx-1 PE=3 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 6.247e-132
Identity = 286/768 (37.24%), Postives = 387/768 (50.39%), Query Frame = 1
Query:  607 GPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHI--GCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQ--CNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPND----SSVF-----LICDSECKKNARNIKLADAFDISLTSSNLQTY-----YSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKN--------LDENKADFINRYAACFKINSKSV 2814
            G SR      R+++      + + KI L     RE L+  L +NKYEC IC   I      WSC+ CYHIFHI  GCI+ WA +   S DK+G     RCP CQ E +      P N        Y CFCG+  NP  + G   VPHSC + CG + R   C H C+ +CHPGPC  C+   T++C+C +TK + +C +D+  ++C   C K L+CG H CE  CH+G+CG C+V +EQ CFC  K+ ++V C     + E +SCG+ C+ M  CG H C   CH  +C  C+   +RI  C C +  +  +G      R  C D VP+C +VC+ K + CG     H+C + CHEGPC PC L+  V+CRCG S    + C    +  + + +  C K C KK SCG H+C E CC  + H C   C + LSC  H CE  C H G C  C   SFDE  C CG    +PPI CG   PVCS  C R HSC H+V H CH E  CPPCT+L  K C G H+   N+PC     +CG+VC +PL    H C R CH   C  +  KC + C   R  C+HPCA+PCH  S C+   S C A V ++C C        C ++   I         E      +  +        S+ F     + CD ECKK  RN K+A+A ++      +        +   LK   + N DF+  VEK L+DL+    +   + +        +   K  F++ YA  F I S+SV
Sbjct:  189 GNSRRGQGARRREQKEEPLTEEETKI-LADKPLREGLVYLLENNKYECAICYTRITTRQGVWSCKTCYHIFHISTGCITDWARS---SRDKEGAN-TWRCPTCQTENET----MPYN--------YYCFCGRMRNPNFRVGE--VPHSCGETCGGA-RKFGCPHPCTELCHPGPCIECKLFTTKSCNCGKTKKSVRCGSDQE-VMCETVCGKQLSCGQHNCERICHSGDCGECTVILEQDCFCG-KTPKEVSCNP--CAHEKYSCGSECDGMFSCGIHHCTKKCHDKECGECETGANRIRTCPCGRNTLQSLGVT----RKKCTDMVPTCDSVCD-KWLTCGTPGKNHHCREKCHEGPCPPCNLNTSVICRCGTSK-GVIPCDEYLQIMKTTGEYLCTKRCRKKKSCGMHKCQEVCCIQDEHFCLQMCNKRLSCGIHTCENVC-HAGQCRPCLQASFDEQFCHCGHTVRMPPIPCGARLPVCSQPCVRPHSCDHSVSHKCHGEQNCPPCTQLTEKMCYGGHRVRKNIPCHIDSVSCGVVCKKPLKCGVHVCQRTCHGEECEKEGEKCTKKCETIRELCEHPCALPCHEDSPCEP--SPCKASVRISCECGRIKKDAPCCEVDKMILSKLEKEEEEKSESDGEEKVVKEGILKRSTSFSQLNCMKCDDECKKLERNRKVAEALEVDTDEYGMNKLAPTISFPCYLKEMVRTNIDFVKSVEKILIDLVIQILSGEAYHDTFRAHLPAMSIEKRRFVHEYANFFNIASESV 923          
BLAST of Nuclear transcription factor, X-box binding 1 vs. TrEMBL
Match: A0A0F7GXR2 (Nuclear transcription factor X-box binding 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 9.345e-163
Identity = 257/257 (100.00%), Postives = 257/257 (100.00%), Query Frame = 1
Query: 2251 GPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVCXXXXXXXXXXXXEFPVLFPLKSDVEKIPALPSSTNLPMSFADRIRLSKKE 3021
            GPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVCTPRPLLTDLLRREFPVLFPLKSDVEKIPALPSSTNLPMSFADRIRLSKKE
Sbjct:    1 GPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVCTPRPLLTDLLRREFPVLFPLKSDVEKIPALPSSTNLPMSFADRIRLSKKE 257          
BLAST of Nuclear transcription factor, X-box binding 1 vs. TrEMBL
Match: B3MM96 (Uncharacterized protein OS=Drosophila ananassae OX=7217 GN=Dana\GF14341 PE=4 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 6.109e-153
Identity = 292/754 (38.73%), Postives = 399/754 (52.92%), Query Frame = 1
Query:  670 HDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRE-------SLDLIISP---NDSSVFLICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSV-RNQNQKINMSAEINR 2859
            H    D E ++QRE LI  +   + EC++CV  I+A   TWSC+NCYH+ H+ C + WA++  + V         RCPACQ            N   +   +Y CFCGK  NP V R    +PHSC +VC    R E C H C+L+CHPGPCPPC+A V R+C C R+  T +C   E  L+CG+ C+K LNCG HRC++ CHAG+C  CS ++EQ C C  K  R+V C      +  +SC   C + L CGNHKC+  CH G C PC+ +PD+I  C C KM +       S  R SC+D +P+C  +C R ++ CG     H C   CH G C PCP    V CRCG      + CR +S ++    +C + C KK SCG+H+CN  CC    H C   C RTLSC  H+C++ C H G+CP C   SF+EL+CECGAE + PP+ CG  +P+C   CSR H C H  +HNCHS++TCPPC    +KSC G H+    +PC +   +CG+ C +PL    H CI+ CH+G C      C Q C++ R  C H C+ PCH  +C +  + C   V V C C  R     C +L    S I  +    S  E        L  I++P   N S+  L C+ EC+   RN +LA A       T     T YS+ +K +AK+N      V +TL DL+K +K   +      F  ++  K   ++     F I S S  +  N+ +  +A   R
Sbjct:  370 HPPPADNEKLSQREKLIRDIEQRRLECLVCVEAIKAHQPTWSCQNCYHVLHLKCTTTWASSSKSEV-------GWRCPACQ------------NVLQELPREYLCFCGKLKNPPVSR--SELPHSCGEVC---CRIEGCSHACTLLCHPGPCPPCQANVVRSCGCGRSTKTMQCAMKE-DLLCGEVCDKLLNCGEHRCKSECHAGKCVACSEQVEQHCHCG-KQDRQVTCTRESQDKRSYSCKESCGKPLPCGNHKCKDSCHAGSCRPCKLSPDQITSCPCGKMPV------ASSQRTSCLDPIPTCEGICSR-VLRCGKPAHPHQCGSKCHLGQCPPCPKQTAVKCRCGH-MDQMIKCRQLS-TRADDARCKRRCTKKRSCGKHKCNAECCIDIDHACPLPCNRTLSCGKHKCDQPC-HRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKRPCSRSHPCEHPPQHNCHSDATCPPCMLFTTKSCHGGHEQRKTIPCSQESFSCGMACAKPLACGRHKCIKPCHEGACQAAGDVCRQSCTKPRPTCGHKCSAPCHEGSCPE--TPCKELVEVQCECGNRKQSRSCQELAREHSRIATAQLASSMAEMSRGNYMELSEILAPSKANKSNRTLDCNDECRLLERNRRLAMALSSRNPETQQKSLTKYSEFVKGFAKRNPVLTKSVYETLSDLVKLAKESKQRSRSHSFPTMNREKRQLVHELCEIFGIESVSYDKEPNRNVVATAHKER 1085          
BLAST of Nuclear transcription factor, X-box binding 1 vs. TrEMBL
Match: A0A3Q2XKF4 (Nuclear transcription factor, X-box binding 1 OS=Hippocampus comes OX=109280 GN=NFX1 PE=4 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 4.346e-152
Identity = 294/782 (37.60%), Postives = 413/782 (52.81%), Query Frame = 1
Query:  628 YNNRKDRNHGNNFKHDKKI---DLEGMNQRES--LILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGS----LEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKR-------ESLD---LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQ----TYYSDSLKAYAKQNFDFLLLVE---KTLLDLMKSSKNIIE---FKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVC 2871
            ++NR +R  G+ ++  + +   ++   NQ ++  LI QL+  KYECM+C ++IR  +  WSC +C+H+FH+ CI KWA +  +  D        RCPACQ            N   K    Y CFCGK  NP  +R    +PHSC D+CGK      C H C+++CHPGPCP C A VT++C C RT    +CN     L C   C   LNCG H C   CHAG C  C +E++Q C+C   S+R+V CG+    L+AS   FSC   C +ML+C  H+C+  CH+G C PC  +P  +  C C + L+ ++   G   R SC D +PSCG  C   L     D  H C ++CHEG C PC L+  + CRC  S    + C +I    +    C K CNKK +CGRH+C E CC S  H C   CG  L+C  H+C+  C H G+C  C   SFDEL C CGA  L PPI CG S P C N C+R H C H V HNCH+E  CPPCT L  K C G H+   N+PC     +CGL CG+ L    H C RICH+G C+  A  C QPC+  R DC HPCA PCH G+ C +  + C ++V + C C  R   + C   + A S+++++    + +       +SLD   L+         L CD EC    RN +LA+A  I  +S        + YS SLK  A+++  F+  VE   K L++L+   K       F+ ++ ++   ++  A  + + S S  ++ ++  +   +   ++C
Sbjct:  208 HDNRTNRQPGDRYRGQRSVRNRNMPQSNQTQTGCLIEQLSSEKYECMVCCDVIRLMAPVWSCHSCFHVFHLNCIKKWARSPASQADDSA--DGWRCPACQ------------NVALKHPASYTCFCGKVTNPEWQRSE--IPHSCGDMCGKKRSGADCNHPCNILCHPGPCPQCPAFVTKSCVCGRTSQPMRCNQPS-LLHCDTACGAALNCGRHVCAQVCHAGPCQPCQLEVQQACYCG-VSTREVPCGTDSEGLDASGN-FSCQKTCGKMLNCEAHRCQQPCHRGSCPPCPRSPSTVKTCPCGQTLLAKLLELGCPERKSCSDPIPSCGKTCSMPLPCGSNDTIHQCDKLCHEGACGPCSLTSTIRCRCA-SKTKEVPCATIKREDELVFTCEKRCNKKRTCGRHKCGELCCVSVDHKCQLICGYKLNCGLHRCQEPC-HRGNCEPCWQSSFDELTCYCGASVLYPPIPCGTSPPECKNLCTRRHECDHPVFHNCHTEEKCPPCTYLTDKWCMGKHEQRSNIPCHLQDISCGLTCGKSLPCQMHRCKRICHRGDCSAVAGGCSQPCALPRPDCGHPCAAPCHTGTACPN--TTCTSKVALECDCGRRKETVSC--TEAASSYLRYTAITMASKLSDMQPGDSLDIGPLLAKKELKQSRLECDEECATLERNKRLAEALQIDPSSDPFHARSPSVYSSSLKDDARKDLKFVSGVEEAIKNLVELVSKGKQPKRSHCFQPMNRDRRRIVHELAEVYAVESVSYDSEPKRNVVVTALKGKSLC 964          
BLAST of Nuclear transcription factor, X-box binding 1 vs. TrEMBL
Match: A0A154PBD9 (Protein shuttle craft OS=Dufourea novaeangliae OX=178035 GN=WN55_10736 PE=4 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 5.290e-152
Identity = 333/933 (35.69%), Postives = 471/933 (50.48%), Query Frame = 1
Query:  220 QNNKYFHNNRSEMPREN--------------KFYSHYNNKNQKTVENKFNNDPY-----HNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSG-------------FFSNKGR----QRGNYNNFEKFDSNVISKN--CNEKEFYEFGPSRGNY-YNNRKDRNHGNNFK----HDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNN-LESKRESLDLIISPNDSSVF------------LICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKS 2811
            Q+NKY+   R+ + + N              K Y++YN+ ++++     N   Y     HN D ++Y E   N +  +  +++  H  +D   +R  +   + N+N+    S               +S +GR    +R   +  E F     SKN   ++KE       +GN  + N++D +  N  +    + K +  +  +QRE L  QLN  + EC++C   IR     WSC NC+H+ H+ C+ KWA +   S   +G     RCPACQ   +V+  +  D         Y CFCGK   P   R    V HSC +VCG++     C H C+L+CHPG CP C A+VTR C C +T  T +C+   + L+C   C+K L CG H+CE  CH GEC  C   IEQKC+C  K+ R+VIC +    E  +SC   C ++LDCGNH C  +CH   CEPC  TP+++  C C + L+ E        R +C D +P C  VC + L  CG     H C   CHEG C  C L+ DV CRCG +    +AC+ ++ S+    +C K C K+ SCGRH+CN+ CC    H+C   C +TLSC  H+CE+ C H G C  C   SFDEL+CECGA  + PP+ CG  RPVC   CSR+HSC H V HNCHSE  CPPCT L  + C G H+    V C+    +CGL C +P++   H CI ICH G C     +C QPC+  R  C H CA PCH   C DV   C   V VTC C  R +  +C   +N   + + +++ L SK   + L  S N   VF            L C+ ECK   RN KLA    I     S  L   YSDS+K +AK++  F  +V + L +L+  +K   +      F  + +++ DF++     F   S++
Sbjct:  210 QDNKYYTKRRNTVAKYNNVQSNGTKQSIDQSKEYTYYNSGSKQSYAYHKNTRKYPYNIRHNRDEYNYREKRYNCQGQNETWEN--HSKEDKQLERREQLCSQKNYNEVRQGSSEEVQLGTKELKEKGYSYQGRDGHKERNKQDKIETFKERDRSKNNILDDKE-------KGNENWRNKRDISEKNGIQKRIQNKKSLVDDDASQRERLTEQLNRGQLECLVCCENIRQNDYIWSCSNCHHVLHLKCVKKWAKS---SQADNGW----RCPACQ---NVSSTIPDD---------YFCFCGKTKAPEWNRRD--VAHSCGEVCGRTLSKNNCPHKCTLLCHPGSCPQCVAMVTRYCGCGKTSQTVQCST-HKLLLCESICDKDLLCGAHKCEKQCHHGECSNCEKTIEQKCYCG-KNKREVICQNGVPRE--YSCETVCGKLLDCGNHICTKLCHPDVCEPCVLTPEKVTTCCCGQTLLTE-------ERKTCSDPIPCCDKVCSKNL-KCGQPNNPHTCKVKCHEGDCPICDLTTDVKCRCG-NMDREIACKDLT-SKADDARCEKRCTKRRSCGRHKCNQLCCIEVEHICPMMCSKTLSCGRHKCEQTC-HKGRCQPCWRSSFDELYCECGAAVIYPPVPCGTRRPVCDRPCSRQHSCGHEVLHNCHSEPICPPCTVLTQRWCHGKHELRKAVACYVNEISCGLPCNKPISCGRHKCITICHPGSCEKPGQQCTQPCTISREMCGHICAAPCHDGKCPDVP--CKEMVKVTCQCGHRMMSRVC--AENTKEYQRIASSILASKMADMQLGHSINLEEVFGQGAKKQNQLKTLECNDECKLIERNRKLALGLQIVNPDLSGKLMPRYSDSMKQWAKKDPHFCQMVHEKLTELVHLAKTSKQKSRSYSFDCMKKDRRDFVHESCEHFGCESQA 1093          
BLAST of Nuclear transcription factor, X-box binding 1 vs. TrEMBL
Match: E2C3V1 (Protein shuttle craft OS=Harpegnathos saltator OX=610380 GN=EAI_14467 PE=4 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 6.904e-152
Identity = 321/882 (36.39%), Postives = 445/882 (50.45%), Query Frame = 1
Query:  244 NRSE-MPRENKFYSHYNNKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDK-------VHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRN----HGNNFKHDKKIDLEG-MNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNN-LESKRESLDLIISPNDSSVF------------LICDSECKKNARNIKLADAFDI--SLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKN------IIEFKNLDENKADFI 2772
            NR E  PREN       N+N ++  +K N        RF+   + +N  K++ +  D+          Y         + NY+   N+ +  +G  SN   +R      +  DS       +  E   +   +   + +R + N    H       KK++++   +QRE L  QLN    EC++C   I+     WSC NCYH+ H+ CI KWAT+  + +DK       RCPACQ       ++ P+N        Y CFCGK   P   R    V HSC + CG++   + C+H C+L+CHPG CP C A+VT+ C C +T  T +C+A  + L+C   C K L CG H CE  CH GEC  C   ++Q CFC +K+ ++V+C +     + +SC N C + LDCG H C  +CH G CE C  TPD++  C C +M + EI       R SC+D VP+C  +C + L  CG     H C   CH G C  C L+ DV CRCG +    +ACR + +S+    +C K C KK SCG+H CN+ CC    H+C   C +TLSC  H+CE+ C H+G CP C   SFDEL+CECGAE + PP+ CG  RP C+  CSR+H C H V HNCHSE TCPPC+ L  + C G H+    VPC     +CGL C +PL    H CI +CH G C      C QPC   R  C H CA PCH   C D  + C   V VTC C  R++   C  + NA  + + ++N L SK   + L  S N   VF            L C+ ECK   RN +LA    I     S  L   YSD +K +AK++  F  +V + L +L++ +K          F +++  K  F+
Sbjct:  333 NRGETFPREN-------NENLESASSKSNVQRNGKPKRFNNHANTSNYYKYNPDNSDRSELVGRITRRYTGNSRSERYESNYKGRKNNFNLQTGPRSNGYSKRSGNEKLDDRDSRDGGGKDSNVETINYKEKKVENWRDRAENNGTTAHMQRRNLQKKLEIDDDASQRERLSEQLNRGTLECLVCYEHIKQNDYVWSCGNCYHVLHLKCIQKWATS--SQIDK-----GWRCPACQNV----SSIVPEN--------YYCFCGKMKMPEWNRRD--VAHSCGETCGRNLSKKGCVHKCTLLCHPGSCPQCVAMVTKYCGCGKTSQTLQCSA-HKPLLCDSICGKDLPCGKHVCEKKCHQGECESCDKTVQQTCFCGKKT-QEVLCRA--NVSDTYSCDNICNKKLDCGKHNCRKICHPGSCESCSLTPDKVVSCCCGQMPLTEI-------RESCLDPVPTCDKICSKTL-KCGQPSNPHTCKAPCHMGECPECDLTSDVKCRCG-NMDREIACRDL-KSKADDARCEKRCKKKRSCGKHNCNQLCCIDIEHICPLPCSKTLSCGRHKCEQRC-HIGRCPPCWQSSFDELYCECGAEVIYPPVPCGTRRPTCNRPCSRQHPCGHEVLHNCHSEPTCPPCSVLTQRWCHGKHELRKAVPCHVNEISCGLPCNKPLPCGRHKCITMCHSGSCEKPGQSCTQPCVITRELCGHICATPCHDGKCPD--TPCKETVKVTCQCGHRTMSRTC--VDNAREYQRIASNILASKMADMQLGHSVNLEEVFGQGAKKQNQLKTLECNDECKTIERNRRLALGLQIVNPDLSGKLMPRYSDYMKQWAKKDPHFCQMVHEKLTELVQLAKTSKHKSRSYSFDSMNREKRHFV 1167          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Cavefish
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:103047189])

HSP 1 Score: 465.307 bits (1196), Expect = 7.122e-146
Identity = 278/733 (37.93%), Postives = 384/733 (52.39%), Query Frame = 1
Query:  715 LILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA---ISFIKFSNNLESKR--ESLD--LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT-----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            LI QL+  KYECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D  G     RCPACQ       NV P     K    Y CFCGK  NP   R    +PHSC D+CGK      C H C+++CHPGPCP C A VT++C C RT    +C+  E +L C   C   LNC  H C   CH G C  C + ++Q C C     R+V CG+     +    FSC   C +ML+C  H+C+  CH G C+PC  +P  +  C C +  + ++   G   R SC D +PSCG +C RK + CG     H C ++CHE  C PC L+  + CRCG S    + C  I   ++    C + C KK SCGRH+C E CC    H C   CG  L+C  H+C+  C H G+C +C   SFDEL C CG   + PP+ CG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGLVC +PL  C H C +ICH+G C  +  +C QPCS  R +C HPC+ PCH G+ C    + C A+V + C C  R   M C +  N+    + I  ++ L   +  ES+D  L+         L CD EC    RN +LA+A  I  ++    +      +SDSLK  A++ F F+  VE+ + +L+      K +K    F  +       ++  A  + + S S  ++ ++
Sbjct:  344 LIEQLSEEKYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDSG--EGWRCPACQ-------NVAP-----KAPTSYICFCGKMTNPEYHR--SEIPHSCGDMCGKKRTGGNCNHPCNILCHPGPCPQCPAFVTKSCICGRTSKQVRCSQAE-SLRCEQVCGALLNCAEHPCTQICHQGVCQPCQLLVQQVCCCG-VVHREVPCGTDRDRFDGIGHFSCNKPCGKMLECQVHRCQQTCHTGQCQPCPLSPKLVRSCPCGQTALAKLLELGYPERRSCTDPIPSCGKIC-RKPLPCGDADTIHLCDKLCHEDSCGPCALTSTIKCRCG-SKTKEVPCAVIQREEELMFTCERRCTKKRSCGRHKCGEMCCVDIEHKCSKICGYKLNCGLHRCQELC-HRGNCHTCWQTSFDELSCYCGETVMFPPVPCGTKPPECKKPCTRQHDCDHPVFHSCHSEDRCPPCTYLTKKWCMGNHEQRSNIPCHLQDISCGLVCNKPLPSCSHRCKKICHRGECDAEG-ECKQPCSHPRPECGHPCSAPCHPGTPC--PRNTCPAKVSMQCECGRRKETMPCTEAANSQQRFAAISVASKLSDMQLGESVDIGLMTKKEQKQARLECDQECATLERNRRLAEALQIDQSADPFNSKTSTCKFSDSLKDDARRQFKFVNDVEEEIKNLVELANKGKQTKRSHCFPPMKREHRRIVHELAEVYGVESMSYDSEPKR 1052          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Cavefish
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:103047189])

HSP 1 Score: 465.307 bits (1196), Expect = 7.122e-146
Identity = 278/733 (37.93%), Postives = 384/733 (52.39%), Query Frame = 1
Query:  715 LILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA---ISFIKFSNNLESKR--ESLD--LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT-----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            LI QL+  KYECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D  G     RCPACQ       NV P     K    Y CFCGK  NP   R    +PHSC D+CGK      C H C+++CHPGPCP C A VT++C C RT    +C+  E +L C   C   LNC  H C   CH G C  C + ++Q C C     R+V CG+     +    FSC   C +ML+C  H+C+  CH G C+PC  +P  +  C C +  + ++   G   R SC D +PSCG +C RK + CG     H C ++CHE  C PC L+  + CRCG S    + C  I   ++    C + C KK SCGRH+C E CC    H C   CG  L+C  H+C+  C H G+C +C   SFDEL C CG   + PP+ CG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGLVC +PL  C H C +ICH+G C  +  +C QPCS  R +C HPC+ PCH G+ C    + C A+V + C C  R   M C +  N+    + I  ++ L   +  ES+D  L+         L CD EC    RN +LA+A  I  ++    +      +SDSLK  A++ F F+  VE+ + +L+      K +K    F  +       ++  A  + + S S  ++ ++
Sbjct:  344 LIEQLSEEKYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDSG--EGWRCPACQ-------NVAP-----KAPTSYICFCGKMTNPEYHR--SEIPHSCGDMCGKKRTGGNCNHPCNILCHPGPCPQCPAFVTKSCICGRTSKQVRCSQAE-SLRCEQVCGALLNCAEHPCTQICHQGVCQPCQLLVQQVCCCG-VVHREVPCGTDRDRFDGIGHFSCNKPCGKMLECQVHRCQQTCHTGQCQPCPLSPKLVRSCPCGQTALAKLLELGYPERRSCTDPIPSCGKIC-RKPLPCGDADTIHLCDKLCHEDSCGPCALTSTIKCRCG-SKTKEVPCAVIQREEELMFTCERRCTKKRSCGRHKCGEMCCVDIEHKCSKICGYKLNCGLHRCQELC-HRGNCHTCWQTSFDELSCYCGETVMFPPVPCGTKPPECKKPCTRQHDCDHPVFHSCHSEDRCPPCTYLTKKWCMGNHEQRSNIPCHLQDISCGLVCNKPLPSCSHRCKKICHRGECDAEG-ECKQPCSHPRPECGHPCSAPCHPGTPC--PRNTCPAKVSMQCECGRRKETMPCTEAANSQQRFAAISVASKLSDMQLGESVDIGLMTKKEQKQARLECDQECATLERNRRLAEALQIDQSADPFNSKTSTCKFSDSLKDDARRQFKFVNDVEEEIKNLVELANKGKQTKRSHCFPPMKREHRRIVHELAEVYGVESMSYDSEPKR 1052          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Cavefish
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:103047189])

HSP 1 Score: 465.307 bits (1196), Expect = 7.122e-146
Identity = 278/733 (37.93%), Postives = 384/733 (52.39%), Query Frame = 1
Query:  715 LILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEI---FSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-----HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA---ISFIKFSNNLESKR--ESLD--LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT-----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            LI QL+  KYECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D  G     RCPACQ       NV P     K    Y CFCGK  NP   R    +PHSC D+CGK      C H C+++CHPGPCP C A VT++C C RT    +C+  E +L C   C   LNC  H C   CH G C  C + ++Q C C     R+V CG+     +    FSC   C +ML+C  H+C+  CH G C+PC  +P  +  C C +  + ++   G   R SC D +PSCG +C RK + CG     H C ++CHE  C PC L+  + CRCG S    + C  I   ++    C + C KK SCGRH+C E CC    H C   CG  L+C  H+C+  C H G+C +C   SFDEL C CG   + PP+ CG   P C   C+R+H C H V H+CHSE  CPPCT L  K C G H+   N+PC     +CGLVC +PL  C H C +ICH+G C  +  +C QPCS  R +C HPC+ PCH G+ C    + C A+V + C C  R   M C +  N+    + I  ++ L   +  ES+D  L+         L CD EC    RN +LA+A  I  ++    +      +SDSLK  A++ F F+  VE+ + +L+      K +K    F  +       ++  A  + + S S  ++ ++
Sbjct:  344 LIEQLSEEKYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDSG--EGWRCPACQ-------NVAP-----KAPTSYICFCGKMTNPEYHR--SEIPHSCGDMCGKKRTGGNCNHPCNILCHPGPCPQCPAFVTKSCICGRTSKQVRCSQAE-SLRCEQVCGALLNCAEHPCTQICHQGVCQPCQLLVQQVCCCG-VVHREVPCGTDRDRFDGIGHFSCNKPCGKMLECQVHRCQQTCHTGQCQPCPLSPKLVRSCPCGQTALAKLLELGYPERRSCTDPIPSCGKIC-RKPLPCGDADTIHLCDKLCHEDSCGPCALTSTIKCRCG-SKTKEVPCAVIQREEELMFTCERRCTKKRSCGRHKCGEMCCVDIEHKCSKICGYKLNCGLHRCQELC-HRGNCHTCWQTSFDELSCYCGETVMFPPVPCGTKPPECKKPCTRQHDCDHPVFHSCHSEDRCPPCTYLTKKWCMGNHEQRSNIPCHLQDISCGLVCNKPLPSCSHRCKKICHRGECDAEG-ECKQPCSHPRPECGHPCSAPCHPGTPC--PRNTCPAKVSMQCECGRRKETMPCTEAANSQQRFAAISVASKLSDMQLGESVDIGLMTKKEQKQARLECDQECATLERNRRLAEALQIDQSADPFNSKTSTCKFSDSLKDDARRQFKFVNDVEEEIKNLVELANKGKQTKRSHCFPPMKREHRRIVHELAEVYGVESMSYDSEPKR 1052          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Cavefish
Match: nfxl1 (nuclear transcription factor, X-box binding-like 1 [Source:ZFIN;Acc:ZDB-GENE-110411-178])

HSP 1 Score: 223.402 bits (568), Expect = 2.326e-60
Identity = 224/758 (29.55%), Postives = 320/758 (42.22%), Query Frame = 1
Query:  706 RESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWAT----TCGNSVDKDGLKMN--LRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAVR--HNCHSESTCPPCTELVSKSCP-GAH----------------------------------KTLDNVPCFRPVAT-------------------CGLVCGRPLTGCEHSCIRICH---------QGPCALDATKCIQPCSQKRTD-CDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICY-KLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSEC----KKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNII 2733
            R+ L          C+IC+  ++   + WSC  CY IFHI CI KWA        +  D+D  K +    CP C+ EY          S  +   +Y C+CGK+++P       L+PHSC  VC + ++   C H C L+CHPGPCPPC  +V+ +C C +     +     +   CG  C + L C +H C + CHAG C  C     QKC C R S+ +      + +  ++ C   C R L CGNH CE VCH G C  C    +R C C   K  +             C   VP+CG+ C++KL +CG H CS  CH+GPC  C    +  CRCG+ +   M C        +   C   CN+  SC RH+C  +CC      C   CGR+L C++H+C   C H GSC  CP V   ++ C CG   L   + CG+ +    P C   CS+  SC H  R  H CH    CP C ++     P  AH                                  K L   PC  P+ T                   CG  CGR LT   HSC  +CH         +     +  +C + CS+ R   C HPC++PCH  +C      C   +   C CK+ ++ + C  K++     IK   +    RE   L+          +CD  C    KK A + +  +   +    + L+ +         K   +  + VE+ L   +K  K ++
Sbjct:  140 RQYLNEAFQSGAVTCLICIASVKRTQAIWSCVGCYCIFHIPCIQKWAKDSIFLVSSVTDEDFGKKDHPWPCPKCRHEY----------SPQQTPCRYHCYCGKEVDPAPDPW--LLPHSCGQVCDREFK-PSCGHRCLLLCHPGPCPPCPKMVSVSCVCGKAVPVPR-RCSNKAWTCGKVCSRKLPCRIHTCTHTCHAGVCEPCPRVSVQKCVCGRSSAER------QCASPVWHCDQVCGRPLPCGNHTCERVCHPGVCGECPRAGNRTCPCGKSKCALP------------CTADVPTCGDTCDKKL-ECGLHTCSMRCHKGPCETCREEVEKQCRCGRYS-KRMPC-------HKEYLCESKCNQTRSCSRHQCRRKCCPGNCPPCDLNCGRSLGCRNHKCPSVC-HQGSCYPCPEVV--QVKCACGKTSLT--VPCGREKSTKPPRCRELCSKPSSCHHPTREHHRCHF-GPCPGCKQVCKLPLPCCAHLCPAPCHDQVLLKTNQQVPLAGPWEQPSTPAFECKALPCPPCQVPIPTYVHTHCVSPIPCHTRGPFSCGRPCGRALTCSNHSCSLMCHSVTPDPKREKTEAGKECEQCEEGCSKPRPPGCPHPCSLPCHRGDCPP----CTQMIRQRCHCKITNLYIECLVKVKCPCKRIKKEFSCSRAREEASLV----------VCDDTCRELQKKFAESSRTVNPVFLCPLQAELEAFEKRQKGKRKKNRRNTEVEVEEGL--WLKYKKYLL 834          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Sea Lamprey
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:HGNC Symbol;Acc:HGNC:7803])

HSP 1 Score: 403.675 bits (1036), Expect = 9.354e-127
Identity = 262/740 (35.41%), Postives = 369/740 (49.86%), Query Frame = 1
Query:  715 LILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATK-----------CIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLESKR--ESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNL----QTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIE------FKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            LI QL  + YECM+C   +R  S+ WSC+NCYH+FH+ C++KWA +    V+ DG     RCPACQ       NVT     N     YRCFCGK LNP   R    +PHSC ++C K  +   CLH C+++CHPGPCP C A +T+ C C R+  + +C    R + C + C+  LNCG H C   CH G C  C +++ Q C C   + R+V CG  E  E  FSC   C R L CGNH C+ +CH G C  C   P     C C +  ++++   GS  R SC D +P+C NVC + L     D  H C  +CHEGPCAPC     +VCRCG      + C  + ES + +       N +     H    RC + +    + QC R   CK H  E  C H+ +  SC   SF+EL C CGAE L PP++CG   P C   CSR+H C H V H CHS+  CPPCT LV + C G H+   N+PC+    +CGL C + L    H C++ CH+G C                 C QPC+  R+ C HPC   CH G  C    ++C A+V + C C  R   + C      Y+    I+ +   ++++     E   L+         L C  EC    RN +LA+A +I  +++         YSD LK  A+++  F+  VE  + +L++++           F  ++ +    I+  A  + + S S  N+ ++
Sbjct:   12 LIEQLMASTYECMVCCERVRGHSAVWSCQNCYHLFHLPCVNKWARSPTAKVE-DGSD-GWRCPACQ-------NVTDKVPSN-----YRCFCGKVLNPEWNRTD--IPHSCGEMCAKHRQGSDCLHPCNILCHPGPCPSCPAFLTKKCECSRSSQSVRCGQSTR-VRCSEVCDNLLNCGKHTCALICHPGNCESCPIKVVQVCHCG-ATKREVPCGG-ELKE--FSCEKPCNRPLACGNHCCQELCHPGVCRLCPLLPGEAGSCPCGQTSLEKLLDLGSPERKSCTDPLPTCTNVCGKPLPCGSDDLVHTCPAICHEGPCAPCTGVSTIVCRCG-CKTKEVPCVEVQESGKGTFVSWSQINMQRILVYHSPKRRCITEQKESSFIQCPRNGMCKKHI-EEPC-HLSNWQSCWQTSFEELMCYCGAEVLFPPVSCGTKPPECKQPCSRQHDCDHPVYHTCHSDEKCPPCTHLVERWCLGKHELRRNIPCYLREISCGLPCQKTLPCGHHKCVKACHRGECVPRVLAEPDVEPSAVLGCGQPCTIPRSGCAHPCGSVCHPGLPCP--RTSCKAEVTLQCSCGHRKEKLPCSQSSSSYQRIATIALVSKLSDMQMGECTELAKLVTEKEAQQSRLECTEECAVLERNRRLAEALNIDPSTNPFNKAAAMKYSDFLKEEARKDLKFVRGVEDEIRNLVEATNKGKHARRSHCFPPMNRDHRRVIHELAESYALESLSYDNEPKR 725          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Sea Lamprey
Match: nfxl1 (nuclear transcription factor, X-box binding-like 1 [Source:ZFIN;Acc:ZDB-GENE-110411-178])

HSP 1 Score: 182.185 bits (461), Expect = 1.482e-47
Identity = 204/702 (29.06%), Postives = 296/702 (42.17%), Query Frame = 1
Query:  613 SRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDV-----------NRNVTP----------DNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGE-CGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCG-HNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSR----PVCSNNCSREHSCSHAVR--HNCHSESTCPPC--------------------------------------------------TELVSKSCPGAHKTLDNVPCF--RPVATCGLVCGRPLTGCEHSCIRICH--------QGPCALDATKCIQPCSQKRTD-CDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNA 2448
            ++ N   +   R +      +  + LE    R+ L   L      C++C++ ++   + WSC  CY +FH+ C+ +WA        +D  ++ +  P   + +             NR+ +P          + +  +    Y C+CG++ +P  +    LVPHSC +VC +  R   C H C L+CHPGPCPPC  +V   CHC    I ++     R   CG  C + L C  H+C   CHAG+ C +C     Q C C    + +  C S E     + C   C +  DCG H CE VCH G    C  + +R C C          G + +     C + V  CG+ C R L+ CG H C+Q CH GPC  C    + VCRCG+ +  AM C        +   C+  C ++ +C RH C  +CC      C   C R+LSCK+H+C   C H GSC  C  VS  E+ C CG+ K+  P  CG+ +    P C   CS +  C HA R  H CH    CPPC                                                  + +  + C G H+    +PC   RP ++CG  CGR L    H+C  +CH         GP   +   C + C++ R + C H C   CH   C      C   +   C C L SI + C +L +A
Sbjct:   42 AQSNTILDSALRQYTGQAGTEGAVVLE--RTRQLLEECLQSGALSCLVCISSVKRTHAVWSCMGCYSVFHLPCVQQWA--------RDSARLAVPSPLSPQLFPASINFTTNIPSSNRSASPRCACSPKCRHEYTRKEAPSVYYCWCGREPDP--RPDPWLVPHSCGEVCNRELR-PSCGHRCLLLCHPGPCPPCPQVVRVPCHCGGGGIQSR-RCGGRAWSCGTPCGRALPCRQHKCSVTCHAGDHCPLCPHVSSQLCCCGTSLTMRP-CSSPE-----WQCIKVCGKAFDCGVHTCELVCHAGAGGSCPRSGERSCPC----------GTNPAGCSLPCTEEVLLCGDTCGR-LLSCGVHTCAQRCHRGPCDTCRQVVEKVCRCGRHS-KAMPC-------LKEYLCDTRCTQQRTCQRHACRRKCCDGNCPQCDQVCARSLSCKNHKCSSIC-HPGSCYPC-GVSV-EVSCACGSTKVTVP--CGREKHTRPPRCKQLCSAQSDCHHAAREPHRCHG-GLCPPCRQTCRLPLKPCGHVCPAPCHDNDTLAEPAATGTRLQRYVYIHSPHTLAYSSHMYIQKCLGGHEE-SALPCHAARP-SSCGRACGRLLACGNHTCSLVCHAVTGSGLQAGP---ECAVCEEGCARSRPEGCTHRCKRRCHLGPC----PACTHTIRTPCHCTLVSIHLSCSELLSA 689          

HSP 2 Score: 50.8322 bits (120), Expect = 1.786e-6
Identity = 49/156 (31.41%), Postives = 59/156 (37.82%), Query Frame = 1
Query: 1204 RTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCG-NHKCESVCHQGDCEPCQWTPDRICRCWCEKMLID--EIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPC 1662
            R   CG  C + L CG H C   CHA                       V    L+A  E   C   C R    G  H+C+  CH G C  C  T    C C    + +   E+   G   R    D + SC N C RKL +CGH C  +CH G C
Sbjct:  596 RPSSCGRACGRLLACGNHTCSLVCHA-----------------------VTGSGLQAGPECAVCEEGCARSRPEGCTHRCKRRCHLGPCPACTHTIRTPCHCTLVSIHLSCSELLSAGETER----DKLLSCKNQCPRKL-ECGHRCRALCHPGTC 723          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Yeast
Match: FAP1 (Protein that binds to Fpr1p; confers rapamycin resistance by competing with rapamycin for Fpr1p binding; accumulates in the nucleus upon treatment of cells with rapamycin; has similarity to D. melanogaster shuttle craft and human NFX1 [Source:SGD;Acc:S000004968])

HSP 1 Score: 242.662 bits (618), Expect = 2.626e-67
Identity = 230/794 (28.97%), Postives = 340/794 (42.82%), Query Frame = 1
Query:  691 EGMNQRESLILQLNH-NKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKC---NADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEI--------EQKCFCDRKSSRKVICGSLEASEE--------------IFSCGNRCERMLD--CGNHK----CESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCA-PCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSEL------------------------HLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSR----EHSCSH-AVRHNCHS-ESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICH-QGPCALDATKCIQPCSQKRTDCDHPCAVPCHG-SNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAY--AKQNFDFLLL-------------------VEKTLLDLM-KSSKNIIEFKNLDENKADFINRYAACFKINSKS 2811
            + M   E  I +++  + Y CMIC   +      ++C+ CY +F  GCI +WA     S +K   ++  +CP C   Y V++ V   N          C+CGK +NP       L P+SC   C  S     C+H CS +CH GP P C  +V   CHC +   +  C      ++   C + C   L+C +H C+  CH G CG C   I        + KC+C   +   + C   +  +               +F+C +   R++D  C  H     C S       + C + P  +  C C +  ++E+    +  R  C D +P+C + C + L    H+C   CH+  C  PC     V C C +S F      S+    Q   +CN  C   +SC RHRC +RCCS                           H+C   C  TLSC  H+C+R+C H G CP C     ++L C CG   +  P+ CG   P C++ C +    E +C H  + H CHS + +CPPCTE V K C    KT     CF+   +CG+ CG PL+ C H+C + CH  G C      C Q C QKR +C+H C  PCHG + C D+   C   V + C C                  IK S    +K +     +S  +SSV L C+ EC+   R  +L +AF I   ++N  +   D+LK        F+ L L                   +E  L  LM   +++ + FK +   +  FI   A  + + S+S
Sbjct:   48 DDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWAL---KSTEKTVDRI-WKCPNC---YYVSKRVPVKNRPT-------CWCGKVVNP---DPNPLDPNSCGQTCNAS----TCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADN--RVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEEL----TKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTF------SVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKC-HPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC---QKVCKQTCGQKRLNCNHECPKPCHGKTECPDL--PCATLVKIYCKC----------------GRIKKSVTCGAKSDR----VSVTESSV-LDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSES 781          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Nematostella
Match: EDO45870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR1])

HSP 1 Score: 285.804 bits (730), Expect = 2.564e-81
Identity = 207/592 (34.97%), Postives = 295/592 (49.83%), Query Frame = 1
Query: 1216 CGDRCEKY--LNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVV--CRCGKSAFT-------------------AMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKL--QNAISFIKFSN-NLESKRESLDLIISPNDSSVFL---------ICDSECKKNARNIKLADAFDISLTSSNLQT--YYSDSLKAYAKQNFDFLLLVEKTLLDLMKS------SKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINR 2859
            CG+ C+K   +N   H+C   CH G C  C V + + C C  K+S++V CG       +  C + CE++L+CGNH C+  CH G C+PC     +   C+C K     + G G +          SC + CER L    H+C +VCH+G C  C L  + V  C CGK+A T                    +  R I E   +   C++ CNKK  CGRHRCN++CC    H C   CG+ L C +H C   C H G CP C    +DE+ C CGA  L PPI CG   P C   CSR+HSCSH V H+CHSE  CPPCT L  K C G H+   ++PC     +CG  C RPL  C H+C R CH+ PC  +   C QPC+  R +CDHPC  PCH G  C  V   C  ++ V+C C  RS  + C +   ++A ++ +F+  +L  K +++ L  + + S + L          C+ +C    RN +LA A D++  SS       +S  L A AK NF F+  +E+    L++S      ++    F  ++ ++   I+  A+ + + S+S  +Q  K N      R
Sbjct:  396 CGELCQKSRDINNCPHKCNLLCHPGPCPTCPVMVAKSCECG-KTSQQVRCGQTG----VILCTDVCEKLLNCGNHNCQRTCHSGPCDPCDVEVQQ--DCYCSKTTRKVLCGTGEYDIVDDHVGYFSCEDRCERVLDCSNHHCEKVCHKGSCKSCELKPEAVSHCPCGKTALTEILGENNMRQQCLDPIPTCGLKVRCI-EVTSEDFLCDQRCNKKRQCGRHRCNQKCCVDTEHRCELVCGKKLRCGTHTCLELC-HRGYCPPCYMTGYDEVTCHCGATILYPPIPCGTPPPNCPYPCSRQHSCSHPVNHSCHSEEVCPPCTALTQKMCAGGHELRHSIPCHVTDVSCGRRCDRPLL-CGHTCSRTCHKPPCLGEQEPCTQPCANPREECDHPCGAPCHPGQPCPSVP--CKVKITVSCKCGRRSDVVQCLRGGDKSAPAYQRFTTESLADKMKNIQLGQTVDISGILLNDQFSIRHIECNEDCAIQERNRRLAQALDVNPESSAFSANVTFSPFLLAEAKFNFPFIKSIEEVFYGLIESTTKGSLTQKSHAFNPMNSHQRRIIHELASHYNLCSRSY-DQEPKRNTVVTATR 974          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Nematostella
Match: EDO41791 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3K7])

HSP 1 Score: 157.147 bits (396), Expect = 1.512e-40
Identity = 177/553 (32.01%), Postives = 233/553 (42.13%), Query Frame = 1
Query:  973 QYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHC-ERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAG--ECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHC-------ECGAEKLLPPIACGQ-----------SR----------PVCSNNCSRE-HSCSHAVRHNCHSEST-----------------------CPPCTELVSKSCPGAHKTLDNVPCFRPVA-TCGLVCGRPLTGCEHSCIRICH----------QGPCALDATKCIQPCSQKR-TDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMIC 2430
            +Y CFCGK+ NP       +VPHSC   C +  + + C H C L+CHPGPCPPC   V   CHC  +     +C A +    C   C K L+CG H C+  CHAG  +C  C  E  Q C C ++ S++  C S +     + C   C R L CG H CE VCH G C  C  + +R C C   K+ +             C + +P+CG+ CE++L    H C+Q CH+GPC PC       CRCGK        R  +        C   C     C RH+C  +CC  +   C   CGRTL+CK+H+C  +C H G C  CP     +  C       +CG EK+  P  C +           SR          P C   C R    C+H     CH                           CPPC E V  SC G H+     PC      +CG  CGR L    H+C   CH           GP   +   C +PC++ R + C H C  PCH   C      C   +   C C L ++ + C
Sbjct:   15 RYHCFCGKEENPAFDPW--IVPHSCGQTCSRPLKPD-CGHECLLLCHPGPCPPCPKTVRTRCHCGTQAPSVRRCGAKD--WSCSRPCGKLLSCGHHSCQTPCHAGKSDCPPCPKESVQSCLCGKQESKRP-CASPD-----WQCQKICGRTLSCGFHICEKVCHSGLCGDCPRSGERSCPCGKTKISL------------PCTEDIPTCGDTCEQELSCGRHKCTQRCHQGPCGPCRQFVTKQCRCGK--------REKNVQCSMEFTCEAKCTNMRQCSRHQCKRKCCDGKCPPCEQTCGRTLNCKNHKCPSQC-HRGPCYPCPLTVDMKCFCGSTVVTLQCGREKISKPPKCNELCKHPSNCHHPSREPHRCHYGDCPTCRQICKRHLPDCNHTCPQRCHDNVPAQTKSPIAAAKDTQQNPEVVALPCPPCREPVKWSCYGEHED-RLFPCSEACRYSCGRPCGRALPCGNHTCQLECHYVTKETSKTEAGP---ECQACEEPCNKPRPSGCTHSCPRPCHQGECH----QCKLMLKRQCHCCLMAVYIRC 527          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Medaka
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:101167670])

HSP 1 Score: 464.151 bits (1193), Expect = 9.001e-147
Identity = 300/879 (34.13%), Postives = 421/879 (47.90%), Query Frame = 1
Query:  280 SHYNNKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSN-KGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLE---ASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLESKRESLD---LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            S   N  Q+  E +   D +  AD+         G+      + K    + +HE +  +   +                 GR+RG     +   S     +          P++G    N+  R+H    +  +++      Q   LI QL    YECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D        RCPACQ            N   K    Y CFCGK  NP  +R    +PHSC D+CGK  R   C H C+++CHPGPCP C A VT++C C +T    +C      L C   C   LNC +H C   CHAG C  C  +I+Q C C   ++R+V CG+ +        +SC N C + L C  H+C+ VCH G C+PC  +P  +  C C +  + ++   G   R  C D +PSCG  C + L     D  H C  +CHEG C PC L+  V CRCG      + C  I + ++    C++ CNKK  CGRH+C E CC +  H C   CG  L+C  H+C+  C H G+C  C   SFDEL C CG   L PPI CG   P C N C+R H C+H V HNCHSE  CPPCT L  K C G H+   N+PC     +CGL+C +PL    H C R+CH+G C  D   C QPC+  R DC HPC+ PCH GS+C    + C A+V + C C  R   + C      Y+   AI+     ++++   +S+D   L+         L CD EC    RN +LA+A  I  TS    T     YS SLK  A+++  F+  VE+ +  L+      K  K    F  ++      I+  A  + + S S  ++ ++
Sbjct:   85 SGSRNVEQRRAEQRERGDHFKAADQ----RHGTKGETTERTQESKSGPKRHYHETQKKEVEVKRRQGPIKPPKPPSQEIDGRERGANARLDSDQSRPAQDSRGPPP-----PAKGGKRFNQ--RSHKPGRQSWEQVPKSKETQTGCLIEQLTEENYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDS--TEGWRCPACQ------------NVALKSPASYTCFCGKVTNPEWRR--SEIPHSCGDMCGK-RRGGDCNHPCNILCHPGPCPQCPAFVTKSCICGKTSQPMRC-GQAAVLRCDRVCAALLNCAVHTCMQLCHAGPCEPCQRQIKQVCHCG-VATREVPCGTDKDGSVGSGHYSCRNTCGKKLSCDAHECQEVCHPGACQPCPRSPKLVKTCPCGQTALTKLLELGYAERKICSDPIPSCGKTCYKPLACGSSDTIHLCQNLCHEGSCGPCSLTSTVRCRCGFKT-KDVPCSLIQKEEELIFTCDRRCNKKRLCGRHKCGELCCVNVEHKCLLICGYKLNCGLHRCQEPC-HRGNCEPCWQSSFDELSCHCGLTVLYPPIPCGTKPPECKNPCTRRHECNHPVFHNCHSEDKCPPCTYLTQKWCMGKHEQRSNIPCHLQDISCGLMCNKPLPCEMHRCKRLCHRGECLPDGGCCQQPCALPRPDCGHPCSAPCHEGSSC--PRTTCTAKVALQCDCGRRKDTVACADAATSYQRYAAIAMASKLSDMQLG-DSMDMGPLLTKKEAKQTRLDCDEECATLERNRRLAEALQIDATSDPFNTRSTSVYSSSLKEDARKDLKFVTEVEEEMRSLVELANKGKQPKRSHCFPAMNREHRKIIHELAEVYGVESASYDSEPKR 928          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Medaka
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:101167670])

HSP 1 Score: 464.922 bits (1195), Expect = 1.544e-146
Identity = 306/908 (33.70%), Postives = 434/908 (47.80%), Query Frame = 1
Query:  202 PLNRRKQNNKYFHNNRSEMPRENKFYSHYN---NKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSN-KGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLE---ASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLESKRESLD---LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            P++    +N+   N   E   E ++ SH+    N  Q+  E +   D +  AD+         G+      + K    + +HE +  +   +                 GR+RG     +   S     +          P++G    N+  R+H    +  +++      Q   LI QL    YECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D        RCPACQ            N   K    Y CFCGK  NP  +R    +PHSC D+CGK  R   C H C+++CHPGPCP C A VT++C C +T    +C      L C   C   LNC +H C   CHAG C  C  +I+Q C C   ++R+V CG+ +        +SC N C + L C  H+C+ VCH G C+PC  +P  +  C C +  + ++   G   R  C D +PSCG  C + L     D  H C  +CHEG C PC L+  V CRCG      + C  I + ++    C++ CNKK  CGRH+C E CC +  H C   CG  L+C  H+C+  C H G+C  C   SFDEL C CG   L PPI CG   P C N C+R H C+H V HNCHSE  CPPCT L  K C G H+   N+PC     +CGL+C +PL    H C R+CH+G C  D   C QPC+  R DC HPC+ PCH GS+C    + C A+V + C C  R   + C      Y+   AI+     ++++   +S+D   L+         L CD EC    RN +LA+A  I  TS    T     YS SLK  A+++  F+  VE+ +  L+      K  K    F  ++      I+  A  + + S S  ++ ++
Sbjct:   99 PMDGSDGSNRRGVNRNLEKGYE-QWDSHFKKNRNVEQRRAEQRERGDHFKAADQ----RHGTKGETTERTQESKSGPKRHYHETQKKEVEVKRRQGPIKPPKPPSQEIDGRERGANARLDSDQSRPAQDSRGPPP-----PAKGGKRFNQ--RSHKPGRQSWEQVPKSKETQTGCLIEQLTEENYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDS--TEGWRCPACQ------------NVALKSPASYTCFCGKVTNPEWRR--SEIPHSCGDMCGK-RRGGDCNHPCNILCHPGPCPQCPAFVTKSCICGKTSQPMRC-GQAAVLRCDRVCAALLNCAVHTCMQLCHAGPCEPCQRQIKQVCHCG-VATREVPCGTDKDGSVGSGHYSCRNTCGKKLSCDAHECQEVCHPGACQPCPRSPKLVKTCPCGQTALTKLLELGYAERKICSDPIPSCGKTCYKPLACGSSDTIHLCQNLCHEGSCGPCSLTSTVRCRCGFKT-KDVPCSLIQKEEELIFTCDRRCNKKRLCGRHKCGELCCVNVEHKCLLICGYKLNCGLHRCQEPC-HRGNCEPCWQSSFDELSCHCGLTVLYPPIPCGTKPPECKNPCTRRHECNHPVFHNCHSEDKCPPCTYLTQKWCMGKHEQRSNIPCHLQDISCGLMCNKPLPCEMHRCKRLCHRGECLPDGGCCQQPCALPRPDCGHPCSAPCHEGSSC--PRTTCTAKVALQCDCGRRKDTVACADAATSYQRYAAIAMASKLSDMQLG-DSMDMGPLLTKKEAKQTRLDCDEECATLERNRRLAEALQIDATSDPFNTRSTSVYSSSLKEDARKDLKFVTEVEEEMRSLVELANKGKQPKRSHCFPAMNREHRKIIHELAEVYGVESASYDSEPKR 970          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Medaka
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:101167670])

HSP 1 Score: 464.922 bits (1195), Expect = 2.921e-146
Identity = 306/908 (33.70%), Postives = 434/908 (47.80%), Query Frame = 1
Query:  202 PLNRRKQNNKYFHNNRSEMPRENKFYSHYN---NKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSN-KGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLE---ASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLESKRESLD---LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            P++    +N+   N   E   E ++ SH+    N  Q+  E +   D +  AD+         G+      + K    + +HE +  +   +                 GR+RG     +   S     +          P++G    N+  R+H    +  +++      Q   LI QL    YECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D        RCPACQ            N   K    Y CFCGK  NP  +R    +PHSC D+CGK  R   C H C+++CHPGPCP C A VT++C C +T    +C      L C   C   LNC +H C   CHAG C  C  +I+Q C C   ++R+V CG+ +        +SC N C + L C  H+C+ VCH G C+PC  +P  +  C C +  + ++   G   R  C D +PSCG  C + L     D  H C  +CHEG C PC L+  V CRCG      + C  I + ++    C++ CNKK  CGRH+C E CC +  H C   CG  L+C  H+C+  C H G+C  C   SFDEL C CG   L PPI CG   P C N C+R H C+H V HNCHSE  CPPCT L  K C G H+   N+PC     +CGL+C +PL    H C R+CH+G C  D   C QPC+  R DC HPC+ PCH GS+C    + C A+V + C C  R   + C      Y+   AI+     ++++   +S+D   L+         L CD EC    RN +LA+A  I  TS    T     YS SLK  A+++  F+  VE+ +  L+      K  K    F  ++      I+  A  + + S S  ++ ++
Sbjct:  129 PMDGSDGSNRRGVNRNLEKGYE-QWDSHFKKNRNVEQRRAEQRERGDHFKAADQ----RHGTKGETTERTQESKSGPKRHYHETQKKEVEVKRRQGPIKPPKPPSQEIDGRERGANARLDSDQSRPAQDSRGPPP-----PAKGGKRFNQ--RSHKPGRQSWEQVPKSKETQTGCLIEQLTEENYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDS--TEGWRCPACQ------------NVALKSPASYTCFCGKVTNPEWRR--SEIPHSCGDMCGKR-RGGDCNHPCNILCHPGPCPQCPAFVTKSCICGKTSQPMRC-GQAAVLRCDRVCAALLNCAVHTCMQLCHAGPCEPCQRQIKQVCHCG-VATREVPCGTDKDGSVGSGHYSCRNTCGKKLSCDAHECQEVCHPGACQPCPRSPKLVKTCPCGQTALTKLLELGYAERKICSDPIPSCGKTCYKPLACGSSDTIHLCQNLCHEGSCGPCSLTSTVRCRCGFKT-KDVPCSLIQKEEELIFTCDRRCNKKRLCGRHKCGELCCVNVEHKCLLICGYKLNCGLHRCQEPC-HRGNCEPCWQSSFDELSCHCGLTVLYPPIPCGTKPPECKNPCTRRHECNHPVFHNCHSEDKCPPCTYLTQKWCMGKHEQRSNIPCHLQDISCGLMCNKPLPCEMHRCKRLCHRGECLPDGGCCQQPCALPRPDCGHPCSAPCHEGSSC--PRTTCTAKVALQCDCGRRKDTVACADAATSYQRYAAIAMASKLSDMQLG-DSMDMGPLLTKKEAKQTRLDCDEECATLERNRRLAEALQIDATSDPFNTRSTSVYSSSLKEDARKDLKFVTEVEEEMRSLVELANKGKQPKRSHCFPAMNREHRKIIHELAEVYGVESASYDSEPKR 1000          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Medaka
Match: si:dkey-10f23.2 (nuclear transcription factor, X-box binding 1 [Source:NCBI gene;Acc:101167670])

HSP 1 Score: 464.922 bits (1195), Expect = 2.921e-146
Identity = 306/908 (33.70%), Postives = 434/908 (47.80%), Query Frame = 1
Query:  202 PLNRRKQNNKYFHNNRSEMPRENKFYSHYN---NKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSN-KGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLE---ASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLV----DCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCH-GSNCQDVMSNCMAQVIVTCLCKLRSIPMIC------YKLQNAISFIKFSNNLESKRESLD---LIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQT----YYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQK 2832
            P++    +N+   N   E   E ++ SH+    N  Q+  E +   D +  AD+         G+      + K    + +HE +  +   +                 GR+RG     +   S     +          P++G    N+  R+H    +  +++      Q   LI QL    YECM+C ++IR  +  WSC++C+H+FH+ CI KWA +  +  D        RCPACQ            N   K    Y CFCGK  NP  +R    +PHSC D+CGK  R   C H C+++CHPGPCP C A VT++C C +T    +C      L C   C   LNC +H C   CHAG C  C  +I+Q C C   ++R+V CG+ +        +SC N C + L C  H+C+ VCH G C+PC  +P  +  C C +  + ++   G   R  C D +PSCG  C + L     D  H C  +CHEG C PC L+  V CRCG      + C  I + ++    C++ CNKK  CGRH+C E CC +  H C   CG  L+C  H+C+  C H G+C  C   SFDEL C CG   L PPI CG   P C N C+R H C+H V HNCHSE  CPPCT L  K C G H+   N+PC     +CGL+C +PL    H C R+CH+G C  D   C QPC+  R DC HPC+ PCH GS+C    + C A+V + C C  R   + C      Y+   AI+     ++++   +S+D   L+         L CD EC    RN +LA+A  I  TS    T     YS SLK  A+++  F+  VE+ +  L+      K  K    F  ++      I+  A  + + S S  ++ ++
Sbjct:  129 PMDGSDGSNRRGVNRNLEKGYE-QWDSHFKKNRNVEQRRAEQRERGDHFKAADQ----RHGTKGETTERTQESKSGPKRHYHETQKKEVEVKRRQGPIKPPKPPSQEIDGRERGANARLDSDQSRPAQDSRGPPP-----PAKGGKRFNQ--RSHKPGRQSWEQVPKSKETQTGCLIEQLTEENYECMVCCDVIRVMAPVWSCQSCFHVFHLNCIKKWARSPASQADDS--TEGWRCPACQ------------NVALKSPASYTCFCGKVTNPEWRR--SEIPHSCGDMCGKR-RGGDCNHPCNILCHPGPCPQCPAFVTKSCICGKTSQPMRC-GQAAVLRCDRVCAALLNCAVHTCMQLCHAGPCEPCQRQIKQVCHCG-VATREVPCGTDKDGSVGSGHYSCRNTCGKKLSCDAHECQEVCHPGACQPCPRSPKLVKTCPCGQTALTKLLELGYAERKICSDPIPSCGKTCYKPLACGSSDTIHLCQNLCHEGSCGPCSLTSTVRCRCGFKT-KDVPCSLIQKEEELIFTCDRRCNKKRLCGRHKCGELCCVNVEHKCLLICGYKLNCGLHRCQEPC-HRGNCEPCWQSSFDELSCHCGLTVLYPPIPCGTKPPECKNPCTRRHECNHPVFHNCHSEDKCPPCTYLTQKWCMGKHEQRSNIPCHLQDISCGLMCNKPLPCEMHRCKRLCHRGECLPDGGCCQQPCALPRPDCGHPCSAPCHEGSSC--PRTTCTAKVALQCDCGRRKDTVACADAATSYQRYAAIAMASKLSDMQLG-DSMDMGPLLTKKEAKQTRLDCDEECATLERNRRLAEALQIDATSDPFNTRSTSVYSSSLKEDARKDLKFVTEVEEEMRSLVELANKGKQPKRSHCFPAMNREHRKIIHELAEVYGVESASYDSEPKR 1000          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Medaka
Match: znfx1 (zinc finger NFX1-type containing 1 [Source:NCBI gene;Acc:101166468])

HSP 1 Score: 55.8398 bits (133), Expect = 2.520e-7
Identity = 95/335 (28.36%), Postives = 130/335 (38.81%), Query Frame = 1
Query: 1393 CGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRD-VVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHC--------ECGAEKLLPPIACGQSR--PVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEH-SCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDV 2361
            C   C+  LDCG H C  VCH  D E  ++                                   C   CE+ L D GH C+ VCH+     CP+  + +V +C  S    + C        Q+ +C + C K LSCG H C   C +     C  +C   ++        ECGH            D+L C        +CG E      +C Q R   +CS+ C R   CSH     C  +  CPPC       C  ++      PC +P A C   C   +  C H SC ++CH+ PC  D   C QPC+ K  +C H C   C G  C ++
Sbjct: 1273 CNQPCQYRLDCG-HVCSRVCHPSDLEHKKF----------------------------------KCSKKCEKILCDLGHRCTLVCHQECPKKCPMKVEKIVPKCQHSQM--IPCH----QSPQTFECREPCQKLLSCG-HPCGSTCGAP----CTTKCMVVVTLAL-----ECGHSQQGACFYKKERDQLKCTIPCRHQLKCGHECSGTCSSCLQGRVHVLCSHQCERLLICSHKCTEPCTGD--CPPCQRPCENCCIHSNCM---KPCGQPCAPCIEPC---VWQCPHQSCSKLCHE-PC--DRPPCTQPCT-KILNCGHQCIGLC-GDKCPNM 1543          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Planmine SMEST
Match: SMESG000064203.1 (SMESG000064203.1)

HSP 1 Score: 1894.4 bits (4906), Expect = 0.000e+0
Identity = 962/981 (98.06%), Postives = 965/981 (98.37%), Query Frame = 1
Query:  121 MKKNAESSNLXXXXXXXXXXXXXXXXFPLNRRKQNNKYFHNNRSEMPRE--------------NKFYSHYNNKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVCXXXXXXXXXXXXEFPVLFPLKSDVEKIPALPSSTNLPMSFADRIRLSKKE 3021
            MKKNAESSNLTNINDETTDSNTTSNNFPLNRRKQNNKYFHNNRSEMPRE              +KFYSHYNNKNQKTVENKFNNDPYHNADRF+YMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFND SHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRC+RMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSN CSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVCTPRPLLTDLLRREFPVLFPLKSDVEKIPALPSSTNLPMSFADRIRLSKKE
Sbjct:    1 MKKNAESSNLTNINDETTDSNTTSNNFPLNRRKQNNKYFHNNRSEMPRESKIIFIFIYFEYSLDKFYSHYNNKNQKTVENKFNNDPYHNADRFNYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDGSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCKRMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNTCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRNQNQKINMSAEINRSNVCTPRPLLTDLLRREFPVLFPLKSDVEKIPALPSSTNLPMSFADRIRLSKKE 981          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Planmine SMEST
Match: SMESG000064236.1 (SMESG000064236.1)

HSP 1 Score: 1519.98 bits (3934), Expect = 0.000e+0
Identity = 767/925 (82.92%), Postives = 816/925 (88.22%), Query Frame = 1
Query:  121 MKKNAESSNLXXXXXXXXXXXXXXXXFPLNRRKQNNKYFHNNRSEMPRE--------------NKFYSHYNNKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRN-QNQKINMSAE 2850
            MKKNAESSNLTNINDETTDSNTTSNNFPLNRRKQNNKYFHNNRSEMPRE              +KFYSHYNNKNQKTVENKFNNDPYHNADRF+YMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFND SHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRC+RMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGH+CSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSN CSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPC +   +C HPC++PCH   C    SNC+  V V C C LR+  + C       S ++   +     ES DL  S   +++ L C  +C +         A  +  + + +  YY+     + K NF+F++ +E+   ++ + + ++ +F ++  +KA FI+R++A +K+ +K V N +N   N++ E
Sbjct:    1 MKKNAESSNLTNINDETTDSNTTSNNFPLNRRKQNNKYFHNNRSEMPRESKIIFIFIYFEYSLDKFYSHYNNKNQKTVENKFNNDPYHNADRFNYMESANNGKKFSNNYQDKVHGYKDFHEQRGNKGNYRTNFNDGSHSSGFFSNKGRQRGNYNNFEKFDSNVISKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCKRMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHSCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNTCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCGKPLPECGHPCSLPCHADICLSTDSNCVLTVPVNCKCGLRTSELDC-------SLVRSFKSKPELIESNDLYTSVETNALTLNCTVKCNQAGIIANKIRAATLPSSFALIMRYYAAYFDEFCKANFNFVISIERIFANVCQEN-SVHKFLSITVDKAKFISRFSAAYKLLTKIVYNFENNSANVTVE 917          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Planmine SMEST
Match: SMESG000036201.1 (SMESG000036201.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 327/757 (43.20%), Postives = 456/757 (60.24%), Query Frame = 1
Query:  616 RGNYYNNRKDRNHGNNFKHDKKIDLEG----MNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYR-NEKCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESL---DLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRN-QNQKINMSAEINR 2859
            R N YN R  +  GN     +K + +     +NQRE LI QL+H++YECMICV+ +  ++  WSC NCYH+FHI CI++WA TC N  + DG K N RCP CQ EY++N +        KE   YRCFC K+ NP+ KRG   +PHSC + CGKS + +EKC HLC L CHPGPC  CEAI++R+C C ++K++TKC+A  + L CG  C+K LNC +H+C N CHAG+C  CSV  +Q C C+R   R V CGS E     FSC   C + L CGNHKC+ +CH G C+ C  + + +  CWC K  I  + G+   +R SC++ +PSC + C R    C H C  +CHEG C+PC  ++   C+CGKS  T + C   S+ + + + C ++CNKK+ C RH C ++CC + +H+C  +C R L+C+ H CE  CGH+G C  C NVSFDEL CECG  K LPPI C Q  P C   CSREH C H VRH CHSE  CPPC EL SK CPG H   DN+PCFRPVATCG  C RP + CEHSC ++CH G C  ++  C+QPC +   +C+H C +PCH  +C+     C+  + ++C CKLR + + C  + + I     S+ +++    L   ++IIS +D    L CD+ C+K     K    F + ++ S ++ YY +    + K N   ++ +E    DL +S +   +F  L   +A FI+R++  + + SKSV N Q  + N++ E  +
Sbjct:  199 RTNEYNPRNHQEKGNMLVKQEKKERDKENTELNQREKLIEQLSHSEYECMICVSNVYKDAPIWSCNNCYHVFHIKCINQWAVTCSNKTETDGAKRNFRCPGCQTEYNINDD-------EKEMFSYRCFCDKEKNPIFKRG--TIPHSCGNTCGKSNKTSEKCPHLCFLPCHPGPCSACEAIISRSCSCGKSKLSTKCSASPQHLQCGKVCDKLLNCRIHKCTNLCHAGDCQPCSVTHQQTCGCERGVERTVYCGSEEFYSN-FSCEEICGKDLTCGNHKCDQICHSGKCKACARSIETVKYCWCGKQEIVCLLGE---NRKSCLEMIPSCCDKCNRPNKTCNHFCQDICHEGDCSPCNQTQLRSCQCGKSLQTEVKC---SDLENEQILCKRVCNKKMLCRRHCCTKKCCVNNVHICEQKCNRKLNCQIHLCEESCGHIGLCRPCSNVSFDELFCECGKSKTLPPIPCNQPPPQCQEVCSREHECEHPVRHKCHSEIDCPPCVELTSKYCPGNHFLYDNIPCFRPVATCGRRCSRPFSKCEHSCNKMCHVGECQTESDVCVQPCGKLLKNCNHACQIPCHSGDCESFNVTCVENMTISCACKLRFVTVKCSDIAHRIK----SDTIQAHLNFLPIWNVIISKSDDQFILNCDNSCQKEISLAKDIQTFIVPISYSVMKKYYGEYFNEFKKNNLALVVSIENVFSDLCRSGQGKHQFTELTIEQAKFIDRFSFSYNLTSKSVYNFQLNRANVTVETKK 935          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Planmine SMEST
Match: SMESG000040104.1 (SMESG000040104.1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 315/773 (40.75%), Postives = 430/773 (55.63%), Query Frame = 1
Query:  556 DSNVISKNCNEKEFYE------FGPSRGNYYNNRKDRNHGNNFKHDKKIDLEG---MNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNE-KCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDG---SHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQ--QSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKS 2811
            DS ++ K+ N    +E      F       YNN        NF + K  D+     +NQR +LI+Q+++ +YEC IC   ++     W+C NC+HIFHI CI KW +TC   V  D  K   RCP CQ EY +            + + Y CFCGK  NP  K G  L  HSC  VC K+ R + +C H CS+ CHPGPCPPCEA +   C C +T +T KCN  E +L CG +CEK LNC  H C+  CH G C  C   I Q C+C RK +R VICGSLEA+E  F+C   C ++ DCGNHKCE  CH   C+ C + P  +  C C K  + ++  D    +  R SC D +P+C  +C +    C H C   CH+G C PC L    +  C +     + C  +   ++  + VQC   C  K +CG HRCNE CC   +HLC   CG+ LSC+ H C + C H G+CP+C NVSF+EL C CG E +LPPIACGQS P CS  CSREH CSH VRHNCHSE  C  CT L SK CPG H    NVPCFRPV TCG  C +PL  C+H CI+ CH G C  +  +C Q C++ R+ C HPC+  CH  +CQ V   C  ++ + C+C  +SI ++C+KL++    ++  +N E    +   ++S   S++ LICD++CKK +R  +  +  D  L ++     YS  L+ ++  + +FLL +++    L+      K  K I  F+ ++ NK  FI+  +  F +NS S
Sbjct:   22 DSIILQKDVNILNHFENIQLNNFISQNSQEYNNMSFERQ--NFLNSKNFDISNDYNVNQRGTLIMQISNFQYECTICYVTLQPGHPIWTCSNCFHIFHISCIKKWHSTC---VSSDNNKW--RCPTCQNEYCLE----------IDEITYYCFCGKIKNPEFKPGNLL--HSCGGVCSKTNRTDLRCPHFCSIQCHPGPCPPCEASLASKCFCLKTSLTVKCNTSENSLRCGKKCEKLLNCLKHNCQMLCHPGTCNDCIESIVQCCYC-RKETRSVICGSLEATESSFTCNTVCNKLKDCGNHKCEEKCHIEPCDSCIYLPSNVKYCPCGKTKLADLLPDLHSCAGGRQSCFDEIPTCNKICAKTYSTCEHACPDSCHQGNCKPCSLVSTNIKCCCRKTIQNLKCSEVIRLKELGKVVQCKNRCKTKKNCGIHRCNEFCCDKSVHLCEKVCGKPLSCQLHSCGKTC-HRGACPTCSNVSFEELFCACGLEVILPPIACGQSPPACSGVCSREHLCSHDVRHNCHSELECTQCTVLTSKYCPGMHMVFYNVPCFRPVVTCGFPCNKPLPNCQHFCIKNCHFGNCTDELFQCSQLCTKPRSQCQHPCSSLCHIGDCQTVFKLCSVKIEIKCVCNHKSISLVCHKLEDTRKLLE--SNSEPLSTNGTFVLS--GSTIVLICDNDCKKASRVKQNIETVDRDLINTE-NLVYSSFLRDFSTSDPNFLLKIDEEFTSLIRKLETSKLKKIIHRFEPMNRNKRRFIHELSKYFGLNSIS 768          
BLAST of Nuclear transcription factor, X-box binding 1 vs. Planmine SMEST
Match: SMESG000040104.1 (SMESG000040104.1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 315/773 (40.75%), Postives = 430/773 (55.63%), Query Frame = 1
Query:  556 DSNVISKNCNEKEFYE------FGPSRGNYYNNRKDRNHGNNFKHDKKIDLEG---MNQRESLILQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVDKDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKRGGDLVPHSCDDVCGKSYRNE-KCLHLCSLMCHPGPCPPCEAIVTRNCHCERTKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQKCFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCEPCQWTPDRICRCWCEKMLIDEIGGDG---SHHRNSCVDAVPSCGNVCERKLVDCGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQ--QSVQCNKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVGSCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVRHNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGCEHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSNCMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPNDSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNFDFLLLVEKTLLDLM------KSSKNIIEFKNLDENKADFINRYAACFKINSKS 2811
            DS ++ K+ N    +E      F       YNN        NF + K  D+     +NQR +LI+Q+++ +YEC IC   ++     W+C NC+HIFHI CI KW +TC   V  D  K   RCP CQ EY +            + + Y CFCGK  NP  K G  L  HSC  VC K+ R + +C H CS+ CHPGPCPPCEA +   C C +T +T KCN  E +L CG +CEK LNC  H C+  CH G C  C   I Q C+C RK +R VICGSLEA+E  F+C   C ++ DCGNHKCE  CH   C+ C + P  +  C C K  + ++  D    +  R SC D +P+C  +C +    C H C   CH+G C PC L    +  C +     + C  +   ++  + VQC   C  K +CG HRCNE CC   +HLC   CG+ LSC+ H C + C H G+CP+C NVSF+EL C CG E +LPPIACGQS P CS  CSREH CSH VRHNCHSE  C  CT L SK CPG H    NVPCFRPV TCG  C +PL  C+H CI+ CH G C  +  +C Q C++ R+ C HPC+  CH  +CQ V   C  ++ + C+C  +SI ++C+KL++    ++  +N E    +   ++S   S++ LICD++CKK +R  +  +  D  L ++     YS  L+ ++  + +FLL +++    L+      K  K I  F+ ++ NK  FI+  +  F +NS S
Sbjct:   22 DSIILQKDVNILNHFENIQLNNFISQNSQEYNNMSFERQ--NFLNSKNFDISNDYNVNQRGTLIMQISNFQYECTICYVTLQPGHPIWTCSNCFHIFHISCIKKWHSTC---VSSDNNKW--RCPTCQNEYCLEI----------DEITYYCFCGKIKNPEFKPGNLL--HSCGGVCSKTNRTDLRCPHFCSIQCHPGPCPPCEASLASKCFCLKTSLTVKCNTSENSLRCGKKCEKLLNCLKHNCQMLCHPGTCNDCIESIVQCCYC-RKETRSVICGSLEATESSFTCNTVCNKLKDCGNHKCEEKCHIEPCDSCIYLPSNVKYCPCGKTKLADLLPDLHSCAGGRQSCFDEIPTCNKICAKTYSTCEHACPDSCHQGNCKPCSLVSTNIKCCCRKTIQNLKCSEVIRLKELGKVVQCKNRCKTKKNCGIHRCNEFCCDKSVHLCEKVCGKPLSCQLHSCGKTC-HRGACPTCSNVSFEELFCACGLEVILPPIACGQSPPACSGVCSREHLCSHDVRHNCHSELECTQCTVLTSKYCPGMHMVFYNVPCFRPVVTCGFPCNKPLPNCQHFCIKNCHFGNCTDELFQCSQLCTKPRSQCQHPCSSLCHIGDCQTVFKLCSVKIEIKCVCNHKSISLVCHKLEDTRKLLE--SNSEPLSTNGTFVLS--GSTIVLICDNDCKKASRVKQNIETVDRDLINTE-NLVYSSFLRDFSTSDPNFLLKIDEEFTSLIRKLETSKLKKIIHRFEPMNRNKRRFIHELSKYFGLNSIS 768          
The following BLAST results are available for this feature:
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFX14.108e-13738.61nuclear transcription factor, X-box binding 1 [Sou... [more]
NFX13.253e-10142.68nuclear transcription factor, X-box binding 1 [Sou... [more]
NFXL12.679e-5932.34nuclear transcription factor, X-box binding like 1... [more]
NFXL12.679e-5932.34nuclear transcription factor, X-box binding like 1... [more]
NFXL12.679e-5932.34nuclear transcription factor, X-box binding like 1... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nfx-14.911e-13337.24Transcriptional repressor NF-X1 homolog [Source:U... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stc1.342e-14835.25gene:FBgn0001978 transcript:FBtr0332473[more]
stc2.408e-14835.25gene:FBgn0001978 transcript:FBtr0080706[more]
stc2.501e-14835.25gene:FBgn0001978 transcript:FBtr0332474[more]
stc2.771e-14835.25gene:FBgn0001978 transcript:FBtr0080705[more]
CG150114.439e-5532.43gene:FBgn0035518 transcript:FBtr0073244[more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NFX17.949e-14336.56si:dkey-10f23.2 [Source:ZFIN;Acc:ZDB-GENE-160728-1... [more]
nfxl13.455e-5831.88nuclear transcription factor, X-box binding-like 1... [more]
nfxl13.932e-5731.73nuclear transcription factor, X-box binding-like 1... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFX15.543e-12836.25nuclear transcription factor, X-box binding 1 [Sou... [more]
NFX12.941e-12732.96nuclear transcription factor, X-box binding 1 [Sou... [more]
NFX13.075e-12335.56nuclear transcription factor, X-box binding 1 [Sou... [more]
NFX11.004e-11734.84nuclear transcription factor, X-box binding 1 [Sou... [more]
NFX15.215e-11639.82nuclear transcription factor, X-box binding 1 [Sou... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nfx15.695e-13538.20nuclear transcription factor, X-box binding 1 [Sou... [more]
Nfx19.719e-10242.30nuclear transcription factor, X-box binding 1 [Sou... [more]
Nfx14.294e-10142.27nuclear transcription factor, X-box binding 1 [Sou... [more]
Nfxl15.038e-6032.62nuclear transcription factor, X-box binding-like 1... [more]
Nfxl12.700e-4234.91nuclear transcription factor, X-box binding-like 1... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40798|STC_DROME2.777e-14735.25Protein shuttle craft OS=Drosophila melanogaster O... [more]
sp|Q12986|NFX1_HUMAN1.973e-13638.61Transcriptional repressor NF-X1 OS=Homo sapiens OX... [more]
sp|A6QLA0|NFX1_BOVIN3.670e-13438.20Transcriptional repressor NF-X1 OS=Bos taurus OX=9... [more]
sp|B1AY10|NFX1_MOUSE3.983e-13438.20Transcriptional repressor NF-X1 OS=Mus musculus OX... [more]
sp|Q18034|NFX1_CAEEL6.247e-13237.24Transcriptional repressor NF-X1 homolog OS=Caenorh... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXR29.345e-163100.00Nuclear transcription factor X-box binding 1 (Frag... [more]
B3MM966.109e-15338.73Uncharacterized protein OS=Drosophila ananassae OX... [more]
A0A3Q2XKF44.346e-15237.60Nuclear transcription factor, X-box binding 1 OS=H... [more]
A0A154PBD95.290e-15235.69Protein shuttle craft OS=Dufourea novaeangliae OX=... [more]
E2C3V16.904e-15236.39Protein shuttle craft OS=Harpegnathos saltator OX=... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-10f23.27.122e-14637.93nuclear transcription factor, X-box binding 1 [Sou... [more]
si:dkey-10f23.27.122e-14637.93nuclear transcription factor, X-box binding 1 [Sou... [more]
si:dkey-10f23.27.122e-14637.93nuclear transcription factor, X-box binding 1 [Sou... [more]
nfxl12.326e-6029.55nuclear transcription factor, X-box binding-like 1... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-10f23.29.354e-12735.41nuclear transcription factor, X-box binding 1 [Sou... [more]
nfxl11.482e-4729.06nuclear transcription factor, X-box binding-like 1... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
FAP12.626e-6728.97Protein that binds to Fpr1p; confers rapamycin res... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO458702.564e-8134.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417911.512e-4032.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-10f23.29.001e-14734.13nuclear transcription factor, X-box binding 1 [Sou... [more]
si:dkey-10f23.21.544e-14633.70nuclear transcription factor, X-box binding 1 [Sou... [more]
si:dkey-10f23.22.921e-14633.70nuclear transcription factor, X-box binding 1 [Sou... [more]
si:dkey-10f23.22.921e-14633.70nuclear transcription factor, X-box binding 1 [Sou... [more]
znfx12.520e-728.36zinc finger NFX1-type containing 1 [Source:NCBI ge... [more]
back to top
BLAST of Nuclear transcription factor, X-box binding 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064203.10.000e+098.06SMESG000064203.1[more]
SMESG000064236.10.000e+082.92SMESG000064236.1[more]
SMESG000036201.10.000e+043.20SMESG000036201.1[more]
SMESG000040104.10.000e+040.75SMESG000040104.1[more]
SMESG000040104.10.000e+040.75SMESG000040104.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017251 ID=SMED30017251|Name=Nuclear transcription factor, X-box binding 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3092bp
AGATATTTTAATTAATTATTGCATCATTTAAAAAAAAATTTGTTCTATAA
GCATTTGGCAGTTTCGTAATTAGGTGTTTTATAATTAACTCAAATATATT
AATATTAAAATACAATTGTAATGAAAAAAAATGCCGAATCATCTAATTTA
ACAAATATAAACGATGAAACAACTGATTCCAATACAACTAGTAATAATTT
TCCACTAAATCGTAGGAAGCAGAACAATAAATACTTTCATAACAACCGTT
CTGAAATGCCAAGAGAAAATAAATTTTATTCACATTATAATAATAAAAAT
CAGAAAACAGTAGAAAATAAATTTAACAACGATCCATATCATAATGCCGA
TCGTTTCGATTATATGGAATCAGCAAACAATGGGAAGAAATTCTCTAATA
ACTATCAAGATAAAGTACACGGTTATAAAGATTTTCATGAACAAAGAGGC
AATAAAGGTAATTATAGAACCAATTTTAATGATTGTTCACATTCAAGTGG
GTTCTTTTCAAATAAAGGAAGACAAAGGGGAAACTATAATAATTTTGAAA
AATTTGATTCAAACGTAATTTCTAAAAATTGTAACGAAAAAGAATTTTAC
GAATTTGGCCCATCTCGTGGAAATTATTACAATAACAGAAAAGATAGAAA
TCATGGAAACAATTTTAAACACGATAAGAAAATTGACCTGGAAGGAATGA
ATCAACGAGAATCGTTGATTTTGCAATTGAATCACAACAAATATGAATGC
ATGATCTGTGTAAACATTATTCGCGCGGAATCCTCAACGTGGTCATGTGA
GAATTGTTATCATATATTCCACATCGGTTGTATCAGTAAATGGGCAACAA
CCTGTGGTAATTCTGTAGATAAAGACGGATTGAAAATGAATTTGAGATGT
CCTGCATGCCAGAAAGAATACGATGTGAATAGAAATGTAACGCCCGATAA
CAGTGGCAATAAGGAATGGCTGCAGTATCGATGTTTCTGTGGCAAACAAT
TGAATCCTGTTGTAAAGCGCGGGGGAGATTTGGTGCCCCATAGTTGCGAT
GATGTGTGTGGGAAATCGTATAGAAACGAGAAATGTCTCCACCTGTGTTC
CTTGATGTGCCATCCGGGTCCTTGCCCGCCCTGTGAGGCCATCGTGACGA
GGAATTGCCACTGTGAGCGGACAAAAATAACGACAAAGTGCAATGCGGAT
GAGCGAACATTGGTTTGTGGAGACCGGTGTGAGAAATATCTGAATTGTGG
GCTGCATCGATGTGAAAATGCGTGCCATGCCGGCGAATGCGGGATTTGCT
CAGTGGAGATTGAACAGAAATGTTTCTGTGATAGAAAATCGTCGAGAAAA
GTTATTTGTGGATCGCTGGAAGCGAGCGAAGAAATCTTCAGCTGCGGAAA
TCGCTGCGAACGAATGCTGGACTGTGGCAATCACAAATGTGAGTCAGTGT
GTCACCAAGGTGATTGTGAGCCGTGCCAATGGACGCCGGATCGAATCTGT
CGTTGCTGGTGTGAGAAAATGCTGATTGATGAGATCGGAGGCGACGGCAG
TCATCACCGGAATTCATGCGTTGACGCGGTGCCGAGCTGTGGGAATGTCT
GTGAGCGGAAATTGGTGGACTGCGGGCACAATTGCAGCCAGGTGTGCCAT
GAAGGCCCGTGCGCACCGTGCCCGTTGTCAAGGGATGTTGTATGCCGCTG
TGGGAAATCAGCATTTACTGCGATGGCGTGCCGCAGTATCAGTGAATCTC
AGCAGCAATCGGTGCAGTGCAATAAATTGTGCAATAAGAAGTTGTCATGC
GGTCGGCATCGATGCAACGAGCGCTGTTGCAGCAGCGAGCTGCATTTGTG
CTGGAATCAATGTGGCAGAACATTGAGTTGCAAATCCCATCAATGTGAAC
GGGAATGCGGCCATGTGGGCTCGTGTCCGTCTTGTCCGAATGTCAGTTTC
GATGAGTTGCACTGTGAGTGTGGCGCAGAGAAATTGCTGCCGCCAATCGC
ATGTGGTCAATCGCGGCCCGTTTGCAGTAACAATTGCAGTCGGGAGCATT
CCTGCTCGCATGCAGTCCGTCACAATTGCCACAGCGAGTCGACTTGTCCT
CCTTGCACGGAATTGGTGAGCAAATCATGTCCAGGCGCTCACAAGACATT
GGATAATGTCCCTTGCTTCCGCCCAGTAGCGACCTGCGGCTTGGTATGCG
GCCGGCCGCTGACTGGCTGTGAGCACTCGTGCATTAGGATCTGTCACCAG
GGCCCGTGCGCACTGGATGCCACCAAATGCATTCAGCCCTGCAGCCAGAA
GCGCACCGATTGCGACCACCCGTGTGCCGTTCCGTGCCACGGATCCAATT
GCCAGGATGTCATGAGCAATTGTATGGCCCAAGTTATTGTCACCTGCTTA
TGCAAGTTGCGATCCATTCCAATGATTTGTTACAAGCTCCAGAACGCAAT
TTCCTTCATAAAATTCAGCAACAATTTAGAATCGAAGCGTGAAAGCCTCG
ACCTCATAATATCTCCCAATGACAGCTCAGTGTTCCTCATTTGTGACAGT
GAATGCAAAAAAAACGCACGTAATATCAAATTAGCTGATGCCTTCGATAT
TAGTCTGACCTCGTCTAATTTGCAAACGTATTACTCAGATTCTTTAAAAG
CCTATGCCAAACAAAATTTCGATTTTCTGCTTCTAGTGGAGAAAACATTG
CTGGATTTGATGAAGAGCAGTAAAAATATTATTGAATTCAAAAATTTAGA
CGAAAATAAAGCTGATTTTATCAATCGATATGCCGCATGTTTTAAAATCA
ATTCTAAAAGTGTTCGTAATCAAAATCAGAAAATAAATATGAGTGCTGAA
ATTAATCGATCAAATGTCTGCACGCCAAGACCTTTGCTCACTGATTTATT
AAGGAGAGAATTTCCTGTTTTATTTCCATTAAAATCAGACGTGGAAAAAA
TACCTGCATTGCCATCTAGCACGAATTTACCGATGTCATTTGCTGATCGT
ATCAGATTGTCCAAAAAAGAATGAAGTTGATTTATTTCATGTCGTTAACA
CTCAAATTTTAGTCCAAATAAAATATTTTTCTTGAAAAAAAA
back to top

protein sequence of SMED30017251-orf-1

>SMED30017251-orf-1 ID=SMED30017251-orf-1|Name=SMED30017251-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=968bp
MKKNAESSNLTNINDETTDSNTTSNNFPLNRRKQNNKYFHNNRSEMPREN
KFYSHYNNKNQKTVENKFNNDPYHNADRFDYMESANNGKKFSNNYQDKVH
GYKDFHEQRGNKGNYRTNFNDCSHSSGFFSNKGRQRGNYNNFEKFDSNVI
SKNCNEKEFYEFGPSRGNYYNNRKDRNHGNNFKHDKKIDLEGMNQRESLI
LQLNHNKYECMICVNIIRAESSTWSCENCYHIFHIGCISKWATTCGNSVD
KDGLKMNLRCPACQKEYDVNRNVTPDNSGNKEWLQYRCFCGKQLNPVVKR
GGDLVPHSCDDVCGKSYRNEKCLHLCSLMCHPGPCPPCEAIVTRNCHCER
TKITTKCNADERTLVCGDRCEKYLNCGLHRCENACHAGECGICSVEIEQK
CFCDRKSSRKVICGSLEASEEIFSCGNRCERMLDCGNHKCESVCHQGDCE
PCQWTPDRICRCWCEKMLIDEIGGDGSHHRNSCVDAVPSCGNVCERKLVD
CGHNCSQVCHEGPCAPCPLSRDVVCRCGKSAFTAMACRSISESQQQSVQC
NKLCNKKLSCGRHRCNERCCSSELHLCWNQCGRTLSCKSHQCERECGHVG
SCPSCPNVSFDELHCECGAEKLLPPIACGQSRPVCSNNCSREHSCSHAVR
HNCHSESTCPPCTELVSKSCPGAHKTLDNVPCFRPVATCGLVCGRPLTGC
EHSCIRICHQGPCALDATKCIQPCSQKRTDCDHPCAVPCHGSNCQDVMSN
CMAQVIVTCLCKLRSIPMICYKLQNAISFIKFSNNLESKRESLDLIISPN
DSSVFLICDSECKKNARNIKLADAFDISLTSSNLQTYYSDSLKAYAKQNF
DFLLLVEKTLLDLMKSSKNIIEFKNLDENKADFINRYAACFKINSKSVRN
QNQKINMSAEINRSNVCTPRPLLTDLLRREFPVLFPLKSDVEKIPALPSS
TNLPMSFADRIRLSKKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR034078NFX1_fam
IPR000967Znf_NFX1
IPR019786Zinc_finger_PHD-type_CS
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003723RNA binding
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005829cytosol
GO:0005886plasma membrane
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0006954inflammatory response
GO:0016032viral process
GO:0045347negative regulation of MHC class II biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000967Zinc finger, NF-X1-typeSMARTSM00438znfxneu3coord: 435..454
e-value: 0.0012
score: 28.1
coord: 587..607
e-value: 24.0
score: 9.6
coord: 645..664
e-value: 5.4
score: 15.5
coord: 376..395
e-value: 0.012
score: 24.8
coord: 731..753
e-value: 0.26
score: 20.4
coord: 322..340
e-value: 0.097
score: 21.8
coord: 501..519
e-value: 0.0027
score: 26.9
coord: 700..726
e-value: 7.3
score: 14.3
coord: 560..579
e-value: 18.0
score: 10.8
IPR000967Zinc finger, NF-X1-typePFAMPF01422zf-NF-X1coord: 693..725
e-value: 0.042
score: 13.9
coord: 376..394
e-value: 1.4E-4
score: 21.9
coord: 435..453
e-value: 2.6E-6
score: 27.4
coord: 581..606
e-value: 55.0
score: 4.0
coord: 323..338
e-value: 0.077
score: 13.1
coord: 560..570
e-value: 8.0
score: 6.6
coord: 501..518
e-value: 2.6E-4
score: 21.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..35
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..48
NoneNo IPR availablePANTHERPTHR12360:SF0TRANSCRIPTIONAL REPRESSOR NF-X1coord: 10..931
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 425..462
e-value: 6.72542E-10
score: 53.5032
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 490..530
e-value: 1.77183E-8
score: 49.266
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 689..736
e-value: 9.74897E-6
score: 41.562
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 550..597
e-value: 8.92358E-6
score: 41.562
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 309..357
e-value: 3.13482E-7
score: 45.7992
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 366..415
e-value: 6.71649E-9
score: 50.4216
NoneNo IPR availableCDDcd06008NF-X1-zinc-fingercoord: 577..630
e-value: 4.93945E-5
score: 39.636
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 204..277
IPR034078Transcription factor NFX1 familyPANTHERPTHR12360NUCLEAR TRANSCRIPTION FACTOR, X-BOX BINDING 1 NFX1coord: 10..931
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 210..263
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 210..264
score: 10.66