NEPH-3

Overview
NameNEPH-3 (AKN21716.1)
Smed IDSMED30017231
Length (bp)2913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NEPH-3 (SMED30017231) t-SNE clustered cells

Violin plots show distribution of expression levels for NEPH-3 (SMED30017231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NEPH-3 (SMED30017231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NEPH-3 (SMED30017231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017231

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30017231SMESG000022777.1 dd_Smed_v4_13803_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017231SMESG000022777.1 dd_Smed_v4_13803_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30017231SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017231SMESG000022777.1 dd_Smed_v6_11280_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 154.066 bits (388), Expect = 9.097e-38
Identity = 134/527 (25.43%), Postives = 218/527 (41.37%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W    + +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L  +   PM +I+G  
Sbjct:   53 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPVIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGVA 529          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 145.976 bits (367), Expect = 9.427e-36
Identity = 135/537 (25.14%), Postives = 218/537 (40.60%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVG 1762
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W    + +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L            L     PM +I+G
Sbjct:   53 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPVIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIG 539          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 146.747 bits (369), Expect = 1.748e-35
Identity = 135/539 (25.05%), Postives = 218/539 (40.45%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVGAT 1768
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W    + +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L            L     PM +I+G  
Sbjct:   53 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPVIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVA 541          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 140.969 bits (354), Expect = 1.346e-33
Identity = 129/502 (25.70%), Postives = 204/502 (40.64%), Query Frame = 2
Query:  284 VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLH-IKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFL--NGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            V W KDG  LG         GQ      R+ +  +   G+Y+L ITD EL D+  + CQ      A  S++  + VL+P             P+  R +  P+I+      H + C A N +P A++ W+ +      Q+ G +  T L  +GK   T             V+ L +    L  G    C ++N    + K      +  +         V    +     E + V FTC A+  P    + W  G   + +  + +Y+  +      + ++C   +K    N ST + V + P        T     IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V+S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:   51 VQWTKDGLALG--------MGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQ--ATEAALRSRRAKLTVLIP-------------PEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDG----TQQEGAVASTELLKDGKRETT-------------VSQLLINPTDLDIGRVFTCRSMNEAIPSGK------ETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPT--TTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 502          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL2 (kirre like nephrin family adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:18816])

HSP 1 Score: 128.257 bits (321), Expect = 6.874e-30
Identity = 138/561 (24.60%), Postives = 216/561 (38.50%), Query Frame = 2
Query:  131 MLLMVTISILVSV---NGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAK-NGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGC--NSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICK--AAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMY---------RQINEKIVISVLHILSVQPHDFG-DYNCSVSTKYGSDMATIILLRKSETPMLMIV 1759
            ML M   ++LV +    G      + L  PE  V  L     L C +       V W K G  LG  R D+       P   R+ +  N A G++DL I  +EL DE  + CQ    G    S+   + VLVP + PQ++     GP         + +  G   ++ C ++ + RP   L W+         ++GVL    L+G     +   E  P    V ++L L   S  +G    C A      +Q L  T     +         V      +   E + V F C A+ +P    + W  G   ++  R P+ ++ +       +   C  S ++G    ST + V +GP  +        +  +GE+    C   GNP P +TW R    +V+  G+ L    +  +D GDY+C+  A +           L    PP +     +       ARL C + + P P  + + W +    L  G++ +           R      +ISVLHI   Q  DF   +NCS   + G   A   L R+   P + IV
Sbjct:    1 MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEEARLPCALGAYWGL-VQWTKSGLALGGQR-DL-------PGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAG--LRSRPAQLHVLVPPEAPQVLG----GPS--------VSLVAGVPANLTCRSRGDARPTPELLWF---------RDGVL----LDGATFHQTLLKEGTPG--SVESTLTLTPFSHDDGATFVCRA-----RSQALP-TGRDTAITLSLQYPPEVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEV-VADASFLTEPVSCEVSNAVGSANRSTALDVLFGPILQAKPE--PVSVDVGEDASFSCAWRGNPLPRVTWTRRGGAQVLGSGATLRLPSVGPEDAGDYVCRAEAGLSGLRGGAAEARLTVNAPPVVTALHSAPAFLRGPARLQCLVFASPAP--DAVVWSWDEGFLEAGSQGRFLVETFPAPESRGGLGPGLISVLHISGTQESDFSRSFNCSARNRLGEGGAQASLGRRDLLPTVRIV 512          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 127.102 bits (318), Expect = 9.201e-30
Identity = 130/571 (22.77%), Postives = 237/571 (41.51%), Query Frame = 2
Query:  128 PMLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVV--NGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYW-------------YLNE---------IKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSD-FHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
            P+LL+  +         + +   I+  P+  +AA+  T  L CRV+  ++  V W+KD FGLG  R       +  P   R+ +  + A GEY+L I+++ LFD+  F CQI    + KA  S K  + VLV    P++V+             + +    G+ +   C+++ G+P  ++ W             +L E          K E  +  V+       ++     +S     +Y ++++L        +  +L C++ +  + N K+   S ++ +   P + + V  K       EN      C+ + +P D    +W  G++ L    D      +   DH + I C AT++ IG    +I +      +   +      + G+N    C    NP P I W R  S+E+I  G  L   +++    G+Y C A V+ F ++    YL  +GPP +           ++  + C I     P  N ++W    K++     R  +++        S+L I  ++  DFG YNCS +   G D    +L +++    ++I  
Sbjct:    8 PLLLLFQLVTC------QQLQQRIVEAPKDTLAAVGETAILTCRVEH-QQGPVQWMKDDFGLGTDRD------KPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVK-----------SHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESRSKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPN-KIEVDSVKLSLRYAPQINLTVASKLP---LRENGSALLACNVNAKPLDNVKISWYKGNQKLRETGDTLTFETLKMEDHNRDIFCEATNE-IGTTRGSIKLNVAFGARIMSTSQDKEVNEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISG--RPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKRNILDWIVITA 547          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 127.102 bits (318), Expect = 1.017e-29
Identity = 129/561 (22.99%), Postives = 233/561 (41.53%), Query Frame = 2
Query:  128 PMLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVV--NGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYW-------------YLNE---------IKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSD-FHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK 1732
            P+LL+  +         + +   I+  P+  +AA+  T  L CRV+  ++  V W+KD FGLG  R       +  P   R+ +  + A GEY+L I+++ LFD+  F CQI    + KA  S K  + VLV    P++V+             + +    G+ +   C+++ G+P  ++ W             +L E          K E  +  V+       ++     +S     +Y ++++L        +  +L C++ +  + N K+   S ++ +   P + + V  K       EN      C+ + +P D    +W  G++ L    D      +   DH + I C AT++ IG    +I +      +   +      + G+N    C    NP P I W R  S+E+I  G  L   +++    G+Y C A V+ F ++    YL  +GPP +           ++  + C I     P  N ++W    K++     R  +++        S+L I  ++  DFG YNCS +   G D    +L ++
Sbjct:    8 PLLLLFQLVTC------QQLQQRIVEAPKDTLAAVGETAILTCRVEH-QQGPVQWMKDDFGLGTDRD------KPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVK-----------SHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESRSKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPN-KIEVDSVKLSLRYAPQINLTVASKLP---LRENGSALLACNVNAKPLDNVKISWYKGNQKLRETGDTLTFETLKMEDHNRDIFCEATNE-IGTTRGSIKLNVAFGARIMSTSQDKEVNEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISG--RPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKR 537          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: pxn-2 (PeroXidasiN (Drosophila peroxidase) homolog [Source:UniProtKB/TrEMBL;Acc:G5EG78])

HSP 1 Score: 62.3882 bits (150), Expect = 1.662e-9
Identity = 55/183 (30.05%), Postives = 80/183 (43.72%), Query Frame = 2
Query: 1229 GENMQMECRADGNPEPLITW----QRISS---NEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKY-IYLGEKGPPEIKN-PSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVIS----VLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSE 1738
            GE ++++C A G P P ITW    Q+++    +++   GS+L        D G Y C A+  E  + H + + L E   P I + P  +    GQ   L C  K  P P   ++ W+F      EG R     + N +  IS     L I  V  HD G + C      GS +AT  LL  +E
Sbjct:  366 GETLELKCEASGEPTPTITWLFEKQKLTESRKHKLTKNGSVLKIFPFLNTDIGQYECVASNGEESKSHIFSVSLKESEQPVIIDAPMDTNATIGQQVTLRCNAKGFPVP---DVVWLF------EGIR---IPRRNTRYTISDNNIELTIEKVTRHDSGVFTCQAVNSVGSAVATANLLVGAE 536          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 60.8474 bits (146), Expect = 6.628e-9
Identity = 104/503 (20.68%), Postives = 187/503 (37.18%), Query Frame = 2
Query:  233 NSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLP-FNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKY--GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQR----ISSNEVI--ARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEI-----KNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYG 1699
            ++T+ + CR + +   E+ W  DG                KP     ++P     +G+  LRI +++   EG + C +  N    + Q   V++   S+ P++V  +++           + V +G    I+C    G P   + W          K+G                 + +L +    ++ L L+  +L +G    C+A N    +Q    T  +++V         V   K+ N ++ +      C  +GRP  +   W    + +       +    TR D GK    C  S   G    + L+     P F+  +  T +    GE+ ++EC+ DG+P+P I+W +     + + +I   RG  L+    Q  D G Y C  A   + +  +   +     P I     + P    G E     L C +   P P    + W   +  +   +RH +    +       L I SV   D G Y+C    + G
Sbjct: 3050 DTTLEIPCRTEGIPPPEISWFLDG----------------KP---ILEMPGVTYKQGDLSLRIDNIKPNQEGRYTC-VAENKAGRAEQDTYVEI---SEPPRVVMASEV-----------MRVVEGRQTTIRC-EVFGNPEPVVNWL---------KDG--------------EPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQ--TTTDVEVLVPPRIEDEERVLQGKEGNTYMVH------CQVTGRPVPY-VTWKRNGKEIEQFNPVLHIRNATRADEGKY--SCIASNEAGTAVADFLIDVFTKPTFETHE--TTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTC-VATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGE---IILKCPVLGNPTPT---VTWKRGDDAVPNDSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAG 3467          

HSP 2 Score: 53.9138 bits (128), Expect = 7.528e-7
Identity = 67/293 (22.87%), Postives = 121/293 (41.30%), Query Frame = 2
Query:  779 YDVVNSLELKI--VSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIF--IENDIVEFTCSASGRPSDFHWAWTIGDESLV-----NIRDPKYKLKITRV---DHGKKITCCATSKSIGCNSTNILVK--YGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRN--------DIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPE--IKNPSVSYGREGQSARLSCTIKSIPFPNDN--EIKWIFKNKQLLEG 1579
            + +VN+ +LKI  V+ ++     C+A+N    N   +Y +         ++    + +K  N++  IEND +   C  + RP     +W  GD+ +      +I      + I +    D GK I  C  S   G +  ++++K    P    S+ +    A +   + +EC   G P+P + W +   +  +    ++L          ++Q  D G Y C A  +     H +  L    PPE  I     +  REG +  L+C IK      D   ++ W  K+ + L+G
Sbjct: 3437 HTIVNNYDLKINSVTTEDAGQYSCIAVNEA-GNLTTHYAA--------EVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLP-SISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYI--CRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDF-SLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWT-KDSRALDG 3715          

HSP 3 Score: 53.5286 bits (127), Expect = 9.533e-7
Identity = 109/514 (21.21%), Postives = 173/514 (33.66%), Query Frame = 2
Query:  212 ERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSL-KN--GNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSD----FHWAWTIGDESLVNIRDPKYKLKITRVD-HGKKITCCATSKSIGCNSTNILVKY--GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRND--------IQADDFGDYICKA--AVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTK 1693
            + ++A  N  I L+C  K +      W  +G  + +         Q  PH  R D           L + +++L + GVF CQ+       + +  L   L   +KP++          I      + V  G  + I C A  G P     W  N I ++  +                        K + V N   L+I    KN  GN+  C+  N   T+Q   +   Q     +P         + NN  +  D VE  C     P      F     IG ++   + +    L I         I  C  S   G    N+ V     P+ KD D +T  +        + C    NP P I+W       +  + S    +D         +  D G Y C A  A  E  +  +   +      E K     + +EG+   L C +   P P   +I W+     +  G ++K     N+ +    LH  SV     G+Y+C   +K
Sbjct: 1186 QEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDS---------QLIPHTIRED---------GALVLQNVKLENTGVFVCQV----SNLAGEDSLSYTLTVHEKPKI----------ISEVPGVVDVVKGFTIEIPCRA-TGVPEVIRTWNKNGIDLKMDE------------------------KKFSVDNLGTLRIYEADKNDIGNY-NCVVTNEAGTSQMTTHVDVQEPPIILPST-------QTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVP---QINWVVDGTVVEPGKKYKGATLSNDGL---TLHFDSVSVKQEGNYHCVAQSK 1628          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 60.4622 bits (145), Expect = 6.742e-9
Identity = 104/503 (20.68%), Postives = 187/503 (37.18%), Query Frame = 2
Query:  233 NSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLP-FNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKY--GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQR----ISSNEVI--ARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEI-----KNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYG 1699
            ++T+ + CR + +   E+ W  DG                KP     ++P     +G+  LRI +++   EG + C +  N    + Q   V++   S+ P++V  +++           + V +G    I+C    G P   + W          K+G                 + +L +    ++ L L+  +L +G    C+A N    +Q    T  +++V         V   K+ N ++ +      C  +GRP  +   W    + +       +    TR D GK    C  S   G    + L+     P F+  +  T +    GE+ ++EC+ DG+P+P I+W +     + + +I   RG  L+    Q  D G Y C  A   + +  +   +     P I     + P    G E     L C +   P P    + W   +  +   +RH +    +       L I SV   D G Y+C    + G
Sbjct: 3050 DTTLEIPCRTEGIPPPEISWFLDG----------------KP---ILEMPGVTYKQGDLSLRIDNIKPNQEGRYTC-VAENKAGRAEQDTYVEI---SEPPRVVMASEV-----------MRVVEGRQTTIRC-EVFGNPEPVVNWL---------KDG--------------EPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQ--TTTDVEVLVPPRIEDEERVLQGKEGNTYMVH------CQVTGRPVPY-VTWKRNGKEIEQFNPVLHIRNATRADEGKY--SCIASNEAGTAVADFLIDVFTKPTFETHE--TTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTC-VATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGE---IILKCPVLGNPTPT---VTWKRGDDAVPNDSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAG 3467          

HSP 2 Score: 53.9138 bits (128), Expect = 7.854e-7
Identity = 67/293 (22.87%), Postives = 121/293 (41.30%), Query Frame = 2
Query:  779 YDVVNSLELKI--VSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIF--IENDIVEFTCSASGRPSDFHWAWTIGDESLV-----NIRDPKYKLKITRV---DHGKKITCCATSKSIGCNSTNILVK--YGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRN--------DIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPE--IKNPSVSYGREGQSARLSCTIKSIPFPNDN--EIKWIFKNKQLLEG 1579
            + +VN+ +LKI  V+ ++     C+A+N    N   +Y +         ++    + +K  N++  IEND +   C  + RP     +W  GD+ +      +I      + I +    D GK I  C  S   G +  ++++K    P    S+ +    A +   + +EC   G P+P + W +   +  +    ++L          ++Q  D G Y C A  +     H +  L    PPE  I     +  REG +  L+C IK      D   ++ W  K+ + L+G
Sbjct: 3437 HTIVNNYDLKINSVTTEDAGQYSCIAVNEA-GNLTTHYAA--------EVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLP-SISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYI--CRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDF-SLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWT-KDSRALDG 3715          

HSP 3 Score: 53.5286 bits (127), Expect = 9.616e-7
Identity = 109/514 (21.21%), Postives = 173/514 (33.66%), Query Frame = 2
Query:  212 ERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSL-KN--GNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSD----FHWAWTIGDESLVNIRDPKYKLKITRVD-HGKKITCCATSKSIGCNSTNILVKY--GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRND--------IQADDFGDYICKA--AVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTK 1693
            + ++A  N  I L+C  K +      W  +G  + +         Q  PH  R D           L + +++L + GVF CQ+       + +  L   L   +KP++          I      + V  G  + I C A  G P     W  N I ++  +                        K + V N   L+I    KN  GN+  C+  N   T+Q   +   Q     +P         + NN  +  D VE  C     P      F     IG ++   + +    L I         I  C  S   G    N+ V     P+ KD D +T  +        + C    NP P I+W       +  + S    +D         +  D G Y C A  A  E  +  +   +      E K     + +EG+   L C +   P P   +I W+     +  G ++K     N+ +    LH  SV     G+Y+C   +K
Sbjct: 1186 QEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDS---------QLIPHTIRED---------GALVLQNVKLENTGVFVCQV----SNLAGEDSLSYTLTVHEKPKI----------ISEVPGVVDVVKGFTIEIPCRA-TGVPEVIRTWNKNGIDLKMDE------------------------KKFSVDNLGTLRIYEADKNDIGNY-NCVVTNEAGTSQMTTHVDVQEPPIILPST-------QTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVP---QINWVVDGTVVEPGKKYKGATLSNDGL---TLHFDSVSVKQEGNYHCVAQSK 1628          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0332492)

HSP 1 Score: 129.028 bits (323), Expect = 4.874e-30
Identity = 131/544 (24.08%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  173 GIESVDDYILVHPERQVAALNSTITLKCRVKVVEKY-EVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV---VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNG---YTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 1759
            G ++   +  + P+ Q A + S +TL CRV  +EK   + W KD FGLG  R ++  +        R+ +  +  EG++ L I  L L D+  + CQ+       +   S+   + VLVP + P++ Q             + ++  +   + ++C+++ G+P A + W      +  +    + E   + +  IT+ S             L+L      +     C A N     Y + KL           V +V   +   K      E   V  +C A   P +  + W I DE +      K  +      +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E +  +++ I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:   76 GGDNGGQHFAMEPQDQTAVVGSRVTLPCRV--MEKVGALQWTKDDFGLGQHR-NLSGF-------ERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------------GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSR-RITARSI------------LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGK----IPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALI-IRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309498)

HSP 1 Score: 129.028 bits (323), Expect = 4.874e-30
Identity = 131/544 (24.08%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  173 GIESVDDYILVHPERQVAALNSTITLKCRVKVVEKY-EVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV---VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNG---YTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 1759
            G ++   +  + P+ Q A + S +TL CRV  +EK   + W KD FGLG  R ++  +        R+ +  +  EG++ L I  L L D+  + CQ+       +   S+   + VLVP + P++ Q             + ++  +   + ++C+++ G+P A + W      +  +    + E   + +  IT+ S             L+L      +     C A N     Y + KL           V +V   +   K      E   V  +C A   P +  + W I DE +      K  +      +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E +  +++ I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:   76 GGDNGGQHFAMEPQDQTAVVGSRVTLPCRV--MEKVGALQWTKDDFGLGQHR-NLSGF-------ERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------------GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSR-RITARSI------------LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGK----IPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALI-IRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070560)

HSP 1 Score: 129.028 bits (323), Expect = 4.874e-30
Identity = 131/544 (24.08%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  173 GIESVDDYILVHPERQVAALNSTITLKCRVKVVEKY-EVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV---VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNG---YTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 1759
            G ++   +  + P+ Q A + S +TL CRV  +EK   + W KD FGLG  R ++  +        R+ +  +  EG++ L I  L L D+  + CQ+       +   S+   + VLVP + P++ Q             + ++  +   + ++C+++ G+P A + W      +  +    + E   + +  IT+ S             L+L      +     C A N     Y + KL           V +V   +   K      E   V  +C A   P +  + W I DE +      K  +      +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E +  +++ I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:   76 GGDNGGQHFAMEPQDQTAVVGSRVTLPCRV--MEKVGALQWTKDDFGLGQHR-NLSGF-------ERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------------GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSR-RITARSI------------LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGK----IPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALI-IRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309499)

HSP 1 Score: 129.028 bits (323), Expect = 4.874e-30
Identity = 131/544 (24.08%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  173 GIESVDDYILVHPERQVAALNSTITLKCRVKVVEKY-EVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV---VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNG---YTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 1759
            G ++   +  + P+ Q A + S +TL CRV  +EK   + W KD FGLG  R ++  +        R+ +  +  EG++ L I  L L D+  + CQ+       +   S+   + VLVP + P++ Q             + ++  +   + ++C+++ G+P A + W      +  +    + E   + +  IT+ S             L+L      +     C A N     Y + KL           V +V   +   K      E   V  +C A   P +  + W I DE +      K  +      +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E +  +++ I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:   76 GGDNGGQHFAMEPQDQTAVVGSRVTLPCRV--MEKVGALQWTKDDFGLGQHR-NLSGF-------ERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------------GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSR-RITARSI------------LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGK----IPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALI-IRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070559)

HSP 1 Score: 129.028 bits (323), Expect = 4.874e-30
Identity = 131/544 (24.08%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  173 GIESVDDYILVHPERQVAALNSTITLKCRVKVVEKY-EVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV---VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNG---YTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 1759
            G ++   +  + P+ Q A + S +TL CRV  +EK   + W KD FGLG  R ++  +        R+ +  +  EG++ L I  L L D+  + CQ+       +   S+   + VLVP + P++ Q             + ++  +   + ++C+++ G+P A + W      +  +    + E   + +  IT+ S             L+L      +     C A N     Y + KL           V +V   +   K      E   V  +C A   P +  + W I DE +      K  +      +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E +  +++ I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:   76 GGDNGGQHFAMEPQDQTAVVGSRVTLPCRV--MEKVGALQWTKDDFGLGQHR-NLSGF-------ERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------------GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSR-RITARSI------------LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGK----IPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALI-IRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 159.073 bits (401), Expect = 1.953e-40
Identity = 139/526 (26.43%), Postives = 227/526 (43.16%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV-VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFL-NGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P   V      +TL C + +  +  V WVKDG  LG +R D+  Y        R+D+  + ++GEY L I   EL D+G F CQ + V G++  +Q   + VLVP D P ++    +  +A            G+ L++ C A N +P AS+ W  N    E        +T L +GK     ES+         V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++ +      + ++C  T+     N S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +    + +I+G
Sbjct:   26 QPHDLVIVAGEPVTLPCTI-IGYQGMVLWVKDGLALGVNR-DLSGYP-------RYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAGRSRPAQ---LTVLVPPDDPVIIGAPVVSLRA------------GDSLNLTCHANNAKPAASIIWIRNG---EVINGAAYTKTLLRDGK----REST---------VSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 500          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 159.844 bits (403), Expect = 7.459e-40
Identity = 136/525 (25.90%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV-VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P   V      +TL C + +  +  V WVKDG  LG +R D+  Y        R+D+  + ++GEY L I   EL D+G F CQ + V G++  +Q   + VLVP D P ++    +  +A            G+ L++ C A N +P AS+ W  N    E        +T L               K    V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++ +      + ++C  T+     N S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +    + +I+G
Sbjct:   26 QPHDLVIVAGEPVTLPCTI-IGYQGMVLWVKDGLALGVNR-DLSGYP-------RYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAGRSRPAQ---LTVLVPPDDPVIIGAPVVSLRA------------GDSLNLTCHANNAKPAASIIWIRNG---EVINGAAYTKTLLRDG------------KRESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 500          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 159.844 bits (403), Expect = 7.459e-40
Identity = 136/525 (25.90%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV-VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P   V      +TL C + +  +  V WVKDG  LG +R D+  Y        R+D+  + ++GEY L I   EL D+G F CQ + V G++  +Q   + VLVP D P ++    +  +A            G+ L++ C A N +P AS+ W  N    E        +T L               K    V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++ +      + ++C  T+     N S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +    + +I+G
Sbjct:   26 QPHDLVIVAGEPVTLPCTI-IGYQGMVLWVKDGLALGVNR-DLSGYP-------RYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAGRSRPAQ---LTVLVPPDDPVIIGAPVVSLRA------------GDSLNLTCHANNAKPAASIIWIRNG---EVINGAAYTKTLLRDG------------KRESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 500          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 154.836 bits (390), Expect = 5.482e-39
Identity = 130/512 (25.39%), Postives = 214/512 (41.80%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL 1723
             P+  V      +TL C +       V W++DG  LG  R D+  Y        R+ +  +   GE+ LRI  +EL D+ VF CQ +    A  S+   + VLVP D P +                P++ +  G+ L++ C A N +P AS+ W  N    E     + ++T L               +    V++L +   ++++G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P    + W  G   +  +    Y++ +      + ++C  T+     N S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  +IL    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E  V+S L + ++ P DF   YNC+    +GSD   I L
Sbjct:   39 QPQDLVVVAGQPVTLPCSIPGYHGV-VLWLRDGLALGVGR-DLSGYP-------RYAVVGDHGSGEHHLRIQKVELMDDAVFECQAI--QAAMRSRPARLTVLVPPDDPMIT-------------GGPVVSLRAGDPLNLTCHADNAKPAASIIWIRNG---EVLNGAMYSKTLLRDG------------RRESTVSTLYISASNIESGQKIICRASNKAVPNGK------ETSVTIDIQHLPLVNLSVEPQPVLEGNLVKFHCSAKANPPVTQYKWAKGGSVIKEVSGDTYEVIVDHSFFTEPVSCEVTNPLGSTNISRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKSVRQEDAGKYVCRAVVPRVGAAEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRL 500          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 146.362 bits (368), Expect = 1.168e-35
Identity = 121/475 (25.47%), Postives = 201/475 (42.32%), Query Frame = 2
Query:  356 PHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIV-VNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
            P   R+D+  + ++GEY L I   EL D+G F CQ + V G++  +Q   + VLVP D P ++    +  +A            G+ L++ C A N +P AS+ W  N    E        +T L               K    V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++ +      + ++C  T+     N S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +    + +I+G
Sbjct:   24 PGYPRYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAGRSRPAQ---LTVLVPPDDPVIIGAPVVSLRA------------GDSLNLTCHANNAKPAASIIWIRNG---EVINGAAYTKTLLRDG------------KRESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 457          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 154.066 bits (388), Expect = 4.968e-38
Identity = 142/543 (26.15%), Postives = 220/543 (40.52%), Query Frame = 2
Query:  173 GIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYE--VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVL--NETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            G+ +     +  P  Q       + L C   VV  Y   V W KDG  LG         GQ      R+ +  N+  G+Y+L I++  + D+  F CQ      A  SQK  + VL+P + P    + + GP+        I++  G   ++ C A + +P AS+ W+ +      Q+ G +   E   +GK   T             V+ L +       G    C   N    + K      +  V         V          E + V FTCSA+  P    + W  G   + + RD  Y+   T+VD+    +   C     +G    ST + V++ P        T     +G ++ + C   GNP   +TW +  SN V++ G+ L    ++ +D G Y+CKA V       + + L   GPP I +  V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V+S L I +V   DF   YNC+    +G   A I LL +   P+ +I GAT
Sbjct:   20 GLPAFQPRFIQEPTDQTVVAGQKVVLTC---VVLNYSGIVQWTKDGLALG--------LGQNLRIWPRYQIVGNVESGQYNLEISNASIVDDANFECQ--ATEAALRSQKAKLTVLIPPEDP----VIEGGPE--------ILLRAGTPTNLTCRANSAKPPASIVWFRDG----NQQAGDVYSTEVLADGKRATT-------------VSYLLISPTDQDIGRVFTCRTSNEAIPSGK------ETSVKLNVHHPPTVTLSIHPQTVQEGERVRFTCSATANPEIKGYRWAKGGMIIESARDSSYE---TQVDYSFFTEPVSCEVHNEVGSTNVSTLVDVQFAPRVVVEPKPT--TTDMGSDVTLTCIWAGNPPLTLTWTKKGSNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDKGKVECFIGSTPPP--DRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 507          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 153.295 bits (386), Expect = 5.967e-38
Identity = 130/525 (24.76%), Postives = 225/525 (42.86%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      ++L C +       + W+KDG  +G  R D+  Y        R+ +  +   GE+ L I   EL D+ ++ CQ +    A  S+   + VLVP D P +                P+I +  G+ L++ C A N +P A++ W          KNG +    LNG     +   +   K   ++++L +    ++NG  + C A N      K      +  V         V    +    +E+++V+F C+A   P+   + W  G + L  + D  Y+  +      + ++C  T+     N S  + V +GP    + +S+T+    +G +    C   GNP   I W +  S  V++  + L   +++ +D G Y+C+A V       + I L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     ++ VIS L I ++   DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   11 QPQDQVVVAGQPVSLLCAIPGYHGL-LLWIKDGLAIGVGR-DLSGYP-------RYSVGGDHLSGEHHLMIQRAELQDDAMYECQAI--QAAIRSRPARLTVLVPPDDPVIT-------------GGPVISIRAGDPLNLTCHADNAKPAATITW---------MKNGEV----LNGATYYKTLLRDG--KRESIISTLFVSSSDIENGQTITCRATNKAVPGGK------EATVTINIQHPPLVNLTVEPQPVLEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYETVVDFSFFTEPVSCEVTNALGSTNVSRTVDVYFGPRMSSEPESITV---DLGSDATFHCAWIGNPSLTIVWMKRGSGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVSTDEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPVTVIIG 485          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 153.68 bits (387), Expect = 7.198e-38
Identity = 130/525 (24.76%), Postives = 225/525 (42.86%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      ++L C +       + W+KDG  +G  R D+  Y        R+ +  +   GE+ L I   EL D+ ++ CQ +    A  S+   + VLVP D P +                P+I +  G+ L++ C A N +P A++ W          KNG +    LNG     +   +   K   ++++L +    ++NG  + C A N      K      +  V         V    +    +E+++V+F C+A   P+   + W  G + L  + D  Y+  +      + ++C  T+     N S  + V +GP    + +S+T+    +G +    C   GNP   I W +  S  V++  + L   +++ +D G Y+C+A V       + I L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     ++ VIS L I ++   DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   11 QPQDQVVVAGQPVSLLCAIPGYHGL-LLWIKDGLAIGVGR-DLSGYP-------RYSVGGDHLSGEHHLMIQRAELQDDAMYECQAI--QAAIRSRPARLTVLVPPDDPVIT-------------GGPVISIRAGDPLNLTCHADNAKPAATITWM---------KNGEV----LNGATYYKTLLRDG--KRESIISTLFVSSSDIENGQTITCRATNKAVPGGK------EATVTINIQHPPLVNLTVEPQPVLEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYETVVDFSFFTEPVSCEVTNALGSTNVSRTVDVYFGPRMSSEPESITV---DLGSDATFHCAWIGNPSLTIVWMKRGSGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVSTDEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPVTVIIG 485          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 153.295 bits (386), Expect = 8.626e-38
Identity = 130/525 (24.76%), Postives = 225/525 (42.86%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      ++L C +       + W+KDG  +G  R D+  Y        R+ +  +   GE+ L I   EL D+ ++ CQ +    A  S+   + VLVP D P +                P+I +  G+ L++ C A N +P A++ W          KNG +    LNG     +   +   K   ++++L +    ++NG  + C A N      K      +  V         V    +    +E+++V+F C+A   P+   + W  G + L  + D  Y+  +      + ++C  T+     N S  + V +GP    + +S+T+    +G +    C   GNP   I W +  S  V++  + L   +++ +D G Y+C+A V       + I L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     ++ VIS L I ++   DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   24 QPQDQVVVAGQPVSLLCAIPGYHGL-LLWIKDGLAIGVGR-DLSGYP-------RYSVGGDHLSGEHHLMIQRAELQDDAMYECQAI--QAAIRSRPARLTVLVPPDDPVIT-------------GGPVISIRAGDPLNLTCHADNAKPAATITW---------MKNGEV----LNGATYYKTLLRDG--KRESIISTLFVSSSDIENGQTITCRATNKAVPGGK------EATVTINIQHPPLVNLTVEPQPVLEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYETVVDFSFFTEPVSCEVTNALGSTNVSRTVDVYFGPRMSSEPESITV---DLGSDATFHCAWIGNPSLTIVWMKRGSGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVSTDEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPVTVIIG 498          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 153.68 bits (387), Expect = 9.003e-38
Identity = 130/525 (24.76%), Postives = 225/525 (42.86%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      ++L C +       + W+KDG  +G  R D+  Y        R+ +  +   GE+ L I   EL D+ ++ CQ +    A  S+   + VLVP D P +                P+I +  G+ L++ C A N +P A++ W          KNG +    LNG     +   +   K   ++++L +    ++NG  + C A N      K      +  V         V    +    +E+++V+F C+A   P+   + W  G + L  + D  Y+  +      + ++C  T+     N S  + V +GP    + +S+T+    +G +    C   GNP   I W +  S  V++  + L   +++ +D G Y+C+A V       + I L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     ++ VIS L I ++   DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   22 QPQDQVVVAGQPVSLLCAIPGYHGL-LLWIKDGLAIGVGR-DLSGYP-------RYSVGGDHLSGEHHLMIQRAELQDDAMYECQAI--QAAIRSRPARLTVLVPPDDPVIT-------------GGPVISIRAGDPLNLTCHADNAKPAATITWM---------KNGEV----LNGATYYKTLLRDG--KRESIISTLFVSSSDIENGQTITCRATNKAVPGGK------EATVTINIQHPPLVNLTVEPQPVLEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYETVVDFSFFTEPVSCEVTNALGSTNVSRTVDVYFGPRMSSEPESITV---DLGSDATFHCAWIGNPSLTIVWMKRGSGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVSTDEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPVTVIIG 496          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 152.91 bits (385), Expect = 2.680e-38
Identity = 135/525 (25.71%), Postives = 217/525 (41.33%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W      +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L  +   PM +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPIIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 494          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 153.295 bits (386), Expect = 8.136e-38
Identity = 135/525 (25.71%), Postives = 217/525 (41.33%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W      +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L  +   PM +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPIIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 494          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 153.295 bits (386), Expect = 8.136e-38
Identity = 135/525 (25.71%), Postives = 217/525 (41.33%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W      +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L  +   PM +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPIIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 494          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 153.295 bits (386), Expect = 1.045e-37
Identity = 135/527 (25.62%), Postives = 217/527 (41.18%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W      +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L  +   PM +I+G  
Sbjct:   53 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPIIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGVA 529          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 146.362 bits (368), Expect = 1.353e-35
Identity = 136/537 (25.33%), Postives = 217/537 (40.41%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVG 1762
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W      +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L            L     PM +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPIIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIG 506          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q8IZU9|KIRR3_HUMAN (Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606 GN=KIRREL3 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 8.394e-35
Identity = 135/539 (25.05%), Postives = 218/539 (40.45%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVGAT 1768
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W    + +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L            L     PM +I+G  
Sbjct:   53 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPVIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVA 541          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q8BR86|KIRR3_MOUSE (Kin of IRRE-like protein 3 OS=Mus musculus OX=10090 GN=Kirrel3 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.759e-34
Identity = 136/539 (25.23%), Postives = 217/539 (40.26%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVGAT 1768
             P+ QV      +TL C +   + + V W+KDG  LG  R D+  Y Q       + +  N   GE+ L+I   EL D+ V+ CQ +    A  S+   + VLVP D P ++               P+I +  G+ L++ C A N +P AS+ W     K E       ++T L               K   +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W      +       Y+  +      + ++C  T+     N S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L I ++   DF   YNC+    +GSD   I L            L     PM +I+G  
Sbjct:   53 QPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGR-DLSSYPQ-------YLVVGNHLSGEHHLKILRAELQDDAVYECQAI--QAAIRSRPARLTVLVPPDDPIIL-------------GGPVISLRAGDPLNLTCHADNAKPAASIIWLR---KGEVINGATYSKTLLRDG------------KRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVA 541          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q80W68|KIRR1_MOUSE (Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.179e-34
Identity = 127/505 (25.15%), Postives = 210/505 (41.58%), Query Frame = 2
Query:  284 VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIV-NDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFL--NGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIY----AASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            V W KDG  LG         GQ      R+ +  +   G+Y+L ITD EL D+  + CQ      A  S++  + VL+P             P+  R +  P+I+   G   ++ C A N +P A++ W+ +      Q+ G +  T L  +GK   T             ++ L ++   L  G    C ++N    N K      +  +         V    +    +E + V FTC A+  P    + W  G   + +  + +Y+  +      + ++C   +K +G  + + LV    N   +  + +Y       IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V +   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V+S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:   83 VQWTKDGLALG--------MGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQ--ATEAALRSRRAKLTVLIP-------------PEETRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDG----TQQEGAVTSTELLKDGKRETT-------------ISQLLIEPTDLDIGRVFTCRSMNEAIPNGK------ETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNK-VGSTNVSTLV----NVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q6X936|KIRR1_RAT (Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 5.160e-34
Identity = 127/505 (25.15%), Postives = 210/505 (41.58%), Query Frame = 2
Query:  284 VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIV-NDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFL--NGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIY----AASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            V W KDG  LG         GQ      R+ +  +   G+Y+L ITD EL D+  + CQ      A  S++  + VL+P             P+  R +  P+I+   G   ++ C A N +P A++ W+ +      Q+ G +  T L  +GK   T             ++ L ++   L  G    C ++N    N K      +  +         V    +    +E + V FTC A+  P    + W  G   + +  + +Y+  +      + ++C   +K +G  + + LV    N   +  + +Y       IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V +   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V+S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:   83 VQWTKDGLALG--------MGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQ--ATEAALRSRRAKLTVLIP-------------PEDTRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDG----TQQEGAVTSTELLKDGKRETT-------------ISQLLIQPTDLDIGRVFTCRSMNEAIPNGK------ETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNK-VGSTNVSTLV----NVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q7TSU7|KIRR2_MOUSE (Kin of IRRE-like protein 2 OS=Mus musculus OX=10090 GN=Kirrel2 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.036e-33
Identity = 141/564 (25.00%), Postives = 223/564 (39.54%), Query Frame = 2
Query:  131 MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAK-NGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGC--NSTNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKE--FPERHKYIYLGEKGPPEIK--NPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQI---------NEKIVISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            ML    +  L    G      + L  PE  V  L     L C +       V W KDG  LG  R D+       P   R+ +  N A G++DL I  +EL DE  + CQ    G    S+   + V+VP + PQ++     GP         + +  G   ++ C ++ + RP   L W+ + I+++       ++T L  K T T E            N+L L   S  +G  L C A      +Q L  T     V         V    +     E + V F C A+ +P    + W  G   ++  R P+ ++ +       +   C  S ++G    ST + V YGP  +    S+++    +G++    C   GNP P ITW R+  ++V++ G  L    +  +D GDY+C+A  +            L    PP +    P+ ++ R    ARL C + + P P+   + W +    L  G+  +   +              +ISVLHI   Q  DF   +NCS   + G     I L R+   P + IV   
Sbjct:    1 MLASALLVFLCCFKGHAGSSPHFLQQPEDMVVLLGEEARLPCALGAYRGL-VQWTKDGLALGGER-DL-------PGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAG--LRSRPAQLHVMVPPEAPQVLG----GPS--------VSLVAGVPGNLTCRSRGDSRPAPELLWFRDGIRLDGSS---FHQTTLKDKATGTVE------------NTLFLTPSSHDDGATLICRA-----RSQALP-TGRDTAVTLSLQYPPMVTLSAEPQTVQEGEKVTFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEV-VADATFLTEPVSCEVSNAVGSANRSTALEVLYGPILQAKPKSVSV---DVGKDASFSCVWRGNPLPRITWTRMGGSQVLSSGPTLRLPSVALEDAGDYVCRAEPRRTGLGGGKAQARLTVNAPPVVTALQPAPAFLR--GPARLQCVVFASPAPDS--VVWSWDEGFLEAGSLGRFLVEAFPAPEVEGGQGPGLISVLHISGTQESDFTTGFNCSARNRLGEGRVQIHLGRRDLLPTVRIVAGA 512          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A0H3YJJ7 (NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=NEPH-3 PE=2 SV=1)

HSP 1 Score: 1571.6 bits (4068), Expect = 0.000e+0
Identity = 801/813 (98.52%), Postives = 801/813 (98.52%), Query Frame = 2
Query:  104 QIYLIISEPMLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKEIFDSNFLRHNAGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS 2542
            QIYLIISEPMLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMK            GNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS
Sbjct:    9 QIYLIISEPMLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMK------------GNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS 809          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A0H3YFE9 (NEPH-2 OS=Schmidtea mediterranea OX=79327 GN=NEPH-2 PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 2.476e-127
Identity = 283/841 (33.65%), Postives = 444/841 (52.79%), Query Frame = 2
Query:  131 MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQN--NIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKEIFDSNFLRHNAGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNF-WPNSQEIESCYSNSVPDSQSSNKSVK------ITKHE-NANTNP-ILYNMHT--IGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCT--QYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANK-----------------------KHQIQF-----QTDFYSPGKPIIKNKLNSGSANME 2494
            MLL + I  ++S+  I   ++YI VHPE Q   LNST+T++CRV+ ++  +V+WVK GFGLG +R+DIR +G    ++ R+D+P +L+ G YDL+ITD+ L DEG FYCQ+ +   A +SQ+  + VLV S  P+++QI    +GP+ +RNE +PI+V++G+ + ++C A+ GRPGA L W ++   IE   +G  N   ++G IT  S+   N  KL D  ++L+ K+  L NG  +KC A N G+  +K N+  A+  +       + +    QN  N F END +  +CSA GRP  F W W I D  ++N     YK+K TR  +   + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +      IS+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y K    S   R N+ N + P        KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++      + K E   ++NP ++ +MH    G+  +NR S          P    P      Q +  QY + +  NP    N       + A P Y V  P+++                        H ++      QT F  PG  I +N  N  S N+ 
Sbjct:    1 MLLKLFI-FIISLKFIFGNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVG-NKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFN-GIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGF--EKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQK---GSPTNRINSNNSTDP-------LKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRAS----------PCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIR 815          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A4S2MJS2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000877 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 1.902e-113
Identity = 197/542 (36.35%), Postives = 310/542 (57.20%), Query Frame = 2
Query:  182 SVDDYILVHPERQVAALNSTITLKCRVKVV------EKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQF-RFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGV----LNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
             VD  I +HP+ Q   LNST+ L+CRV+++         +V+W K+ FG+G SR DI++YG+   + + R+DLP+NL +G+YDL+IT++EL DEG + CQ+      Y SQ  L+ V VPS+ P+L Q+     GP+       P IV+DG  L +KC+A++G+PGA + W ++ + I+ + + V    +      G +T +   S + P+L D  + +  ++  L +G  ++C A N GY  Q L     ++ V+  P+V I V P +++N ++E+DI+   C+A GRP  F W W +    + NI DP Y+L++TR  H     C A S   G   T + VK+GP F +   L ++ AS+GE++ MEC A GNP P I W+R   +EV+ RG    ++ ++ DDFG YIC A V EFP   K +Y+ ++ PP I+   V + + G++ARL CT+ S+P P  ++  W F  + + +   H   R+     V+ +L I  V   D+G YNC+V   YGSD   I L ++ + P+  IVG+ 
Sbjct:   10 GVDGIIQIHPDSQAVTLNSTVRLQCRVRILTDPQTGAGAQVYWSKNDFGIGGSREDIQEYGRSSRYPYSRYDLPYNLKDGQYDLQITNVELSDEGSYVCQVNFMKHQYLSQTALLTVQVPSEAPKLYQVTNEGKGPEVEIGSATPAIVDDGAILVLKCVARHGKPGAIISWSIDGVPIQVETDPVKKVNVFRAGFTGNLTNSLTPSPSFPRLKDASSQMSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMHNAVFRCIAISNKKGHTETTVRVKFGPQFLEPSPL-LFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPQPPPDQTHWYFNGRPVRQDNHHTFEREEFLGGVVLILQIAHVMRTDYGKYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGSA 550          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A4S2MJ83 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000877 PE=4 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 2.166e-113
Identity = 200/553 (36.17%), Postives = 316/553 (57.14%), Query Frame = 2
Query:  155 ILVSVNGIE--SVDDYILVHPERQVAALNSTITLKCRVKVV------EKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQF-RFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGV----LNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            IL+  + +E   VD  I +HP+ Q   LNST+ L+CRV+++         +V+W K+ FG+G SR DI++YG+   + + R+DLP+NL +G+YDL+IT++EL DEG + CQ+      Y SQ  L+ V VPS+ P+L Q+     GP+       P IV+DG  L +KC+A++G+PGA + W ++ + I+ + + V    +      G +T +   S + P+L D  + +  ++  L +G  ++C A N GY  Q L     ++ V+  P+V I V P +++N ++E+DI+   C+A GRP  F W W +    + NI DP Y+L++TR  H     C A S   G   T + VK+GP F +   L ++ AS+GE++ MEC A GNP P I W+R   +EV+ RG    ++ ++ DDFG YIC A V EFP   K +Y+ ++ PP I+   V + + G++ARL CT+ S+P P  ++  W F  + + +   H   R+     V+ +L I  V   D+G YNC+V   YGSD   I L ++ + P+  IVG+ 
Sbjct:   28 ILMDTSKLENPGVDGIIQIHPDSQAVTLNSTVRLQCRVRILTDPQTGAGAQVYWSKNDFGIGGSREDIQEYGRSSRYPYSRYDLPYNLKDGQYDLQITNVELSDEGSYVCQVNFMKHQYLSQTALLTVQVPSEAPKLYQVTNEGKGPEVEIGSATPAIVDDGAILVLKCVARHGKPGAIISWSIDGVPIQVETDPVKKVNVFRAGFTGNLTNSLTPSPSFPRLKDASSQMSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMHNAVFRCIAISNKKGHTETTVRVKFGPQFLEPSPL-LFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPQPPPDQTHWYFNGRPVRQDNHHTFEREEFLGGVVLILQIAHVMRTDYGKYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGSA 579          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A095AEM0 (Irregular chiasm C-roughest protein OS=Schistosoma haematobium OX=6185 GN=MS3_00396 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 6.141e-113
Identity = 205/538 (38.10%), Postives = 307/538 (57.06%), Query Frame = 2
Query:  197 ILVHPERQVAALNSTITLKCRVKVV------EKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQF-RFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGP-QAIR-NEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKN-----GVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            I +HPE Q   LNST+ L+CRV+++         +V+W K+ FG+G +R DI++YG+   + + R+DLP+NL EG+YDL+I ++EL DEG + CQ+    + Y SQ  ++ V VPS+ PQLVQI   G  Q I      P IV+DG  + ++CIA++G+PGA L W+++ ++++ + N     G     F +G +T   ESS  +P+L D  +S+   +  L +G  ++C A N GY    L     +I V+  P+V I V P + +N F+E+DI+   C+A GRP  F W W +    + NI +  Y+L++TR  H     C A S   G   T I VK+GP F  + +L ++ AS+GE++ M+C A GNP P I W+R    EV++R   L R +++ +DFG YIC A V EFP   K +Y+  + PP I+   + +   GQ ARL CT+ S+P P   +  W F    +   + HK  ++     V+ VLHI  V   DFG YNCSV   YGSD   I L  + + P+  I+GA 
Sbjct:   62 IQLHPESQSVTLNSTVRLQCRVRMLIDPDTGAGVQVYWSKNDFGIGGNREDIQEYGRNSRYDYSRYDLPYNLKEGQYDLQIMNVELSDEGSYVCQVNFMRQQYLSQTAVLTVQVPSEAPQLVQITNEGKGQRIDIGPSRPAIVDDGSIMVLECIARHGKPGALLTWFIDGVQVKLESNPDSTPGSFISGF-SGNLTFQLESSAKIPRLVDATSSMRAHLNKLHHGKLVECRAENTGYEMHTLRPAQTKIEVHYAPVVSIQVRPSRPDNQFMEHDIITVECTAHGRPDSFFWEWYVNGRQVENIAESWYRLRLTRELHQSVFRCIAISNKKGVAETTIKVKFGPQFHQASAL-LFTASLGEDVLMDCPAIGNPTPHIEWRREGGREVLSRSVSLKRENLKEEDFGTYICTAFVPEFPPVSKQMYIARRKPPRIQPNPIVHAYLGQPARLRCTVNSVPLPPSGQTHWYFNGNPIQPDSHHKFEQEEFIGGVVLVLHIAHVMMSDFGQYNCSVKNGYGSDWKLIRLSHQEDIPIQFIIGAA 597          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 160.229 bits (404), Expect = 3.263e-40
Identity = 135/525 (25.71%), Postives = 224/525 (42.67%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+  V      +TL C +       V W+KDG  LG  R D+  Y        R+ +  + + GE+ LRI  +EL D+ VF CQ +    A  S+   + VLVP + P +             +  PI+ +  G+ L++ C A N +P AS+ W             + N   LNG   + S++     +    V++L +   +++ G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P    + W  G   +  +    Y++ +      + ++C  T+     N S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  +IL    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E  V+S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:    5 QPQDLVVVAGQPVTLPCSIPGYHGV-VLWIKDGLALGVGR-DLSGYP-------RYTVVGDHSSGEHHLRIQRVELMDDAVFECQAI--QAAMRSRPARLTVLVPPEDPVI-------------DGGPIVSLRAGDPLNLTCHADNAKPAASIIW-------------IRNGEVLNG--AMYSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKAIPNGK------ETSVTIDIQHLPLVNLSVEPQPVLEGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGSTNISRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 160.229 bits (404), Expect = 3.996e-40
Identity = 135/525 (25.71%), Postives = 224/525 (42.67%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+  V      +TL C +       V W+KDG  LG  R D+  Y        R+ +  + + GE+ LRI  +EL D+ VF CQ +    A  S+   + VLVP + P +             +  PI+ +  G+ L++ C A N +P AS+ W             + N   LNG   + S++     +    V++L +   +++ G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P    + W  G   +  +    Y++ +      + ++C  T+     N S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  +IL    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E  V+S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:    5 QPQDLVVVAGQPVTLPCSIPGYHGV-VLWIKDGLALGVGR-DLSGYP-------RYTVVGDHSSGEHHLRIQRVELMDDAVFECQAI--QAAMRSRPARLTVLVPPEDPVI-------------DGGPIVSLRAGDPLNLTCHADNAKPAASIIW-------------IRNGEVLNG--AMYSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKAIPNGK------ETSVTIDIQHLPLVNLSVEPQPVLEGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGSTNISRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 152.525 bits (384), Expect = 1.334e-37
Identity = 144/557 (25.85%), Postives = 233/557 (41.83%), Query Frame = 2
Query:  113 LIISEPMLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNG-VLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN-STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
            L  S P L+ + +   VS  G  +V    +  P   V      +TL C +       V W  DG  LG +R D+  Y        R+D+  + ++GEY L I   EL D+G F CQ +  G    S+   + VLVP D P ++               PI+ +  G+ L++ C A N +P AS+ W          +NG VLN    +  +    +    +  LY   +++E       +G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P   H+ W  G   + ++    Y+  +      + ++C  T+     N S N+ V +GP    +  SL +    +G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +    + +I+G
Sbjct:    8 LYASSPFLIPLCLCFCVS--GACAV---FVQQPHDVVVVAGQPVTLPCSITGFHGM-VLW--DGLALGVNR-DLSGYP-------RYDVIGDHSKGEYHLLIQRTELGDDGSFECQGIQAG--IRSRPARLTVLVPPDDPVII-------------GAPIVSLRAGDPLNLTCHADNAKPAASIIWI---------RNGEVLNGAMYSKTLLRDGQRESTVSTLYISASNIE-------SGQRITCRASNKAAPNGK------EATVTIDIQHLPLVNLSVEPQPILEGNLVKFHCSAKANPPVTHYRWAKGGAVIRDVLGDSYEAVVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGHGVVLSNENTLTLKAVKQEDAGKYVCRAVVPRVGVGEKEVTLTVNGPPTISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 506          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1 [Source:NCBI gene;Acc:103031116])

HSP 1 Score: 133.265 bits (334), Expect = 1.890e-31
Identity = 135/539 (25.05%), Postives = 220/539 (40.82%), Query Frame = 2
Query:  209 PERQVAALNSTITLKCRVKVVEKYE--VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNP-IIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKI--VSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCNSTNILVK--YGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNK--QLLEGTRHKMYRQINEK------IVISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            P  Q   L   + L C   VV  Y   V W KDG  LG    D+R +        R+ +   +  G+Y+L I+  EL D+ ++ CQ      A  S++  + VL+P D+P +             E +P I++  G   ++ C+++  +P A++ W         QK+G+  E   +        ++E LP    V     L +  V    G    C+A N      K      +  +         V    +    +E + V FTC A+  P    + W  G    V I+  +  + IT+ DH    +   C    ++G  + +ILV   +GP    +   +T+ + S   ++ + C+  GNP   +TW +  S+ V++  + L    +   D G Y+CKA V         + L   GPP I +  V Y   G+   + C I S P P  ++I W +K    +  +GT  + Y     K       V+S L I +V   DF   YNC+    +G     I L      P+ +I G T
Sbjct:    8 PADQSVVLGQRVVLSC---VVFNYSGIVQWTKDGLALGIGE-DLRAWP-------RYRVLRMVDIGQYNLEISSAELSDDSLYECQ--ATEAALRSRRAKLTVLIPPDEPVI-------------EGSPEILLTAGVPHNLSCVSRGAKPPAAIEW---------QKDGLPIEGAFS--------TTEVLPDRKRVTTRSFLPVLPVDTDTGKNFTCMATNPAVPMGK------RTTITLNVHHPPVVVLSIEPRSVLEGERVTFTCQATANPPIMGYKWAKGG---VVIQGARESVFITKADHSFFTEPVSCQVFNAVGSTNVSILVDVHFGPILVVEPKPVTVDSDS---DVTLNCKWAGNPPLTLTWTKKGSSMVLSNNNQLYLKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPVQYAVRGERGEVKCYIASTPPP--DKIVWAWKENVWEKEKGTLPERYTVEQSKPSSDGGAVLSTLTINNVMESDFQSTYNCTAWNGFGPGTMIITLEETEVVPVGIIAGGT 489          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 114.39 bits (285), Expect = 1.608e-25
Identity = 127/523 (24.28%), Postives = 213/523 (40.73%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYE--VHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNP-IIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCNSTNILV--KYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNK-------QLLEGTRHKMYRQINE-KIVISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIIL 1723
             P  Q   L   + L C   VV  Y   V W KDG  LG    D+R +        R+ +   +  G+Y+L I+  EL D+ ++ CQ      A  S++  + VL+P D P +             E  P I++  G   ++ C+++  +P +++ WY         K+GV+    ++G  T T   ++   K     + L ++ V    G+   C+A N      K      +  +         V         +E + V FTC A+  P    + W  G   L   R+  +   +T  DH    +   C    ++G  + +ILV   +GP    +   +T+    +  ++ + C+  GNP   +TW +  S+ V++  + L    +   D G Y+CKA V         + L   GPP I +  V Y   G+   + C I S P P  ++I W +K          LLE    +  + +++   V+S L I +V   DF   YNC+    +G     I L
Sbjct:   28 EPADQSVVLGERVVLSC---VVFNYTGIVQWTKDGLALGIGE-DLRAWP-------RYRVLRIVDVGQYNLEISSSELSDDSLYECQ--ATEAALRSRRAKLTVLIPPDDPVI-------------EGAPEILLMAGVPYNLTCVSRGAKPLSTIEWY---------KDGVI----VDGAHTSTEVLADR--KRVTTRSFLPIQPVDTDTGHNFSCVASNLAVPLGK------RATITLNVHHAPTVLLSISPRSVLEGERVTFTCQATANPPVMGYRWAKGGVILEGARESVF---VTTADHSFFTEPVSCQVFNAVGSTNVSILVDVHFGPILVVEPRPVTV---DVDSDVTLNCKWAGNPPLTLTWTKKGSSMVLSNNNQLYLKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPVQYAVRGEKGEIKCYIASTPPP--DKIVWAWKENVWEKERGTLLERYTVEQSKPVSQGGAVLSTLTINNVMESDFQSTYNCTAWNSFGPGTMIITL 495          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010550.1 (pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 gene:ENSPMAG00000009556.1 transcript:ENSPMAT00000010550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.866e-17
Identity = 52/171 (30.41%), Postives = 77/171 (45.03%), Query Frame = 2
Query: 1229 GENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI--VISVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRK 1732
            G +    C   GNP   + W R  SN V++  ++LL   +  DD G Y+CKA V       K + L   GPP I +  + +   G+  R+ C I S   P  + + W +K   L  GT  +   +   ++  V+S L I +V   DF   YNC+    +GSD     L  K
Sbjct:   16 GSDATFTCAWSGNPPLTLAWTRKGSNVVLSNSNMLLLKGVTQDDTGRYVCKAIVPRIGVGEKEVMLNVNGPPIISSDLLQHALRGEKGRVECFIGST--PPAHHLAWAWKENVLEVGTYERYTVETVSRVDGVLSTLTITNVMEGDFQTAYNCTAWNGFGSDTEIFTLREK 184          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 59.3066 bits (142), Expect = 2.890e-9
Identity = 70/287 (24.39%), Postives = 108/287 (37.63%), Query Frame = 2
Query:  950 QNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRD-----PKYKLKIT--RVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDS-------------LTIYAASIGENMQMECRADGNPEPLITWQRISSN-------EVIARGSILLRNDIQADDFGDYICKA-AVKEFPERHKYIYLGEKGPPEIKNPSVSYGRE-GQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 1723
            Q  +  E  +  F C  + RP D    W     +L    D     P   L+IT  R +      C A++ +    S + L+   P      S             LT++  +I     +EC A GNP P+++W R+          +V+  G++++ +D+     G Y+C A        R     L  + PPE   P  S  R  G SA L+C+ +  P P    I W+     L +  R ++          S L I  V   D G Y C+     G   A+  L
Sbjct:  107 QPVVVEEGGVARFQCLINARP-DPLVTWEKNRTALTEDDDRYTFLPSGVLQITGVRPEDSGYFRCIASNVAGRRRSMDALLTVTPAVPAKSSKDPVILSGPQNLTLTVHQTAI-----LECIATGNPRPIVSWSRLDGRPIGVEGIQVVGTGNLMI-SDVAVQHAGVYVCAANRPGTRVRRTAQGRLIVQAPPEFMQPPQSVTRSLGASAVLTCSAQGTPSPR---IIWLHNGLPLHQSERVRLQNG------NSTLTIQRVCSEDEGIYQCTAENSAGYTQASARL 377          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 57.7658 bits (138), Expect = 1.316e-8
Identity = 46/183 (25.14%), Postives = 81/183 (44.26%), Query Frame = 2
Query: 1172 KYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQR------ISSNEVIARGSILLRNDIQADDFGDYIC-----KAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSV 1684
            +YGP F ++ + +T    S  + +   CRA G+P PL  W +      I+ +  +A GS+++RN  +  D G + C       ++     R ++ YL           +V   R+GQ   L C     P P   E+ +++   ++ +  R    R +++  V   L+I  V+  D G Y C V
Sbjct:    5 EYGPLFLEEPEDVTYLVESSEKKVSFRCRASGHPPPLYRWLKNGTEVPITGHYSLAGGSLIVRNPSEGRDGGVFQCLVTNSVGSIISVEARLQFAYLESFRSKPRGTVAV---RQGQGVVLICA----PPPYSGELTFVWLFNEMYDYMRSDGRRFVSQ--VTGNLYIAKVEATDVGSYTCMV 178          

HSP 2 Score: 54.6842 bits (130), Expect = 9.690e-8
Identity = 60/228 (26.32%), Postives = 92/228 (40.35%), Query Frame = 2
Query: 1148 CNSTNILVKYGPNFKDSDSLTIYAA------------SIGENMQMECRADGNPEPLITWQR-------ISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFP-ERHKYIYLGEKGPPEIKNP--SVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVIS---VLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMI 1756
            CN+ N+  K     K    +T+YA              IG+ +  +C+A G P P   W R        S   V+A G ++L+ ++Q  D G Y C A  K      H  + +    P    NP   V+    G  A + C  K+ P P+     W   N  +++          NE++ I+    L I SV   D G Y C+V    GS  +T  L+ K  T + ++
Sbjct:  276 CNAENVAGKNSAQGK----ITVYAPPHWIQPISNVEQGIGDKLSWDCKAGGKPPPTYRWLRNGVPLPSESRFSVMANGELILQ-ELQPWDRGMYQCLAENKHGRIYSHGELRVKASAPDFRSNPLKRVTPAARGGQAVIKCEPKAWPRPS---FTWTKGNAMVMD----------NERMSITQNGSLWIRSVTDEDAGTYTCTVENHLGSANSTGRLILKESTRITVV 485          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001736.1 (pep scaffold:Pmarinus_7.0:GL477265:10898:44695:-1 gene:ENSPMAG00000001554.1 transcript:ENSPMAT00000001736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.833e-8
Identity = 68/284 (23.94%), Postives = 116/284 (40.85%), Query Frame = 2
Query:  971 NDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYK--------LKIT--RVDHGKKITCCATSKSIGCNSTNILVKYGPN-----------FKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISS-------NEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGE----KGPPEIKNP-SVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 1723
             ++    C  SGRP     AW   D + +    P+Y+        L+I+  R +   +  C AT+ +    S  + V   P             +   ++T+ A   G    +EC A G P P+++W R+         ++V+  G++LL  D+Q    G Y+C+A+V     R+     G+      P  ++ P SVS  R G +AR  C  + +P P    + W+   + +    R K+   ++ ++VI+ L        D   Y C      GS  A   L
Sbjct:   21 GEVARLECRVSGRPEPLI-AWER-DGTALPADSPRYRHTLLPSGVLQISAIRSEDAGRYRCQATNMAATRYSREVEVSVLPPGELEGYEKPNITQRPRNVTVEA---GGTAVLECVAQGRPRPIVSWSRLEHLPLDVYHSQVLGSGNLLL-ADVQPHHAGVYVCRASVPG--TRNFTTATGQLTVLAAPWFVEQPESVSRPRAG-TARFMCHAEGVPPP---AVAWLKNGEPIHSNGRVKV---LDNRLVITQL-----IAEDEAYYQCVAENALGSGTAAAWL 284          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 4.672e-8
Identity = 58/231 (25.11%), Postives = 97/231 (41.99%), Query Frame = 2
Query: 1103 HGKKITCCATSKSIGCN-STNILVKYGPNF----KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSN---------------EVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPS-VSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTR---HKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 1723
            H    TC A +++   +  + ++V+  P F    KD D +       G+ + + C ADG P P I W+    N               + +  GS+LLR  +Q +D G Y+C+ +     +  K + L  K P  + + + V+    GQ + L C+ +         I+W  K + L++  R   + +Y Q     ++S L IL     D G + C     YG D   I L
Sbjct:  496 HNGNYTCLARNEAATVSHGSQLIVRVPPRFVVQPKDQDGI------FGKPVVLNCSADGYPIPKIIWKYSKGNGNPQFQPVLSGGGRFQPLGNGSLLLRQ-VQEEDGGFYLCQVSNGVGTDISKSMLLNVKIPALVTSQANVTLATRGQHSNLQCSARG---ERPIIIRWE-KEETLIDPERMFRYVVYTQDTGDELLSTLQILPTVRGDSGFFTCHAINSYGEDRGLIQL 715          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO30350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T115])

HSP 1 Score: 68.9366 bits (167), Expect = 4.689e-13
Identity = 48/176 (27.27%), Postives = 72/176 (40.91%), Query Frame = 2
Query: 1244 MECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKA----AVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLH-ILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMI 1756
            + C A GNP P +TW R    +V+  G  L  +D++  D G Y+C A      +  P           G     N +V    EG+S  L+CT    P PN   I W          T+H +   +   I   ++H I SVQ    G Y C+ + + G+   T+ +   S   +  I
Sbjct:    1 LSCSATGNPTPNVTWTRSGGADVLGTGETLTISDVKISDGGCYVCTAYNNIGSEANPASVHVTSTTPSGDTFASNITV---IEGESLTLNCTATGCPTPN---ITW----------TKHGVSAALRSNITTEIIHQIASVQKSHAGRYTCAANNEIGTVSRTLSVTVHSAPSITFI 160          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO49558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM2])

HSP 1 Score: 61.2326 bits (147), Expect = 1.355e-9
Identity = 66/279 (23.66%), Postives = 115/279 (41.22%), Query Frame = 2
Query:  965 IENDIVEFTCSASGRPSDFHWAWTIG-----DESLVNIRDPKYKLKI---TRVDHGKKITCCATSK--SIGCNSTNILV-KYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSIL-LRNDIQA----------DDFGDYICKAAVKEFPERHKYIYLGEKG--PPE-IKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILL 1726
            +END V      +G P      +  G     +  +  +RD    + +     +D     TC A +    + C+S  +   + GP F     L +     G    +E    G P+P++ W  +   E++   S++ L  + Q           DD G+Y C A  K          L E+G  PP+ I  PS     EG+ A+    +  +P P   E++W+   + +  G R ++  + +     SVL I+  + +D G+Y C  ++K G D  ++ LL
Sbjct:  181 VENDAVRLEVEVTGEPKPVVLWFCEGKPIEENRRVYTMRDGSTSVLVIENAELDDEAMYTCKAINDLGEVECSSEMLPTDEAGPKF--LQRLELKEVVEGSRTDLEVEVSGKPKPVVEW--LKDGELVKPSSLMTLETEGQVHTLTIMNTTLDDEGEYTCIAKNKVGEVSCTAELLVEEGMRPPQFIVKPSSLQIMEGKMAKFEARVSGLPGP---EVEWLRDGRPIKPGRRFQIEFEKDR----SVLTIIDAKLNDEGEYTCVATSKAGKDSCSVELL 448          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO35185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM80])

HSP 1 Score: 59.3066 bits (142), Expect = 6.319e-9
Identity = 54/210 (25.71%), Postives = 87/210 (41.43%), Query Frame = 2
Query: 1178 GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITW--------QRISSNEVIARGS--ILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVS------YGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKM---------YRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK 1732
            GP    S S  ++ A +G ++ + C A G+P+P + W        + +S  +++ +GS  IL    +  +D G Y C A       +   + L       I  P VS            +  L C +++ P      + W   +KQL +G R+KM         Y+++  +     L I  V   D G+Y C V T  GS  A I L+ K
Sbjct:  330 GPPIITSRS-NVHEAKVGSDVAVACVATGSPKPTVEWSSQPLPQCRSLSRAKIVNQGSTAILTIESVTKEDEGIYCCVARNSNGQSKPHIVILSVSYHKRILPPHVSPFSQVVVSTTDSTTTLICAVENAP-QKYTTVFWTLNSKQLTDGGRYKMATTFSTEVEYKRLLLERATMTLIIKHVTTQDSGEYQCGVVTHIGSGHAEIQLVTK 537          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO29616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T347])

HSP 1 Score: 57.3806 bits (137), Expect = 2.016e-8
Identity = 66/269 (24.54%), Postives = 100/269 (37.17%), Query Frame = 2
Query:  968 ENDIVEFTCSASGRPS-DFHW---------AWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIG----CNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKA---AVKEFPERHKYIYLGEKGPPEIKN--PSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATI 1717
            END V  TCSASGRP+ +  W         A   G  +L         LKI R  H   +  C     +G         I+V+Y P      + T+ A   GE + + C   GNP P ++W +  S      G++  +        G Y+C A          R    Y+  K  P I +  P  +        +L+C     P P    + W   ++  L  +R  +Y            +  SV   + G Y C+ + + GSD  T+
Sbjct:  132 ENDDVTNTCSASGRPAPNVTWVNKTSGSPVAHGTGSATL-------SLLKIQR--HQAGLYQCQAINDVGRGAITQDVTIIVQYPPEITPIQNTTVRA---GETITLTCAVAGNPTPSVSWSKAGSGHSTG-GNVFTKAGATKAVTGQYVCTAVNTVTGNTQTRTASTYVMVKYKPSIISSYPGQTVNETIDFLKLTCISDGYPAPT---VTW---SRDGLVVSRTSVY------------YSNSVTRSEAGTYTCTATNEMGSDATTV 369          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO28796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5G7])

HSP 1 Score: 55.4546 bits (132), Expect = 2.530e-8
Identity = 46/172 (26.74%), Postives = 71/172 (41.28%), Query Frame = 2
Query: 1217 AASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAA--VKEFPERHKYIYLGEKGPPEIKNPSVSY-GREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 1723
             A  G+N+++ C A G PEP+I W              +    +Q +D G Y C+A   +       K I +    P  ++ P V   G  G    L+C I   P P+   I+W    +Q+  G      RQ   +++I        +  D G Y C+ + K GS  A I+L
Sbjct:   10 VAKQGQNLKIPCIATGFPEPVIAWSHDGKPRYSTDIGTMTLESVQFNDRGTYTCQAKNFIGSARITFKLISIFAVIPRFVQPPPVYLPGYIGWETTLTCDIFGFPPPH---IEWTRALQQIHSG----RTRQAGRRLIIK-----KTEQQDRGPYMCTGTNKLGSVFALIVL 169          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 164.851 bits (416), Expect = 1.422e-41
Identity = 139/528 (26.33%), Postives = 224/528 (42.42%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+  V      +TL C +       V W+KDG  LG  R D+  Y        R+ +  +   GE+ LRI  +EL D+ VF CQ V    A  S+   + VLVP D P +                P++ +  G+ L++ C A N +P AS+ W          +NG +    +  K++I +   +   +    V++L L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH    +   C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   23 QPQDLVVVAGQPVTLPCSIPGYHGI-VLWIKDGLALGVGR-DLSGYP-------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAV--QAAMRSRPARLTVLVPPDDPVI-------------GGGPVVSLRAGDPLNLTCHADNAKPAASIIWM---------RNGEVLNGAMYSKVSIEALVRDG--RRESTVSTLYLSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 501          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 162.925 bits (411), Expect = 7.283e-41
Identity = 140/529 (26.47%), Postives = 219/529 (41.40%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNG-VLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+  V      +TL C +       V W+KDG  LG  R D+  Y        R+ +  +   GE+ LRI  +EL D+ VF CQ V    A  S+   + VLVP D P +                P++ +  G+ L++ C A N +P AS+ W          +NG VLN    +  +         +  LY       L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH    +   C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   51 QPQDLVVVAGQPVTLPCSIPGYHGI-VLWIKDGLALGVGR-DLSGYP-------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAV--QAAMRSRPARLTVLVPPDDPVI-------------GGGPVVSLRAGDPLNLTCHADNAKPAASIIWM---------RNGEVLNGAMYSKALVRDGRRESTVSTLY-------LSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 525          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 162.155 bits (409), Expect = 1.507e-40
Identity = 141/528 (26.70%), Postives = 223/528 (42.23%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
             P+  V      +TL C +       V W+KDG  LG  R D+  Y        R+ +  +   GE+ LRI  +EL D+ VF CQ V    A  S+   + VLVP D P +                P++ +  G+ L++ C A N +P AS+ W          +NG      LNG   + S++     +    V++L L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH    +   C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:   93 QPQDLVVVAGQPVTLPCSIPGYHGI-VLWIKDGLALGVGR-DLSGYP-------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAV--QAAMRSRPARLTVLVPPDDPVI-------------GGGPVVSLRAGDPLNLTCHADNAKPAASIIWM---------RNG----EVLNG--AMYSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 567          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 157.147 bits (396), Expect = 4.170e-39
Identity = 140/533 (26.27%), Postives = 220/533 (41.28%), Query Frame = 2
Query:  206 HPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPII-VNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNG-VLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHG--KKITCCATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSET----PMLMIVG 1762
             P+  V      +TL C +       V W+KDG  LG  R D+  Y        R+ +  +   GE+ LRI  +EL D+ VF CQ V    A  S+   + VLVP D P +                P++ +  G+ L++ C A N +P AS+ W          +NG VLN    +  +         +  LY       L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH    +   C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ VIS L + ++ P DF   YNC+    +GSD   I L  +  +    P+ +I+G
Sbjct:   19 QPQDLVVVAGQPVTLPCSIPGYHGI-VLWIKDGLALGVGR-DLSGYP-------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAV--QAAMRSRPARLTVLVPPDDPVI-------------GGGPVVSLRAGDPLNLTCHADNAKPAASIIWM---------RNGEVLNGAMYSKALVRDGRRESTVSTLY-------LSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGGSQESLPVAVIIG 497          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: kirrel3l (kirre like nephrin family adhesion molecule 2 [Source:NCBI gene;Acc:101173407])

HSP 1 Score: 138.658 bits (348), Expect = 3.670e-33
Identity = 131/546 (23.99%), Postives = 212/546 (38.83%), Query Frame = 2
Query:  140 MVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLH-IKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVISVLHILSVQPHDFG-DYNCSVSTKYGSDMATIILLRKSETPMLMI 1756
            M ++ ++  +    +   Y    P+ QV     ++TL C V V  +  V W KDG  LG  R D+       P   R+ L  +   GE+ L I   EL D+ V+ CQ    G    S +  + VLVP   P +             E  P++       H + C A   +P A + WY         ++G + ET +  K  +     E        V+ L +       G    C  +N      +      Q  V        +V    Q     E   V F CSAS  P    + W+ G   +        ++ +        I+C   S S+G    ST + V++GP    +   +T+    IG +    C   GNP   + W +  S+ V++ G+ L    +  +D G Y CKA V       + + L   GPP I   +  +  +    +L C + S P P++  I W F +  L  G+  R+ +    +++ V S L +      DF   YNC+   ++G+  A + L  +   P L+I
Sbjct:    1 MSSLYLIFCLMATATQAAYFSQQPQDQVVVSGQSVTLPC-VIVGYRGMVQWTKDGLALGGER-DL-------PGWTRYSLMGDPLSGEHSLLIDSAELADDAVYECQATQAG--LRSHRAKLTVLVPPSDPVV-------------EGGPVVRLKAHTPHNLTCRASGAKPAAEITWY---------RDGEVMETAIYSKTLMQDGKRET------AVSMLPIIPEDSDTGRTYTCRVLNPAAPAGR------QTSVTINVQHPPSVTLSVQPQTVTEGAKVLFLCSASANPEITGYRWSKGGVPISEANGDSLEVTVDYSYFTDPISC-EVSNSVGSTNVSTLVDVQFGPRLLSEPKPMTV---DIGMDAAFTCAWTGNPPLTLAWTKQGSSVVLSNGNTLQLKAVTQEDAGTYTCKAIVPRIGVAERDVTLTVNGPPIITADATQHAVKHSKGKLECRVGSSPPPDN--IVWTFGDMTLSSGSSGRYSVQTVTSDRGVFSSLVLSETLAQDFQMRYNCTAWNRFGTGTALVTLEEQEALPTLII 495          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 1550.8 bits (4014), Expect = 0.000e+0
Identity = 790/804 (98.26%), Postives = 791/804 (98.38%), Query Frame = 2
Query:  131 MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKEIFDSNFLRHNAGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS 2542
            MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAK+GRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIV SVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMK            GNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS
Sbjct:    1 MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKHGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMK------------GNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS 792          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 1544.64 bits (3998), Expect = 0.000e+0
Identity = 787/801 (98.25%), Postives = 788/801 (98.38%), Query Frame = 2
Query:  140 MVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKEIFDSNFLRHNAGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS 2542
            MVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAK+GRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIV SVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMK            GNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS
Sbjct:    1 MVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKHGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMK------------GNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLISDYAS 789          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000071657.1 (SMESG000071657.1)

HSP 1 Score: 416.387 bits (1069), Expect = 6.885e-131
Identity = 283/841 (33.65%), Postives = 444/841 (52.79%), Query Frame = 2
Query:  131 MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQN--NIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKEIFDSNFLRHNAGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNF-WPNSQEIESCYSNSVPDSQSSNKSVK------ITKHE-NANTNP-ILYNMHT--IGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCT--QYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANK-----------------------KHQIQF-----QTDFYSPGKPIIKNKLNSGSANME 2494
            MLL + I  ++S+  I   ++YI VHPE Q   LNST+T++CRV+ ++  +V+WVK GFGLG +R+DIR +G    ++ R+D+P +L+ G YDL+ITD+ L DEG FYCQ+ +   A +SQ+  + VLV S  P+++QI    +GP+ +RNE +PI+V++G+ + ++C A+ GRPGA L W ++   IE   +G  N   ++G IT  S+   N  KL D  ++L+ K+  L NG  +KC A N G+  +K N+  A+  +       + +    QN  N F END +  +CSA GRP  F W W I D  ++N     YK+K TR  +   + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +      IS+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y K    S   R N+ N + P        KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++      + K E   ++NP ++ +MH    G+  +NR S          P    P      Q +  QY + +  NP    N       + A P Y V  P+++                        H ++      QT F  PG  I +N  N  S N+ 
Sbjct:    1 MLLKLFI-FIISLKFIFGNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVG-NKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFN-GIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGF--EKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQK---GSPTNRINSNNSTDP-------LKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRAS----------PCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIR 815          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000074081.1 (SMESG000074081.1)

HSP 1 Score: 176.792 bits (447), Expect = 3.699e-45
Identity = 171/622 (27.49%), Postives = 275/622 (44.21%), Query Frame = 2
Query:  152 SILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEK---YEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAY---SSQKVLVQVLVPSDKPQL------VQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNS-LELKIVSLKNGNWLKCLAIN-NGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKY-------KLKITR------------------------------VDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITW--QRISSNEVIAR----GSILLRNDIQ----------------------ADDFGDYICKAAVKEFPERHKYIYLGEKGPPEI-KNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKN---KQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 1768
            S+ + +  ++  D+ IL  P      +NST  L+CRV         +V W KDGFG  N          R     R+ +P     G YDL I  ++  D+G + CQ  VN   +   +++ + + V+VP DK +L       Q N    + I+N    I  +  E+L + C  +  RP   L W L E  +   K+G ++   + G +T  SE  ++  + Y    S L L++    NG  LKC   N   + ++       ++ V  V  V ++V P +    F E+++++  CSAS  P++  + W   + +       KY       K+K+ R                               D+   + C     + G +   + V+Y P   DS  L   AA +G+ + ++CRAD NP   ITW   + SS E++A     G+  L+ D Q                      AD+ G +IC A    FP   K +++G+   P+I  N  +   + G S R+SC I SIP P+  +I W FKN   K +   +++++Y +     V+S L+I  V   D+G YNCSVS  YG   +TI L+   ETPM+ I+G++
Sbjct:   18 SLYIYLWMVKFADNQIL-GPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETL-------RDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQ--VNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQN----IWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEV-GTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGQECYSNFQPESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDS-ILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIW-FKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 622          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000053066.1 (SMESG000053066.1)

HSP 1 Score: 108.227 bits (269), Expect = 4.750e-24
Identity = 69/227 (30.40%), Postives = 110/227 (48.46%), Query Frame = 2
Query: 1100 DHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNE---VIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI---VISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 1762
            D G    C     +I      + + Y P+ +D  S    A  + +++ + C A GNP+P I W +I S +   ++ R    +      +D+G+Y C A    F    K + +G  GPP+I      +    +  +L+CTI+SIP P+  +I W  +N ++++     M +   E I   VI  L I++V   DFG YNCSV T+YGSD  +I L +     ML+ V 
Sbjct:  236 DIGNTPDCAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQEILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWT-RNYKIVDVPDRIMTKM--EWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVA 459          
The following BLAST results are available for this feature:
BLAST of NEPH-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL39.097e-3825.43kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL39.427e-3625.14kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.748e-3525.05kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL11.346e-3325.70kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL26.874e-3024.60kirre like nephrin family adhesion molecule 2 [Sou... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-19.201e-3022.77Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
syg-11.017e-2922.99Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
pxn-21.662e-930.05PeroXidasiN (Drosophila peroxidase) homolog [Sour... [more]
him-46.628e-920.68High Incidence of Males (Increased X chromosome lo... [more]
him-46.742e-920.68High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirre4.874e-3024.08gene:FBgn0028369 transcript:FBtr0332492[more]
kirre4.874e-3024.08gene:FBgn0028369 transcript:FBtr0309498[more]
kirre4.874e-3024.08gene:FBgn0028369 transcript:FBtr0070560[more]
kirre4.874e-3024.08gene:FBgn0028369 transcript:FBtr0309499[more]
kirre4.874e-3024.08gene:FBgn0028369 transcript:FBtr0070559[more]
back to top
BLAST of NEPH-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel3a1.953e-4026.43kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a7.459e-4025.90kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a7.459e-4025.90kirre like nephrin family adhesion molecule 3a [So... [more]
KIRREL35.482e-3925.39kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a1.168e-3525.47kirre like nephrin family adhesion molecule 3a [So... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfbp44.968e-3826.15insulin like growth factor binding protein 4 [Sour... [more]
rps75.967e-3824.76ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps77.198e-3824.76ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps78.626e-3824.76ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps79.003e-3824.76ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kirrel32.680e-3825.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel38.136e-3825.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel38.136e-3825.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.045e-3725.62kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.353e-3525.33kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of NEPH-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IZU9|KIRR3_HUMAN8.394e-3525.05Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606... [more]
sp|Q8BR86|KIRR3_MOUSE1.759e-3425.23Kin of IRRE-like protein 3 OS=Mus musculus OX=1009... [more]
sp|Q80W68|KIRR1_MOUSE4.179e-3425.15Kin of IRRE-like protein 1 OS=Mus musculus OX=1009... [more]
sp|Q6X936|KIRR1_RAT5.160e-3425.15Kin of IRRE-like protein 1 OS=Rattus norvegicus OX... [more]
sp|Q7TSU7|KIRR2_MOUSE1.036e-3325.00Kin of IRRE-like protein 2 OS=Mus musculus OX=1009... [more]
back to top
BLAST of NEPH-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJJ70.000e+098.52NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A0H3YFE92.476e-12733.65NEPH-2 OS=Schmidtea mediterranea OX=79327 GN=NEPH-... [more]
A0A4S2MJS21.902e-11336.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MJ832.166e-11336.17Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A095AEM06.141e-11338.10Irregular chiasm C-roughest protein OS=Schistosoma... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL33.263e-4025.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.996e-4025.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a1.334e-3725.85kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel1a1.890e-3125.05kirre like nephrin family adhesion molecule 1 [Sou... [more]
kirrel1b1.608e-2524.28kirre like nephrin family adhesion molecule 1b [So... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010550.11.866e-1730.41pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 ... [more]
igdcc32.890e-924.39immunoglobulin superfamily, DCC subclass, member 3... [more]
cntn3b1.316e-825.14contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
ENSPMAT00000001736.12.833e-823.94pep scaffold:Pmarinus_7.0:GL477265:10898:44695:-1 ... [more]
ENSPMAT00000008186.14.672e-825.11pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NEPH-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO303504.689e-1327.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495581.355e-923.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351856.319e-925.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296162.016e-824.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287962.530e-826.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL31.422e-4126.33kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL37.283e-4126.47kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.507e-4026.70kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL34.170e-3926.27kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3l3.670e-3323.99kirre like nephrin family adhesion molecule 2 [Sou... [more]
back to top
BLAST of NEPH-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022777.10.000e+098.26SMESG000022777.1[more]
SMESG000022777.10.000e+098.25SMESG000022777.1[more]
SMESG000071657.16.885e-13133.65SMESG000071657.1[more]
SMESG000074081.13.699e-4527.49SMESG000074081.1[more]
SMESG000053066.14.750e-2430.40SMESG000053066.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30017231
GenBankAKN21716.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017231 ID=SMED30017231|Name=NEPH-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2913bp
TTAATTTACTGTTGTTTCTTTGGATAAGTTTTCATTAATTATTTTTCTAT
TTTAACAATTTACTTATAATTATCATTACAAATTATTTATGCTAGATTGT
TAACAGATTTACCTAATTATTTCGGAGCCAATGTTGCTTATGGTCACAAT
ATCAATTCTTGTGTCAGTAAATGGAATCGAATCCGTGGACGATTACATAT
TGGTTCATCCTGAACGACAGGTAGCAGCATTAAATAGCACAATCACACTG
AAGTGTAGAGTAAAAGTCGTAGAAAAGTATGAAGTGCATTGGGTAAAAGA
CGGATTTGGTCTTGGAAATTCAAGAACCGATATAAGGCAATACGGACAAA
GAAAACCTCATCAATTCAGATTTGACCTCCCATTCAACTTAGCTGAAGGT
GAATATGATTTAAGAATAACCGATTTGGAGCTATTTGATGAAGGGGTATT
TTACTGTCAAATTGTAGTGAATGGAAAAGCTTATTCCAGCCAAAAGGTTT
TGGTTCAAGTTCTAGTTCCATCAGACAAGCCGCAACTGGTTCAAATAAAT
AAAATAGGTCCTCAAGCAATTAGAAATGAAAAAAATCCTATAATAGTGAA
CGATGGCGAGTACCTCCACATCAAATGCATTGCTAAAAACGGTCGACCCG
GTGCTTCACTTTATTGGTATCTGAATGAAATTAAAATTGAAGCTCAGAAA
AATGGAGTACTTAATGAAACATTTCTTAATGGGAAAATCACAATTACAAG
TGAATCTTCAGAAAACCTTCCAAAATTATATGATGTTGTAAATAGTTTGG
AATTGAAAATTGTCAGTTTGAAGAACGGAAACTGGTTGAAATGCTTAGCT
ATAAATAATGGATATACAAATCAAAAATTAAATTATACTTCAGCTCAAAT
CGTAGTTTATACAGTTCCAATTGTCGTTATCAATGTCTATCCAAAGAAAC
AAAATAATATTTTCATTGAAAATGACATAGTCGAATTTACTTGCTCAGCT
TCTGGACGGCCGAGCGACTTTCATTGGGCATGGACTATTGGAGACGAATC
ATTAGTCAATATTCGAGATCCTAAATATAAGTTAAAGATAACTCGAGTCG
ATCATGGAAAAAAAATAACTTGCTGTGCAACGTCAAAATCAATAGGATGC
AATTCTACAAATATTTTAGTAAAATATGGTCCAAACTTCAAAGATTCAGA
TTCGTTAACTATATATGCAGCGTCAATTGGAGAAAACATGCAAATGGAAT
GTAGAGCTGATGGAAATCCTGAGCCACTGATAACGTGGCAAAGGATTTCT
AGCAATGAAGTTATAGCTCGAGGTTCGATTTTATTACGTAATGATATTCA
AGCAGACGATTTCGGCGATTACATTTGTAAAGCTGCTGTGAAAGAATTTC
CAGAAAGACATAAATATATTTATCTTGGAGAAAAAGGACCTCCAGAAATC
AAAAACCCTTCTGTTAGTTACGGACGTGAAGGCCAAAGTGCAAGGCTGAG
TTGCACAATTAAATCAATTCCATTTCCGAACGACAATGAAATAAAATGGA
TTTTTAAAAATAAACAACTTTTGGAAGGGACAAGACATAAAATGTACAGA
CAGATAAATGAAAAGATTGTCATCTCTGTTTTGCATATTTTATCCGTTCA
ACCTCACGATTTCGGAGATTATAACTGTTCAGTTTCAACAAAATATGGAT
CAGACATGGCAACGATAATTTTGTTAAGAAAAAGTGAAACTCCTATGCTG
ATGATTGTTGGAGCAACGATAATATTTTTGTTTATATTATTAGTAATAAT
TGTGGTGCTTTGCATTTGCCAGAGACGGAAGTTTAAAGATGAATATATGA
AAGAAATCTTTGACTCAAATTTTCTTCGGCATAATGCAGGAAATCCTTCA
AGCCCGGAAATTCCACTGCATCATGAGGCAAAGTCAACATTAATTGACTC
GGATTGTCAATGTAATCCAAATTTATACAGCTGGATTCCCCAGTCATTTG
ATGTGAAATCCCAAAATGATGTCCTTAGTAAAATACATTATCAGGATGGG
AATTTTTGGCCGAATTCCCAGGAAATCGAATCATGTTATTCCAACTCAGT
GCCGGATAGCCAATCCAGTAATAAATCAGTCAAGATCACCAAGCATGAGA
ACGCCAACACCAATCCAATACTATACAACATGCATACTATTGGAACAAAT
ACTCTTAACAGATATTCTACAAATATGCCATTTACAAATCTACCAATTCC
TAGAGAAAAGGATCCCCGTTTCTGTGATTCATCTCAATGTACTCAATATC
TTTATCAGAATCTTTATAATCCTGTTGTTGAGCACAATTCCCAACTGAAT
CCTACCGAGAGTACGGCTAGTCCAATTTACATTGTAAAGAAACCCGCCAA
CAAAAAACACCAAATACAATTCCAAACAGATTTTTATAGCCCTGGAAAGC
CAATTATTAAAAACAAATTAAATAGCGGTTCGGCTAACATGGAAATGTAC
ACAGATCATCAGAACACCAAACTCATCTCAGATTATGCCAGCAACATTTA
AAATATTTTCATTTAAAACAAAAAAACTGATTTTTTTTCCTATTAAAACA
AAAATTCGCTTTATCAATTCTTTTTGATAAAATATTTGATTTGTCAATCA
CAATGATGTTATGTATTGAAAATTATAATAAACTAGTAAATAAATTATTT
ATTTAATTAATGTTAGTTAATTTATAACATTTGCTATTTGATGAATTTAT
CAGTGGAGTTTTGATCATTTTAAGTCACTGTGGAAAGGAGAATCAAAGTT
TCCTTATTGTCAACGAGATGTATTATCAAATGAGTCGTGCAACGGAATCT
TTTCATTTCGGCAATAATCGAATACTCTAGTAAACTGTCATTGGTGGTCT
ACGTTGGGGGGGG
back to top

protein sequence of SMED30017231-orf-1

>SMED30017231-orf-1 ID=SMED30017231-orf-1|Name=SMED30017231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=807bp
MLLMVTISILVSVNGIESVDDYILVHPERQVAALNSTITLKCRVKVVEKY
EVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLE
LFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINKIGPQAIRNE
KNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLN
GKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKL
NYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWA
WTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYG
PNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSI
LLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGRE
GQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISV
LHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFL
FILLVIIVVLCICQRRKFKDEYMKEIFDSNFLRHNAGNPSSPEIPLHHEA
KSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIE
SCYSNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMP
FTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIY
IVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQNTKLIS
DYASNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013106Ig_V-set
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013106Immunoglobulin V-set domainSMARTSM00406igv1_8coord: 37..111
e-value: 0.033
score: 19.5
coord: 453..518
e-value: 0.69
score: 6.3
IPR013106Immunoglobulin V-set domainPFAMPF07686V-setcoord: 27..128
e-value: 8.7E-10
score: 38.8
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 449..523
e-value: 0.048
score: 19.8
coord: 33..116
e-value: 0.072
score: 18.1
coord: 365..423
e-value: 5.0E-4
score: 29.4
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 273..348
e-value: 15.0
score: 10.0
coord: 359..435
e-value: 5.2
score: 13.9
coord: 443..534
e-value: 3.6E-9
score: 46.5
coord: 27..128
e-value: 5.8E-9
score: 45.8
coord: 151..260
e-value: 29.0
score: 7.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 144..260
e-value: 1.2E-9
score: 40.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 432..533
e-value: 2.1E-16
score: 61.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 16..134
e-value: 6.5E-18
score: 66.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 345..430
e-value: 1.5E-9
score: 39.9
NoneNo IPR availablePFAMPF13927Ig_3coord: 437..519
e-value: 1.8E-10
score: 41.2
coord: 364..418
e-value: 1.6E-7
score: 31.8
NoneNo IPR availablePANTHERPTHR11640:SF31NEPHROSIS 1, CONGENITAL, FINNISH TYPE (NEPHRIN)-RELATEDcoord: 25..580
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 25..580
NoneNo IPR availableCDDcd00096Igcoord: 38..123
e-value: 7.33477E-5
score: 39.5329
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.618
NoneNo IPR availableTMHMMTMhelixcoord: 541..563
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 263..347
score: 7.105
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 144..251
score: 7.758
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 351..418
score: 10.662
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 437..530
score: 11.025
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 21..125
score: 8.321
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 266..418
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 22..130
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 151..293
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 436..532