RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30017236
Length (bp)1461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30017236) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30017236) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30017236) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30017236) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017236

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017236h1SMcG0019726 dd_Smed_v4_10917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30017236h1SMcG0019726 dd_Smed_v6_10917_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30017236h1SMcG0019726 SMED30017236smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30017236h1SMcG0019726 SMED30017236smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 52.373 bits (124), Expect = 1.383e-6
Identity = 32/111 (28.83%), Postives = 52/111 (46.85%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGCS 492
            +  +++C IC   L +  +TPC   FC  CI + +++    CP   ES  +++L   + +K E     +L L V CP + C     L+ +E HL        C F  + CS
Sbjct:   66 LESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQLFPDNFAKRE-----ILSLRVKCPSQGCTETMELRHLERHL------VRCDFAGVECS 165          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 50.447 bits (119), Expect = 3.473e-6
Identity = 31/110 (28.18%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGC 489
            +  +++C IC   L +  +TPC   FC  CI + +++    CP   E   +++L   + +K E     +L L V CP K C  +  L+ +E H      Q  C F  + C
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKRE-----ILSLTVKCPNKGCLQKMELRHLEDH------QVHCEFALVNC 162          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.122e-6
Identity = 41/166 (24.70%), Postives = 73/166 (43.98%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECH-------LRVCP--EQFL------------CPFNQIG---CSSPLPTNGNILNHLHNEMYSHANLLMEFISNM 585
            +  +++C IC   L +  +TPC   FC  CI + +++    CP   E   +++L   + +K E     +L L V CP K C  +  L+ +E H       L +CP  ++F             CP  Q+    C+ P+P        +H++    AN++ E+   +
Sbjct:   64 LESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVDNEILLENQLFPDNFAKRE-----ILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINKHIIEDCPRRQVSCVNCAVPMPYEE---KEIHDQSCPLANIICEYCGTI 221          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 7.518e-6
Identity = 32/111 (28.83%), Postives = 52/111 (46.85%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGCS 492
            +  +++C IC   L +  +TPC   FC  CI + +++    CP   ES  +++L   + +K E     +L L V CP + C     L+ +E HL        C F  + CS
Sbjct:   66 LESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQLFPDNFAKRE-----ILSLRVKCPSQGCTETMELRHLERHL------VRCDFAGVECS 165          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.678e-20
Identity = 53/162 (32.72%), Postives = 92/162 (56.79%), Query Frame = 1
Query:  118 LNYLIYEHSFS-KSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTL-QDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFL-CPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNE 594
            +N L+  ++F  +  + +  KC +C+ +L +  ++ C C FC KCI +++  G+ +CP     C++  LT+  +I  D   N K+ ++ V CP + CK    L  IE HLR+C  +   CPF  +GC+ P     ++ NHL N  + H+ L+++ ISNM+N+
Sbjct:    6 INRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRND 167          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.276e-16
Identity = 100/453 (22.08%), Postives = 205/453 (45.25%), Query Frame = 1
Query:   94 LFKSSMNNLNYLIYEHSFSK--SRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQ-DISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVC-PEQFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEI---------KISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLP------EEVSRLKSELVRFKSDFESLKSQSE-QNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRKVDSKLKLDK-NPTIIRAPSKRIWEIVNFRDIRKRNHLIASGEFDSDTGHKMEFSLHPDNPKGFLSLYIRVYGKTQNKSSNVPFNGKIEIFIFSKFNPEAKSVKEMFCLIQENDRSQ----AFQFPHESLEEIGALGSDQIVVEFNFFK 1377
            +  S ++N+  L+ +++  +    ++ +  C +C K++ D  ++ C C +C  CI  +L   H +CP  K  C++  L L+ D+ ++   + ++ ++VV CP   C Y + L +++ HL  C PE   CP   IGC         +  HL +++  H  L+M F + +++EI          IS +      + +  +E+    +F  E    KD   ++L+ +   +     NE++        E+ +LKS++  F+ + E +K+  E      ++  + ++K EI  IK  ++++  + E RK+++ ++L+K  P +       +W I  +   R+    + S  F S   H  +F L+       L L+  +    ++     P    + + I      E  S+K     + + D  Q    AF  P +   +   +G+D + V +++ K
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEV----KNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERE-RKMNNLIRLNKLCPNV---DMDFMWRIEEYSKKRRTVTDVYSDSFQS---HNYKFCLNLYIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSII-----EQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDY-CIGTDSL-VRYSYIK 435          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A212ES92 (TRAF6 protein OS=Danaus plexippus plexippus OX=278856 GN=KGM_202662 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.617e-13
Identity = 89/379 (23.48%), Postives = 158/379 (41.69%), Query Frame = 1
Query:  172 FKCGICQKILNDVTKTPCNCSFCLKCIEQHLKN-GHQFCPTMKESCQQHKLTLQ-DISKDEDKNMKLLQLVVTCPF--KNCKYRTNLKQIECHLRVC----PE-------QFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRKVDSKLKLDKNPTIIRAPSKRIWEIVNFR---DIRKRNH---LIASGEFDSDTGHK--MEFSLHPDNPKGFLSLYIRVYGKTQNKSSNVPFNGKIEIFIFSKFNPE 1239
            ++C +C   L D   T C   FC  CI   L+N GH  CP          L+++ DI  D     ++ +  ++CPF  K C  +     ++ H+  C    PE       Q  C F+ +GC     T  ++ +HLH+++ +H +LLM   S +Q +  IS     N    + E+E     +  ++      PP              N+   L   +  L   +V                   LEQ   E+ + I NI  +M+A           +K+K + +  +       IW+I NF+   +  +++H   L + G + S  G++  +  ++ P NP+ F +L++ +     +     PFNG+I   + +++NPE
Sbjct:   34 YECPVCLNWLRDPVITTCGHKFCKSCITSWLQNSGH--CPI-----DNINLSMKVDIFPDNYTKREIQEQRMSCPFATKGCAVKVTPLDLDSHIASCEFNQPEASSQPQVQVPCTFSALGCKETFETQEDMNDHLHSDVQTHMSLLMNAYSKLQIDNDIS-----NASMDAKEQEAMLLWEPSKDGAASTSPP-------------VNNTSAL---IRALYERVV------------------VLEQRNRELDIVIANISKQMSAFAV--------AKMKQNNDLILRYCMGNYIWKIDNFKARLEAMQKDHFKMLYSPGFYTSPNGYRFCVRLNISPQNPQCF-ALHVHLMKTEYDDCLEWPFNGRISFAMINQYNPE 357          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1E1W4E6 (Uncharacterized protein OS=Pectinophora gossypiella OX=13191 GN=g.13052 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.949e-13
Identity = 94/426 (22.07%), Postives = 171/426 (40.14%), Query Frame = 1
Query:  172 FKCGICQKILNDVTKTPCNCSFCLKCIEQHLKN-GHQFCPTMKESCQQHKLTLQ-DISKDEDKNMKLLQLVVTCPF--KNCKYRTNLKQIECHLRVC----------PE-QFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRKVDSKLKLDKNPTIIRAPSKRIWEIVNFR---DIRKRNH---LIASGEFDSDTGHK--MEFSLHPDNPKGFLSLYIRVYGKTQNKSSNVPFNGKIEIFIFSKFNPEAKSVKEMFCLIQENDRSQAFQFPHESLEEIGALGSDQIVVEFNFFKN 1380
            ++C +C   L D   T C   FC  CI   L+N GH  CP          L+++ DI  D     ++ +  ++CPF  K C  +     ++ H+  C          PE +  C F+ +GC     +  ++  HLHN++ SH +LLM    N  +E+KI+   I N    + E+E                            +W+    E  P     L +     ++ +E +          LEQ   E  + I N+  +++A           +K+K +    +       IW+I NF+   D   ++H   L + G + S  G++  +  ++ P NP  F +L++ +     ++    PFNG+I   + ++++P+      M      N    AF+ P+  +  +   G  +  V  +  +N
Sbjct:   34 YECPVCLNWLRDPVITTCGHKFCKGCITSWLQNSGH--CPI-----DNINLSMKVDIFPDNYTKREIQEQRMSCPFASKGCAVKVTPLDLDAHIATCEYNQPEASSQPEIRVPCAFHAVGCKETFDSQEDMNTHLHNDIQSHMSLLM----NAYSEVKINSD-ISNASIDAKEQEAMS-------------------------LWEAPDKEGAPSTAKPLNNTSALIRALYERVV--------VLEQRNREQDIVIANMSKQLSAFAV--------AKMKQNNEMLLRYCMGNYIWKIDNFKARCDAMLKDHYKMLYSPGFYTSPNGYRFCVRLNISPQNPLCF-ALHVHLMKTENDECLEWPFNGRISFAMINQYDPDLTQRDTMM----SNSNLIAFRKPNSEI-CVRGFGYTEYAVVSDVVRN 400          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A3S2NS52 (Uncharacterized protein OS=Chilo suppressalis OX=168631 GN=evm_012233 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.415e-12
Identity = 98/426 (23.00%), Postives = 164/426 (38.50%), Query Frame = 1
Query:  172 FKCGICQKILNDVTKTPCNCSFCLKCIEQHLKN-GHQFCPTMKESCQQHKLTLQ-DISKDEDKNMKLLQLVVTCPF--KNCKYRTNLKQIECHLRVC----PE-------QFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRKVDSKLKLDKNPTIIRAPSKRIWEIVNFR---DIRKRNH---LIASGEFDSDTGHK--MEFSLHPDNPKGFLSLYIRVYGKTQNKSSNVPFNGKIEIFIFSKFNPEAKSVKEMFCLIQENDRSQAFQFPHESLEEIGALGSDQIVVEFNFFKN 1380
            ++C +C   L D   T C   FC  CI   L+N GH  CP          L+++ DI  D     ++ Q  ++CPF  K C  +     ++ H+  C    PE       +  C F  +GC     +   +  HLHNE  SH    M +I N  +E+KI      NN  ++S + ++                      E  ++W+P+ NE                 ++  +L     +    LEQ   E  + I NI  +++A       +  D  L+              +W I NF+   D   ++H   L + G + S  G++  +  ++ P NP  F +L++ +     +     PFNG+I   + +++ PE      M      N    AF+ P   +  +   G  +  V  N  KN
Sbjct:   34 YECPVCLNWLRDPVITTCGHKFCNSCITSWLQNSGH--CPI-----DNINLSMKVDIFPDNYTKREIQQQRMSCPFADKGCTLKVTPLDLDAHIAACEYNQPETSNQIDIKIPCSFQAVGCKETFKSQEEMNAHLHNETQSH----MSYILNAYSEMKI------NNDMNASIDPKE---------------------QEAMILWEPDKNE---------GQNPAPPITNMGTLIQALYERVVVLEQRNREQDIVIANISKQLSAFAVAKNKQNQDMLLRY--------CMGNYVWRIDNFQARLDAMLKDHYKMLYSPGFYTSPNGYRFCVRLNISPQNPLCF-ALHVHLMKTEYDDCLEWPFNGRISFAMINQYEPELSQRDTMM----SNSSLIAFRKPTTEI-CVRGFGYTEYAVVSNVVKN 398          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.0618 bits (118), Expect = 9.645e-7
Identity = 34/121 (28.10%), Postives = 53/121 (43.80%), Query Frame = 1
Query:  133 YEHSFSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCI--EQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGC 489
            YE  F    +  +++C IC   L +  +TPC   FC  CI     L++    CP       + +L   + +K E     +L L V CP K C +R  L+ ++ H      Q  C + Q+ C
Sbjct:   51 YEADFEPP-LESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFPDNFAKRE-----ILSLTVRCPNKPCGHRGELRALQEH------QLRCEYAQVPC 159          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 53.5286 bits (127), Expect = 1.004e-7
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  133 YEHSFSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCI-EQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGCSSPLP 504
            Y+  F  + ++EE+ C IC   L    +T C   FC +C+ E   +     CP  +E     K    D+  D+     +L  +V CP K CK+   L+ +E H R C  + +   N + CS+ LP
Sbjct:   11 YDSEFVIA-VAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREPLDLKK----DVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCSNPM-CSAQLP 129          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 53.1434 bits (126), Expect = 1.357e-7
Identity = 29/106 (27.36%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  145 FSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFK---NCKYRTNLKQIECHLRVCP 453
            F    +  +++C IC   L D  +TPC   FC  CI + +++    CP       + +L   + +K E     ++  +V C  K    C ++  LK++E HL+ CP
Sbjct:   47 FFDPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYRDNFAKRE-----MMSFIVWCRLKKERGCTWKGALKELEEHLKGCP 147          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO27426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A1])

HSP 1 Score: 48.521 bits (114), Expect = 1.054e-6
Identity = 28/98 (28.57%), Postives = 45/98 (45.92%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCI-EQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVC 450
            ++EE+ C IC   L    +T C   FC +C+ E   +     CP  +E     K    D+  D+     +L  +V CP K CK+   L+ +E  ++ C
Sbjct:   19 VAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREPLDLKK----DVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEVSMKGC 112          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 51.9878 bits (123), Expect = 9.822e-7
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVC 450
            +  +++C IC   L +  +T C   FC  CIE+ +++  Q CP   E   + +L   + +K E     +L L V CP  +C  +  L+ +E HL  C
Sbjct:   72 LESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDNEMLSEDQLFPDNFAKRE-----ILSLTVRCPNSDCGEKMELRHLEKHLAQC 163          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000014399.1 (SMESG000014399.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 280/280 (100.00%), Postives = 280/280 (100.00%), Query Frame = 1
Query:  109 MNNLNYLIYEHSFSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRK 948
            MNNLNYLIYEHSFSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRK
Sbjct:    1 MNNLNYLIYEHSFSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGNIKSEMNASRTKNEDRK 280          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000024592.1 (SMESG000024592.1)

HSP 1 Score: 133.265 bits (334), Expect = 2.924e-34
Identity = 110/423 (26.00%), Postives = 190/423 (44.92%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFL-CPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGN-IKSEMNASRTKNEDRKVDSKLKLDKNPT------IIRAPSKRIWEIVNFRDIRKRNHLIASGEFD-SDTGHKMEFSLHPDNPKGF----LSLYIRVYGKTQNKSSNVPFNGKIEIFIFSKFNPEAKSVKEMFCLIQEND-------RSQAFQFPHESLEEIGALGSDQIVVEFN 1368
            ISE+ KC +C+KIL +  ++PC CSFC KCIE+ ++N  + CP   E C+Q  LT  ++  D   N ++ +L+V CP K C Y+  L  ++ HLR C ++ + CP+  +GC         +++H+ +E+YSH ++++   + M+  I                 E   +H+   E N        + + + S+  K N  E L  EV  L ++          +  + +QN   L  ++LEM  +    +K  + +    NE  + D  L+ + +P               +W I      RK+   + S  F      +KM+  L+ +         LS+YI +Y  T++   + PF G + I + +K +  A SVK+   L  ++            F F +  L   G L ++ I VE N
Sbjct:   11 ISEDLKCTLCEKILMNAYQSPCGCSFCQKCIEEFIQNEPKLCPGKSEECKQQFLT--NLQIDYKANNRVQKLIVKCPEKTCLYKCKLSNMDNHLRFCSKKSVKCPYYDLGCDEVAIATDKVIDHIQSEIYSHNSMILGINNQMKQSI-----------------EMLAHHEEIHEEN--------ITSLKNSLKEKENQIESLKREVEILTNK----------INEKVDQNALTLNAILLEMSKDFDQKLKQAIYSVNESNEKYRKDILLRFN-DPGKYDEEHFDSVAGSILWSIEKINKCRKKGGSVESEYFYLGYNKYKMKLLLYANGTGNVTGSGLSIYIYIYPCTKHSKVDWPFKGLVTIKVLNKLDTFA-SVKQKGSLFMDDSIDSCDYQWDNQFDFLYNELSASGVLDNNIITVECN 394          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000024592.1 (SMESG000024592.1)

HSP 1 Score: 130.954 bits (328), Expect = 3.050e-33
Identity = 99/384 (25.78%), Postives = 176/384 (45.83%), Query Frame = 1
Query:  160 ISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQFL-CPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMMLEMKVEIGN-IKSEMNASRTKNEDRKVDSKLKLDKNPT------IIRAPSKRIWEIVNFRDIRKRNHLIASGEFD-SDTGHKMEFSLHPDNPKGF----LSLYIRVYGKTQNKSSNVPFNGKIEIFIFSKFNPEAKSVKEMFCLI 1272
            ISE+ KC +C+KIL +  ++PC CSFC KCIE+ ++N  + CP   E C+Q  LT  ++  D   N ++ +L+V CP K C Y+  L  ++ HLR C ++ + CP+  +GC         +++H+ +E+YSH ++++   + M+  I                 E   +H+   E N        + + + S+  K N  E L  EV  L ++          +  + +QN   L  ++LEM  +    +K  + +    NE  + D  L+ + +P               +W I      RK+   + S  F      +KM+  L+ +         LS+YI +Y  T++   + PF G + I + +K +  A   +  +C+I
Sbjct:   25 ISEDLKCTLCEKILMNAYQSPCGCSFCQKCIEEFIQNEPKLCPGKSEECKQQFLT--NLQIDYKANNRVQKLIVKCPEKTCLYKCKLSNMDNHLRFCSKKSVKCPYYDLGCDEVAIATDKVIDHIQSEIYSHNSMILGINNQMKQSI-----------------EMLAHHEEIHEEN--------ITSLKNSLKEKENQIESLKREVEILTNK----------INEKVDQNALTLNAILLEMSKDFDQKLKQAIYSVNESNEKYRKDILLRFN-DPGKYDEEHFDSVAGSILWSIEKINKCRKKGGSVESEYFYLGYNKYKMKLLLYANGTGNVTGSGLSIYIYIYPCTKHSKVDWPFKGLVTIKVLNKLDTFASVKQSKYCII 370          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000049663.1 (SMESG000049663.1)

HSP 1 Score: 125.561 bits (314), Expect = 1.205e-32
Identity = 81/266 (30.45%), Postives = 136/266 (51.13%), Query Frame = 1
Query:  115 NLNYLIYEHSF-SKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTL-QDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQ-FLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISK-----------ILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEE------SVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQ 852
            NL  ++ E+ F S + IS +  C IC++++      PC C FC  CIEQ+LK    FCP + + CQ  K+   +++S+D   N+++ +++V CP +NC+ +T L  +E H+R C ++   CPF  IGC      N  I  HL++  YSH+ L+++ I+N  NE++  K            L K NR+S  + +   +   ++     +     L   EE       ++     NE L EE++ L+ E   FK  F++++S S   Q
Sbjct:    4 NLWKMMRENKFESDNEISSDLLCRICKRLMIKACNAPCGCRFCSDCIEQYLKENDNFCPGVAKYCQVQKINFTRNVSEDHPANLRISEVIVKCPTQNCETKTELSMMEEHIRTCDKRPISCPFISIGCEINEIANEEIKAHLNDSNYSHSKLIIDLINNFHNEMESLKNENMELRNEMTELKKKNRQSKQQIDNIEFQSTNQYQKMSEMEAKQLENTEEIKKINKEIVAVKKENESLREEMTELRRENREFKQQFDNIQSLSTNQQ 269          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000049621.1 (SMESG000049621.1)

HSP 1 Score: 125.561 bits (314), Expect = 2.611e-32
Identity = 81/274 (29.56%), Postives = 140/274 (51.09%), Query Frame = 1
Query:  115 NLNYLIYEHSF-SKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQHLKNGHQFCPTMKESCQQHKLTL-QDISKDEDKNMKLLQLVVTCPFKNCKYRTNLKQIECHLRVCPEQ-FLCPFNQIGCSSPLPTNGNILNHLHNEMYSHANLLMEFISNMQNEIKISK-----------ILIKNNRRSSSEEERKPYHDFDEESNFQKDPPPILLTPEE------SVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRFLEQMML 876
            NL  ++ E+ F S + IS +  C IC+ ++     TPC C FC  CIEQ+LK    FCP   + CQ  K+   +++S+D   N+++ +++V CP +NC+ +T L  +E H+R C ++   CPFN IGC      N  +  HL+   Y H+ L+++ I+N +NE++  K            L K NR+S  + +   +   ++     +     L   EE       ++     NE L EE++ L+ E   FK   ++++S S   QR  +++++
Sbjct:    4 NLWKMMRENKFESDNEISSDLLCRICKCLMIKACHTPCGCRFCSDCIEQYLKEDDNFCPGEAKYCQVQKINFTRNVSEDHPANLRISEVIVKCPTQNCETKTELSMMEEHIRTCDKRPISCPFNSIGCEMNEIANEEMNAHLNESNYWHSKLIIDLINNFRNEMESLKNENMELRNEMTELKKKNRQSKQQIDNIEFQSTNQYQKMSEMEAKQLENAEEIKKINKEIVAVKKANESLREEMTELRRENREFKQQIDNIQSLSTNQQRLTKELLV 277          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egf1.383e-628.83epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf63.473e-628.18TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B5DF45|TRAF6_RAT1.122e-624.70TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
sp|Q28DL4|TRAF6_XENTR7.518e-628.83TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID81.678e-2032.72TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1011.276e-1622.08TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A212ES922.617e-1323.48TRAF6 protein OS=Danaus plexippus plexippus OX=278... [more]
A0A1E1W4E67.949e-1322.07Uncharacterized protein OS=Pectinophora gossypiell... [more]
A0A3S2NS521.415e-1223.00Uncharacterized protein OS=Chilo suppressalis OX=1... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf69.645e-728.10TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO412431.004e-729.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487731.357e-727.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274261.054e-628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf69.822e-729.90TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014399.10.000e+0100.00SMESG000014399.1[more]
SMESG000024592.12.924e-3426.00SMESG000024592.1[more]
SMESG000024592.13.050e-3325.78SMESG000024592.1[more]
SMESG000049663.11.205e-3230.45SMESG000049663.1[more]
SMESG000049621.12.611e-3229.56SMESG000049621.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017236 ID=SMED30017236|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1461bp
AACTCAATGATAAAAACGGTTACTGATCTTTGGACTAAGTGATCTATGGA
ATGTAATATGTAATCAAATGATATAATAAAGAGTCCCCATGTGTTATTTA
AATCAAGTATGAACAACCTGAATTATCTCATATATGAACACTCTTTTTCT
AAGTCCAGAATATCCGAAGAATTCAAATGTGGAATCTGTCAAAAGATATT
AAATGATGTCACCAAGACTCCTTGCAATTGTTCGTTCTGCCTGAAATGCA
TTGAACAACATCTAAAGAATGGCCATCAGTTCTGTCCGACAATGAAAGAG
TCATGTCAACAACACAAACTGACCCTCCAAGACATATCCAAAGACGAAGA
CAAGAATATGAAACTTCTACAATTAGTTGTTACTTGTCCATTCAAAAACT
GCAAATATCGCACAAACCTGAAACAAATTGAATGTCATTTACGTGTTTGT
CCTGAACAATTTCTTTGTCCTTTTAATCAGATTGGATGCTCTAGTCCACT
TCCAACGAACGGAAACATCCTGAACCATTTACACAACGAAATGTACAGTC
ATGCCAATTTGCTAATGGAGTTTATTTCGAATATGCAGAATGAAATTAAA
ATATCTAAGATTCTAATTAAGAATAACAGAAGGAGTTCATCGGAGGAGGA
AAGAAAACCATATCATGATTTTGATGAGGAAAGTAACTTTCAAAAAGATC
CACCACCAATTCTGTTGACTCCTGAAGAGAGTGTCATTTGGAAACCAAAC
CACAATGAGGTTTTACCAGAAGAAGTCTCACGACTAAAATCTGAATTGGT
TAGATTCAAAAGTGACTTTGAGAGCCTAAAGAGCCAAAGCGAACAAAATC
AGAGATTTCTAGAGCAAATGATGCTAGAAATGAAAGTCGAGATTGGAAAT
ATCAAAAGTGAAATGAATGCCAGTAGGACAAAAAACGAAGATAGAAAAGT
TGATAGTAAATTGAAATTGGACAAGAACCCCACAATCATAAGGGCACCCT
CAAAAAGAATTTGGGAAATTGTGAACTTTAGAGATATTCGGAAAAGGAAT
CACTTGATTGCCAGTGGAGAATTCGACTCGGACACCGGGCACAAAATGGA
GTTTTCGCTGCACCCGGACAACCCCAAAGGATTTCTCAGCCTTTACATTC
GAGTTTATGGGAAAACGCAAAATAAATCTTCAAATGTCCCCTTTAATGGG
AAAATTGAGATTTTTATTTTCAGCAAATTCAATCCGGAAGCAAAATCAGT
TAAGGAAATGTTCTGCTTAATTCAGGAAAATGATAGAAGTCAAGCTTTCC
AATTCCCACATGAAAGTTTAGAGGAGATCGGGGCCTTAGGAAGCGACCAA
ATTGTGGTGGAGTTCAATTTTTTCAAGAACTGACAAAGCAGAACCCTTGA
TTTTTTTATAATCTTTAATAATAATCTCATTCAGATAAACATAATAATTA
TTATTATTATT
back to top

protein sequence of SMED30017236-orf-1

>SMED30017236-orf-1 ID=SMED30017236-orf-1|Name=SMED30017236-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
MNNLNYLIYEHSFSKSRISEEFKCGICQKILNDVTKTPCNCSFCLKCIEQ
HLKNGHQFCPTMKESCQQHKLTLQDISKDEDKNMKLLQLVVTCPFKNCKY
RTNLKQIECHLRVCPEQFLCPFNQIGCSSPLPTNGNILNHLHNEMYSHAN
LLMEFISNMQNEIKISKILIKNNRRSSSEEERKPYHDFDEESNFQKDPPP
ILLTPEESVIWKPNHNEVLPEEVSRLKSELVRFKSDFESLKSQSEQNQRF
LEQMMLEMKVEIGNIKSEMNASRTKNEDRKVDSKLKLDKNPTIIRAPSKR
IWEIVNFRDIRKRNHLIASGEFDSDTGHKMEFSLHPDNPKGFLSLYIRVY
GKTQNKSSNVPFNGKIEIFIFSKFNPEAKSVKEMFCLIQENDRSQAFQFP
HESLEEIGALGSDQIVVEFNFFKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000421tail
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 223..243
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 9..115
coord: 120..403
NoneNo IPR availableCDDcd16449RING-HCcoord: 24..61
e-value: 2.62902E-7
score: 44.7657
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 17..71
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 272..422
e-value: 1.7E-9
score: 39.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 298..382
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 4..122
e-value: 2.6E-15
score: 58.5
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 120..403
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 9..115
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 24..63
score: 9.244
IPR002083MATH/TRAF domainCDDcd00121MATHcoord: 301..421
e-value: 2.41921E-4
score: 38.8995