Ras-related protein Rab-8A

Overview
NameRas-related protein Rab-8A
Smed IDSMED30017223
Length (bp)970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-8A (SMED30017223) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-8A (SMED30017223) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-8A (SMED30017223) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-8A (SMED30017223) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017223

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017223SMESG000004055.1 SMESG000047115.1 SMESG000004000.1 Contig4425GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017223SMESG000030619.1 Contig4425GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30017223SMESG000030619.1 dd_Smed_v4_1573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30017223SMESG000030619.1 dd_Smed_v4_1573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017223SMESG000030619.1 dd_Smed_v4_1573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017223SMESG000030619.1 dd_Smed_v4_1573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB8A (RAB8A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:7007])

HSP 1 Score: 240.35 bits (612), Expect = 8.995e-79
Identity = 120/203 (59.11%), Postives = 165/203 (81.28%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A ++GI F ETSAK++ NV+ AF  L  +IK K D  + G + +    G K+T  P+++K+  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKIT--PDQQKRSSF 201          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB8B (RAB8B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30273])

HSP 1 Score: 239.965 bits (611), Expect = 1.207e-78
Identity = 121/201 (60.20%), Postives = 161/201 (80.10%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  K + +  ++ +   G  +    N+ KK  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSF 201          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB8B (RAB8B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30273])

HSP 1 Score: 234.572 bits (597), Expect = 8.690e-77
Identity = 116/174 (66.67%), Postives = 150/174 (86.21%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD 581
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  K +
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLN 174          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB10 (RAB10, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9759])

HSP 1 Score: 224.942 bits (572), Expect = 6.878e-73
Identity = 111/182 (60.99%), Postives = 150/182 (82.42%), Query Frame = 3
Query:   57 LMAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAK 602
            +  K YD LFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++L+GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T+  SF NI++W++NI EHAN DVE+ML+GNK D++D+R + +  G ++A+EHGI F ETSAK++ N+++AF  L  +I +K  ++  N++
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSE 182          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: AL358472.6 (novel protein)

HSP 1 Score: 223.016 bits (567), Expect = 5.915e-72
Identity = 116/199 (58.29%), Postives = 151/199 (75.88%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIR--GQNAKAPENGHKLTKEPNKRK 650
            MAK YD+LFKLLLIGDSGVGKT L++RFA++ F+ ++I+TIGIDFKI+T+D+EGKK+KLQVWDTAGQERF+TITT+YYRGA GI+LVYD+T   SF NI  WM++I E+A++ VE++L+GNK D+  +R++ +E   K+A+EHGI F ETSAKSS NVD+AF  L  +I  K   R  G   K P    K   + N  K
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNK 199          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 229.18 bits (583), Expect = 8.667e-75
Identity = 114/174 (65.52%), Postives = 147/174 (84.48%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD 581
            MAK YDYLFKLLLIGDSGVGKT +L RF+D++F+ SFI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GI+LVYD+T+  SF NI  W++NI EHA SDVE+M+IGNK D+ +RRE+SR+ G ++A E+G  F ETSAK++ N+D+AF  L  +IK K +
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKME 174          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 229.18 bits (583), Expect = 8.667e-75
Identity = 114/174 (65.52%), Postives = 147/174 (84.48%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD 581
            MAK YDYLFKLLLIGDSGVGKT +L RF+D++F+ SFI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GI+LVYD+T+  SF NI  W++NI EHA SDVE+M+IGNK D+ +RRE+SR+ G ++A E+G  F ETSAK++ N+D+AF  L  +IK K +
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKME 174          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 223.787 bits (569), Expect = 7.953e-73
Identity = 114/171 (66.67%), Postives = 142/171 (83.04%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKF 578
            + YD LFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++L+GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T+A SF+NI +W++NI EHA+ DV KM++GNK D++DRR +SRE G K+AQ+HGI F ETSAK + +VD AF  L   I  K 
Sbjct:    4 RPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKM 174          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 223.787 bits (569), Expect = 7.953e-73
Identity = 114/171 (66.67%), Postives = 142/171 (83.04%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKF 578
            + YD LFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++L+GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T+A SF+NI +W++NI EHA+ DV KM++GNK D++DRR +SRE G K+AQ+HGI F ETSAK + +VD AF  L   I  K 
Sbjct:    4 RPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKM 174          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 216.468 bits (550), Expect = 7.132e-70
Identity = 110/203 (54.19%), Postives = 147/203 (72.41%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            M  +YDYLFKLLLIGDSGVGK+ LL+RFAD+T++ S+I+TIG+DFKI+T++L+GK +KLQ+WDTAGQERFRTIT+SYYRGA GI++VYD+T   +FNN+ QW+Q I  +A  +V K+L+GNK DL  +R +  ++    A + GI F ETSAKSS NV+QAF  +  EIK +         AP  G ++T     + KK  GC
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRMGPVQGAGGAP--GVRITGSQPVQDKKSGGC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 236.884 bits (603), Expect = 9.997e-78
Identity = 118/189 (62.43%), Postives = 155/189 (82.01%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKL 626
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+T+FI+TIGIDFKI+T++L+ KK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T   SF NI  W++NI E+A++DVEKML+GNK +L D+R++S+E G ++A E+GI F ETSAK+S NV++AF  L  +IK K + R +    P+ GH+L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQL 189          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 236.884 bits (603), Expect = 9.997e-78
Identity = 118/189 (62.43%), Postives = 155/189 (82.01%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKL 626
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+T+FI+TIGIDFKI+T++L+ KK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T   SF NI  W++NI E+A++DVEKML+GNK +L D+R++S+E G ++A E+GI F ETSAK+S NV++AF  L  +IK K + R +    P+ GH+L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQL 189          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 222.246 bits (565), Expect = 5.040e-72
Identity = 110/170 (64.71%), Postives = 140/170 (82.35%), Query Frame = 3
Query:   57 LMAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEI 566
            +  K YD LFKLLLIGDSGVGKT +L RF+D+ F+++FI+TIGIDFKIKT++L GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T+  SF NI +W++NI EHAN DVEKM++GNK D+ D+R +++E G  +A+EHGI F ETSAKS+ N+++AF  L   I
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAI 170          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 210.69 bits (535), Expect = 1.517e-67
Identity = 104/187 (55.61%), Postives = 142/187 (75.94%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKL 626
             +YDYLFKLLLIGDSGVGK+ LL+RFAD+T++ S+I+TIG+DFKI+T++L+GK +KLQ+WDTAGQERFRTIT+SYYRGA GI++VYD T   SFNN+ QW++ I  +A  +V K+L+GNKSDL  ++ +   +  + A + GI F ETSAKS+ NV+QAF  +  EIK +    G  + A +N  K+
Sbjct:    6 PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRV---GPPSSATDNASKV 189          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308832)

HSP 1 Score: 190.274 bits (482), Expect = 6.082e-60
Identity = 88/148 (59.46%), Postives = 118/148 (79.73%), Query Frame = 3
Query:  183 GIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKL 626
            GIDFKI+T++L+ KK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T   SF NI  W++NI E+A++DVEKML+GNK +L D+R++S+E G ++A E+GI F ETSAK+S NV++AF  L  +IK K + R +    P+ GH+L
Sbjct:    7 GIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQL 154          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 242.276 bits (617), Expect = 1.037e-79
Identity = 123/205 (60.00%), Postives = 164/205 (80.00%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+N++R++S++ G K+A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +   +G K+T E  K K   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINEKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGNNPQGSNHGVKITTEQPK-KSSFFRC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 242.276 bits (617), Expect = 1.037e-79
Identity = 123/205 (60.00%), Postives = 164/205 (80.00%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+N++R++S++ G K+A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +   +G K+T E  K K   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINEKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGNNPQGSNHGVKITTEQPK-KSSFFRC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 236.498 bits (602), Expect = 1.763e-77
Identity = 118/183 (64.48%), Postives = 153/183 (83.61%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAP 608
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  + + R  N   P
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLN-RKMNENNP 182          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 236.498 bits (602), Expect = 1.763e-77
Identity = 118/183 (64.48%), Postives = 153/183 (83.61%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAP 608
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  + + R  N   P
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLN-RKMNENNP 182          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 236.498 bits (602), Expect = 1.763e-77
Identity = 118/183 (64.48%), Postives = 153/183 (83.61%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAP 608
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  + + R  N   P
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLN-RKMNENNP 182          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 241.891 bits (616), Expect = 2.358e-79
Identity = 123/204 (60.29%), Postives = 162/204 (79.41%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKL-TKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++SRE G K+A ++GI F ETSAKSS NV++AF  L  +I  K + +   + +P  G  +   E + +K   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTKLNRKMNESISPGGGGPVKITEKSSKKSSFFRC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: clcn7 (chloride channel, voltage-sensitive 7 [Source:Xenbase;Acc:XB-GENE-995168])

HSP 1 Score: 241.506 bits (615), Expect = 4.970e-79
Identity = 123/205 (60.00%), Postives = 164/205 (80.00%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIR--GQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVEKM++GNK D+N++R++S+E G K+A E+GI F ETSAK++ NV+ AF  L  +IK K D R  G + +    G K+T++  K K   F C
Sbjct:   14 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDVNEKRQVSKEKGEKLALEYGIKFMETSAKANINVENAFFTLARDIKAKMDKRMEGNSPQGSNQGVKITQDQQK-KSSFFRC 217          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 229.18 bits (583), Expect = 1.512e-74
Identity = 112/161 (69.57%), Postives = 143/161 (88.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQA 542
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++SRE G K+A ++GI F ETSAKSS NV++ 
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 228.794 bits (582), Expect = 1.944e-74
Identity = 112/161 (69.57%), Postives = 143/161 (88.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQA 542
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++SRE G K+A ++GI F ETSAKSS NV++ 
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 228.409 bits (581), Expect = 1.958e-74
Identity = 112/161 (69.57%), Postives = 143/161 (88.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQA 542
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++SRE G K+A ++GI F ETSAKSS NV++ 
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab8a (RAB8A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:96960])

HSP 1 Score: 241.506 bits (615), Expect = 1.970e-79
Identity = 120/198 (60.61%), Postives = 162/198 (81.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKR 647
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A ++GI F ETSAK++ NV+ AF  L  +IK K D  + G + +   +G K+T E  KR
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKR 198          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab8b (RAB8B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2442982])

HSP 1 Score: 238.424 bits (607), Expect = 3.371e-78
Identity = 120/201 (59.70%), Postives = 161/201 (80.10%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  K + +  ++ +   G  +    ++ KK  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSF 201          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab10 (RAB10, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105066])

HSP 1 Score: 224.942 bits (572), Expect = 4.722e-73
Identity = 111/182 (60.99%), Postives = 150/182 (82.42%), Query Frame = 3
Query:   57 LMAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAK 602
            +  K YD LFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++L+GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T+  SF NI++W++NI EHAN DVE+ML+GNK D++D+R + +  G ++A+EHGI F ETSAK++ N+++AF  L  +I +K  ++  N++
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSE 182          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 223.787 bits (569), Expect = 1.961e-72
Identity = 117/198 (59.09%), Postives = 155/198 (78.28%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIR--GQNAKAPENGHKLT-KEPNK 644
            MAK YD+LFKLLLIGDSGVGKT L++RFA++ F++++I+TIGIDFKI+T+D+EGK++KLQVWDTAGQERF+TITT+YYRGA GI+LVYD+T   SF NI  WM++I E+A++ VE++L+GNK D+  +R++ RE   K+A+EH I F ETSAKSS NVD+AF  L  +I  K   R  G N+K    G K + K+ NK
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKNK 198          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 211.075 bits (536), Expect = 1.888e-67
Identity = 105/196 (53.57%), Postives = 145/196 (73.98%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKR 647
            M  +YDYLFKLLLIGDSGVGK+ LL+RFAD+T++ S+I+TIG+DFKI+T++L+GK +KLQ+WDTAGQERFRTIT+SYYRGA GI++VYDVT   SFNN+ QW+Q I  +A+ +V K+L+GNK DL  ++ +   +  + A   GI F ETSAK++ NV+Q+F  +  EIKK+         A ++  K+   P K+
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQ 199          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|P35280|RAB8A_RAT (Ras-related protein Rab-8A OS=Rattus norvegicus OX=10116 GN=Rab8a PE=1 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 1.378e-78
Identity = 120/198 (60.61%), Postives = 162/198 (81.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKR 647
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A ++GI F ETSAK++ NV+ AF  L  +IK K D  + G + +   +G K+T E  KR
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKR 198          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|P55258|RAB8A_MOUSE (Ras-related protein Rab-8A OS=Mus musculus OX=10090 GN=Rab8a PE=1 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 1.378e-78
Identity = 120/198 (60.61%), Postives = 162/198 (81.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKR 647
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A ++GI F ETSAK++ NV+ AF  L  +IK K D  + G + +   +G K+T E  KR
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKR 198          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|A4FV54|RAB8A_BOVIN (Ras-related protein Rab-8A OS=Bos taurus OX=9913 GN=RAB8A PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.647e-78
Identity = 120/203 (59.11%), Postives = 165/203 (81.28%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A ++GI F ETSAK++ NV+ AF  L  +IK K D  + G + +    G K+T  P+++K+  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKKLEGNSPQGSNQGVKIT--PDQQKRSSF 201          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|Q5REC9|RAB8B_PONAB (Ras-related protein Rab-8B OS=Pongo abelii OX=9601 GN=RAB8B PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 3.630e-78
Identity = 121/201 (60.20%), Postives = 161/201 (80.10%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAKSS NV++AF  L  +I  K + +  ++ +   G  +    N+ KK  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSF 201          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|Q4R5P1|RAB8A_MACFA (Ras-related protein Rab-8A OS=Macaca fascicularis OX=9541 GN=RAB8A PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.320e-78
Identity = 120/203 (59.11%), Postives = 165/203 (81.28%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GK++KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A ++GI F ETSAK++ NV+ AF  L  +IK K D  + G + +    G K+T  P+++K+  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKIT--PDQQKRSSF 201          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A3S3SQS8 (Ras-related protein Rab-8A-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_13985 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 5.785e-80
Identity = 128/202 (63.37%), Postives = 163/202 (80.69%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKL-TKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYDVT+  SF NI  W++NI EHA+SDVEKM++GNK D+ DRR++S+E G ++A E+GI F+ETSAKSS NV++AF  L  +IK K + +   A  P  GH L   EP K ++K F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTNEKSFENIKNWIRNIEEHASSDVEKMILGNKCDITDRRQVSKERGEQLAIEYGIKFTETSAKSSINVEEAFFTLARDIKIKMEQKLDAANPPRTGHHLRANEPVKSQRKWF 202          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A3B3BRR8 (RAB8A, member RAS oncogene family OS=Oryzias melastigma OX=30732 GN=RAB8A (1 of many) PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.055e-79
Identity = 124/197 (62.94%), Postives = 162/197 (82.23%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNK 644
            MAK YDYLFKLLLIGDSGVGKT +L RFAD+ F+++FI+TIGIDFKI+T+DL+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVE+M++GNK D+ND+R++S+E G K+A E+G+ F ETSAKS+ NV+ AF  L  +IK K D  + G N +    G K+T++P K
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVERMVLGNKCDVNDKRQVSKERGEKLALEYGLKFMETSAKSNINVENAFMALARDIKAKMDKKLEGNNPQGSNQGVKITEQPKK 197          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A4W4HJF9 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=rab8a PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.201e-79
Identity = 126/205 (61.46%), Postives = 166/205 (80.98%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +   +G K+T EP +RK   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGNNPQGSNHGVKITTEP-QRKSSFFRC 204          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A4W4HJE9 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=rab8a PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.291e-79
Identity = 126/205 (61.46%), Postives = 166/205 (80.98%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +   +G K+T EP +RK   F C
Sbjct:   12 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGNNPQGSNHGVKITTEP-QRKSSFFRC 215          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A3P9J7E8 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 2.409e-79
Identity = 124/197 (62.94%), Postives = 160/197 (81.22%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNK 644
            MAK YDYLFKLLLIGDSGVGKT +L RFAD+ F+++FI+TIGIDFKI+T+DL GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF NI  W++NI EHA++DVE+M++GNK D+NDRR++S+E G ++A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +    G K+T++P K
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKKLEGNNPQGSNQGVKITEQPKK 197          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: rab8a (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:103043778])

HSP 1 Score: 246.128 bits (627), Expect = 2.473e-81
Identity = 125/205 (60.98%), Postives = 164/205 (80.00%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVEKM++GNK D+ND+R++S+E G K+A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +   +G K+T E  K K   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGNNPQGSNHGVKITTEQQK-KSSFFRC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: rab8b (ras-related protein Rab-8B [Source:NCBI gene;Acc:103040614])

HSP 1 Score: 240.736 bits (613), Expect = 3.574e-79
Identity = 122/201 (60.70%), Postives = 160/201 (79.60%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRF 662
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++ I F ETSAKSS NV++AF  L+ +I  + + R  N   P  G  +    N+ KK  F
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYSIKFLETSAKSSTNVEEAFFTLSRDIMTRLN-RKMNENNPAGGGPVKITENRSKKPSF 200          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: megf8 (ras-related protein Rab-8B [Source:NCBI gene;Acc:103041748])

HSP 1 Score: 238.81 bits (608), Expect = 2.323e-78
Identity = 125/205 (60.98%), Postives = 160/205 (78.05%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKR--FGC 668
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T++L GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+TS  SF NI  W++NI EHA+SDVE+M++GNK D+ND+R++S+E G K+A ++GI F ETSAK+S NV++AF  L  +I  + + R  N  +  +G    K   KR KK   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVELNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKTSVNVEEAFLTLARDIMSRLN-RKMNDGSNSDGGAPVKITEKRSKKHSFFKC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: RAB10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:103045708])

HSP 1 Score: 225.713 bits (574), Expect = 2.375e-73
Identity = 111/182 (60.99%), Postives = 150/182 (82.42%), Query Frame = 3
Query:   57 LMAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAK 602
            +  K YD LFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++L+GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+++A SF NI++W++NI EHAN DVE+ML+GNK D+ D+R + +  G ++A+EHGI F ETSAK++ N+++AF  L  +I +K  ++  N++
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRIVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSE 182          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: ENSAMXT00000056277.1 (ras-related protein Rab-10-like [Source:NCBI gene;Acc:103035127])

HSP 1 Score: 223.402 bits (568), Expect = 1.913e-72
Identity = 110/170 (64.71%), Postives = 141/170 (82.94%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKK 575
            K YD LFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++L+GK++KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T+A SF NI +W++NI EHAN DVE+ML+GNK D+ D R + +  G ++A EH I F ETSAK++ N+++AF ML  +I +K
Sbjct:    4 KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKRIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENITKWLRNIEEHANEDVERMLLGNKCDMEDMRVVPKAKGEQIASEHNIRFFETSAKANINIEKAFLMLAEDILRK 173          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 246.128 bits (627), Expect = 5.240e-82
Identity = 123/204 (60.29%), Postives = 162/204 (79.41%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPE-NGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T+DL+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF NI  W++NI EHA++DVEKM++GNK D+N+RR+++RE G K+A E+GI F ETSAK+S NV++AF  L  +IK K D + +    P+ N  ++T     +K   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRITAPSQGKKTSFFRC 204          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 209.92 bits (533), Expect = 8.614e-68
Identity = 106/195 (54.36%), Postives = 144/195 (73.85%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNK 644
            M  +YDYLFKLLLIGDSGVGK+ LL+RFAD+T++ S+I+TIG+DFKI+T++L+GK +KLQ+WDTAGQERFRTIT+SYYRGA GI++VYDVT   SFNN+ QW+Q I  +A+ +V K+L+GNK DL  ++ +   +  + A    I F ETSAK++ NV+QAF  +  EIKK+       A A ++  K+   P K
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATQAGAGKSNVKIDSTPVK 198          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 205.682 bits (522), Expect = 3.910e-66
Identity = 110/206 (53.40%), Postives = 152/206 (73.79%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIK--TMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGH-KLTKEPNKRKKKRFGC 668
            MAK YD LFKLLLIGDSGVGKT +L RF+++ F+++FI+TIG    +    + ++ KK+KLQ+WDTAGQERFRTITT+YYRGA G MLVYD+T+  SF NI  W++NI EHA++DV+KM +GNK D+NDRR+++++ G K+A+++ I F ETSAK+S NV++AF  L  EIK K D + +   A EN   ++T   + +K   F C
Sbjct:    1 MAKSYDCLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGGSRPVCQVCIRIDLKKIKLQIWDTAGQERFRTITTAYYRGAMGSMLVYDITNEKSFENIKNWIRNIEEHASADVQKM-VGNKCDMNDRRQVTKDRGEKLAEDYNIQFMETSAKASINVEEAFFTLAREIKAKMDKKMEGNTAAENSSVQITNASHSKKSSFFRC 205          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010665.1 (pep scaffold:Pmarinus_7.0:GL482742:3398:12039:1 gene:ENSPMAG00000009656.1 transcript:ENSPMAT00000010665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.193 bits (474), Expect = 1.557e-59
Identity = 84/121 (69.42%), Postives = 106/121 (87.60%), Query Frame = 3
Query:  183 GIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAF 545
            GIDFKI+T+DL+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF NI  W++NI EHA++DVE+M++GNK D+NDRR++SRE G K A E+GI F ETSAK+S NV++AF
Sbjct:    1 GIDFKIRTVDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASADVERMILGNKCDMNDRRQVSRERGEKFASEYGIKFMETSAKASINVEEAF 121          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 187.578 bits (475), Expect = 4.820e-59
Identity = 91/176 (51.70%), Postives = 128/176 (72.73%), Query Frame = 3
Query:   72 YDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKK-----FDI 584
            Y YLFK ++IGD+GVGK+ LL++F D+ F      TIG++F  + + ++GK+VKLQ+WDTAGQE FR+IT SYYRGA G +LVYD+T   +FN++  W+++  +H+NS++  MLIGNKSDL  RRE+ RE G   A+EHG++F ETSAK++ NV++AF     EI +K     FDI
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDI 178          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 197.208 bits (500), Expect = 6.252e-63
Identity = 103/173 (59.54%), Postives = 134/173 (77.46%), Query Frame = 3
Query:   63 AKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD 581
             K YD + K+LLIGDSGVGK+ LLVRF ++ F+ SFITTIGIDFKIKT+D+ GKKVKLQ+WDTAGQERFRTITT+YYRGA GI+LVYDVT   +F NI QW + + EHAN + + +L+GNKSD+ + R ++ + G  +A+E GI F E+SAK+ DNV++ F  L   I++K D
Sbjct:   14 GKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKID 185          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 191.815 bits (486), Expect = 6.065e-61
Identity = 96/171 (56.14%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKK 572
            M  +YDYLFKLLLIG+SGVGK+ LL+RF+D+T++  +I+TIG+DFKIKT++L+GK VKLQ+WDTAGQERFRTIT+SYYRG+ GI++VYDVT   SFN +  W+Q I  +A S V K+L+GNK DL D+R +  +   + A  + + F ETSA  S NV+ AF  +  +IK+
Sbjct:    1 MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKE 171          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 185.267 bits (469), Expect = 3.265e-58
Identity = 97/209 (46.41%), Postives = 139/209 (66.51%), Query Frame = 3
Query:   69 DYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEI-----KKKFDIRGQNAK------APENGH-KLTKEPNKRKKKR 659
            DYDYLFK++LIGDSGVGK++LL RF  + F+    +TIG++F  +T+++E KK+K Q+WDTAGQER+R IT++YYRGA G ++VYD++ +SS+ N N W+  + E+A+ +V   LIGNKSDL   R +  +     A E+ +LF+ETSA +SDNVD+AFR L + I     K + D+ G          AP+     LT  P + KKK+
Sbjct:    9 DYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKK 217          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 182.956 bits (463), Expect = 2.732e-57
Identity = 95/208 (45.67%), Postives = 136/208 (65.38%), Query Frame = 3
Query:   69 DYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEI-----KKKFDIRGQNAKAPENGH--------KLTKEPNKRKK 653
            DYD LFK++LIGDSGVGK++LL RF    F+    +TIG++F  +T++++GK++K Q+WDTAGQER+R IT++YYRGA G ++VYD++ +SS+ N N W+  + E+A+ +V   LIGNKSDL   R +  E     AQE+ +LF+ETSA +S+NVD+AF  L   I     K + D+   +A    NG          LT  PN+ KK
Sbjct:    9 DYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKK 216          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 130.954 bits (328), Expect = 3.174e-37
Identity = 72/159 (45.28%), Postives = 107/159 (67.30%), Query Frame = 3
Query:   84 FKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIA-EHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGI-LFSETSAKSSDNVDQAFRML 554
            +K++ +G+ GVGKTSL+ RF  +TF   +  TIGIDF  KTM L+ K ++LQ+WDTAGQERFR++  SY R +   ++VYD+T   SF  I++W++++  E  + +V   ++GNKSDL+D R+IS E G K A+  G  +F ETS K+  NV   F+ +
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKI 169          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 238.039 bits (606), Expect = 1.310e-78
Identity = 119/203 (58.62%), Postives = 158/203 (77.83%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YD+LFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF NI  W++NI EHA+ DVEKM++GNK D+ DRR++S+E G ++A E+GI F ETSAK+S NV++AF  L  +IK K D + +N+     G        + K+  F C
Sbjct:    1 MAKTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKLENSNPASTGAVKITHEKETKRSIFRC 203          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 237.654 bits (605), Expect = 1.410e-78
Identity = 121/204 (59.31%), Postives = 162/204 (79.41%), Query Frame = 3
Query:   57 LMAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            +  K YDYLFKLLLIGDSGVGKT +L RF+D+ F+T+FI+TIGIDFKIKT++++GKK+KLQ+WDTAGQERF TITTSYYRGA GIMLVYD+T   +F+NI++W++NI EHAN DVEKM++GNK D++DRR +SRE G ++A+EHGI F ETSAK++ N++QAF+ L  +I KK ++   + +   N H      + +K K+ GC
Sbjct:    1 MAKKSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKK-ELNKDSEEPSNNIH-----VHDQKDKKGGC 198          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 206.838 bits (525), Expect = 2.048e-66
Identity = 100/173 (57.80%), Postives = 136/173 (78.61%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKF 578
            M  +YDYLFKLLLIGDSGVGK+ LL+RFAD+T++ S+I+TIG+DFKI+T++L+GK +KLQ+WDTAGQERFRTIT+SYYRGA GI++VYDVT   SFNN+ QW+Q I  +A  +V K+L+GNK DL  ++ +   +  + A+  G+ F ETSAK++ NV+QAF  +  EIK + 
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRM 176          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 206.068 bits (523), Expect = 2.222e-66
Identity = 106/167 (63.47%), Postives = 137/167 (82.04%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEI 566
            K  D  FKLLLIGDSGVGKT ++ RFAD TF+ SFI+TIGIDFKIKT++L GKK+KLQ+WDTAGQERF TITT+YYRGA GIMLVYDVT+  SF+NI++W++ I +HAN DV++ML+GNK D+ D+R IS+  G ++A  +GI F ETSA S+ NV+++F +LT +I
Sbjct:    4 KKSDLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDI 170          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO42144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G3])

HSP 1 Score: 197.593 bits (501), Expect = 1.008e-62
Identity = 100/195 (51.28%), Postives = 140/195 (71.79%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNK 644
            M  +YDYLFKLLLIGDSGVGK+SLL+RFAD+TFS ++I+TIG+DFKI+T+ ++GK +KLQ+WDTAGQERFRT+TT+YYR A GI+L+YDV  + +F +++QW++ ++E+A   V  +L+GNK DL D R++   +  + A++  I F ETSAK S NV+  FR +  E+K K    G    +P  G      P K
Sbjct:    1 MNSEYDYLFKLLLIGDSGVGKSSLLLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQIWDTAGQERFRTLTTAYYRSAHGIVLIYDVNESETFLHLSQWLEEVSEYACEGVNTILVGNKCDLIDCRQVGYNTAKEFAEKLDISFIETSAKDSTNVESVFRTMAAELKAKL---GSPLTSPTAGDSTDACPLK 192          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 249.98 bits (637), Expect = 9.068e-83
Identity = 124/197 (62.94%), Postives = 160/197 (81.22%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNK 644
            MAK YDYLFKLLLIGDSGVGKT +L RFAD+ F+++FI+TIGIDFKI+T+DL GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF NI  W++NI EHA++DVE+M++GNK D+NDRR++S+E G ++A E+GI F ETSAK++ NV+ AF  L  +IK K D  + G N +    G K+T++P K
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKKLEGNNPQGSNQGVKITEQPKK 197          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 240.35 bits (612), Expect = 2.917e-79
Identity = 119/185 (64.32%), Postives = 153/185 (82.70%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPEN 614
            MAK YDYLFKLLLIGDSGVGKT +L RFAD+ F+++FI+TIGIDFKI+T+DL GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF NI  W++NI EHA++DVE+M++GNK D+NDRR++S+E G ++A E+GI F ETSAK++ NV+ AF  L  +IK K D +    K P++
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKKLVRKKKPDH 185          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: rab8a (ras-related protein Rab-8A [Source:NCBI gene;Acc:101170877])

HSP 1 Score: 240.35 bits (612), Expect = 5.263e-79
Identity = 124/205 (60.49%), Postives = 163/205 (79.51%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFD--IRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT +L RF+++ F+++FI+TIGIDFKI+T++L+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA+SDVEKM++GNK D+ND+R++++  G K+A E+GI F ETSAKS+ NV+ AF  L  +IK K D  + G   +   +G K++ EP K K   F C
Sbjct:    4 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMVLGNKCDINDKRQVTKMGGEKLALEYGIKFMETSAKSNINVENAFLTLARDIKTKMDSKLEGNAPQGSSHGVKIS-EPQK-KTSFFRC 206          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: ENSORLT00000044845.1 (ras-related protein Rab-8B [Source:NCBI gene;Acc:101162740])

HSP 1 Score: 239.58 bits (610), Expect = 5.741e-78
Identity = 121/203 (59.61%), Postives = 160/203 (78.82%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YDYLFKLLLIGDSGVGKT LL RF+++ F+T+FI+TIGIDFKI+T+DL+GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+T+  SF+NI  W++NI EHA++DVE+M++GNK D+NDRR++S+E G K+A ++ I F ETSAKSS NV++AF  L  +I  + + +  N  +   G  +  +  + KK  F C
Sbjct:   58 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVERMVLGNKCDMNDRRQVSKERGEKLAIDYSIKFLETSAKSSINVEEAFLTLARDIMSRLNRKMHNDSSAGGGGAIQIKEPRSKKSLFRC 260          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: megf8 (RAB8B, member RAS oncogene family [Source:NCBI gene;Acc:101174994])

HSP 1 Score: 227.254 bits (578), Expect = 5.943e-74
Identity = 121/209 (57.89%), Postives = 162/209 (77.51%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNK---RKKKR---FGC 668
            MAK YDYLFKLLLIGDSGVGKT LL RF++++F+T+FI+TIGIDFKI+T++L+GK+VKLQ+WDTAGQERFRTITT+YYRGA GIMLVYD+ +  SF+NI  W++NI EHA+SDVEKM++GNK D+ DRR++S++ G K+A ++ + F ETSAKSS NV++AF  +  +I     +   N+KA +     + +P K   +K KR   F C
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDSFNTTFISTIGIDFKIRTIELDGKRVKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDICNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDMTDRRQVSKDRGEKLAIDYRVKFLETSAKSSLNVEEAFYTMARDI-----LHNLNSKAGDGNGGGSGKPVKITDKKSKRIKFFKC 204          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000030619.1 (SMESG000030619.1)

HSP 1 Score: 397.512 bits (1020), Expect = 4.610e-141
Identity = 203/203 (100.00%), Postives = 203/203 (100.00%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC 668
            MAKDYDYLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC
Sbjct:    1 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKRFGC 203          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000026178.1 (SMESG000026178.1)

HSP 1 Score: 268.085 bits (684), Expect = 4.071e-90
Identity = 130/204 (63.73%), Postives = 164/204 (80.39%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQ-NAKAPENGHKLTKEPNKRKKKRFGC 668
            MAK YD+LFKLLLIGDSGVGKTS+L RF+++ F+ +FI TIGIDFKI+T+D+ GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYDVTS  SFNNINQW+ NI +HAN+DVEKML+GNK+D+ND+R++  ++G ++AQ HGI F ETSAK+  NVD+AFR L ++IK K + R       P   HK+TKE  +R+   F C
Sbjct:    1 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKC 204          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000035214.1 (SMESG000035214.1)

HSP 1 Score: 207.608 bits (527), Expect = 3.196e-66
Identity = 109/190 (57.37%), Postives = 144/190 (75.79%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKA--PENGHKLT 629
            K YD LFKLLLIGDSGVGKT LL R+AD+TFST+FI+TIGIDFKIKT+++ GK++KLQ+WDTAGQERF TIT SYYRGA GIMLVYDVT+  SF+NI++W+ NI  HA+  VEK+++ NK D+ ++R ++++ G  +A  + + F E SAK+  NV QAF  LTM I  K     ++A++   E GH L+
Sbjct:    4 KSYDLLFKLLLIGDSGVGKTCLLFRYADDTFSTTFISTIGIDFKIKTIEMNGKRIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDVTNKKSFDNISKWLTNIQSHASESVEKLIVANKIDMEEKRVVTKDIGENIAVANKVSFLEVSAKTGVNVPQAFEKLTMAILAKVPNTKESAESQQTERGHHLS 193          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 206.838 bits (525), Expect = 4.305e-66
Identity = 102/170 (60.00%), Postives = 129/170 (75.88%), Query Frame = 3
Query:   66 KDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKK 575
            K YD LFKLLLIGDSGVGKT +L  + D  +S ++I+TIGIDFKIKT+++ GKK+KLQ+WDTAGQERF TIT SYYRGA GIMLVYD+T+  SF NIN+W+ NI  HA+  VE +++ NK D+ DRR ++ E G + A  H I + ETSAK+S N+ +AF  LTM I KK
Sbjct:    4 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK 173          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000026323.1 (SMESG000026323.1)

HSP 1 Score: 204.142 bits (518), Expect = 4.578e-65
Identity = 101/183 (55.19%), Postives = 137/183 (74.86%), Query Frame = 3
Query:   60 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADEXXXXXXXXXXGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAP 608
            M  +YDYLFKLLLIGDSGVGK+ LL+RFAD+T++ S+I+TIG+DFKI+T++L+GK +KLQ+WDTAGQERFRTIT+SYYRGA GI++VYDVT   SFNN+  W+  I  +AN +V K+L+GNK+DL  +R +   +  + A    I F ETSAK + NV+QAF  +  EIK +      +++ P
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQDSFNNVKNWLSEIDRYANENVNKLLVGNKTDLISKRVVEASNAKEYADSLNIPFLETSAKDATNVEQAFLTMAGEIKSRSGPPASSSQKP 183          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB8A8.995e-7959.11RAB8A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8B1.207e-7860.20RAB8B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8B8.690e-7766.67RAB8B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB106.878e-7360.99RAB10, member RAS oncogene family [Source:HGNC Sym... [more]
AL358472.65.915e-7258.29novel protein[more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-88.667e-7565.52RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-88.667e-7565.52RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-107.953e-7366.67Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-107.953e-7366.67Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-17.132e-7054.19RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab89.997e-7862.43gene:FBgn0262518 transcript:FBtr0308833[more]
Rab89.997e-7862.43gene:FBgn0262518 transcript:FBtr0074921[more]
Rab105.040e-7264.71gene:FBgn0015789 transcript:FBtr0077337[more]
Rab11.517e-6755.61gene:FBgn0285937 transcript:FBtr0084104[more]
Rab86.082e-6059.46gene:FBgn0262518 transcript:FBtr0308832[more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a1.037e-7960.00RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a1.037e-7960.00RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b1.763e-7764.48RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b1.763e-7764.48RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b1.763e-7764.48RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox22.358e-7960.29PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
clcn74.970e-7960.00chloride channel, voltage-sensitive 7 [Source:Xenb... [more]
pknox21.512e-7469.57PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox21.944e-7469.57PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox21.958e-7469.57PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab8a1.970e-7960.61RAB8A, member RAS oncogene family [Source:MGI Symb... [more]
Rab8b3.371e-7859.70RAB8B, member RAS oncogene family [Source:MGI Symb... [more]
Rab104.722e-7360.99RAB10, member RAS oncogene family [Source:MGI Symb... [more]
Rab131.961e-7259.09RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a1.888e-6753.57RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35280|RAB8A_RAT1.378e-7860.61Ras-related protein Rab-8A OS=Rattus norvegicus OX... [more]
sp|P55258|RAB8A_MOUSE1.378e-7860.61Ras-related protein Rab-8A OS=Mus musculus OX=1009... [more]
sp|A4FV54|RAB8A_BOVIN2.647e-7859.11Ras-related protein Rab-8A OS=Bos taurus OX=9913 G... [more]
sp|Q5REC9|RAB8B_PONAB3.630e-7860.20Ras-related protein Rab-8B OS=Pongo abelii OX=9601... [more]
sp|Q4R5P1|RAB8A_MACFA4.320e-7859.11Ras-related protein Rab-8A OS=Macaca fascicularis ... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S3SQS85.785e-8063.37Ras-related protein Rab-8A-like protein OS=Dinothr... [more]
A0A3B3BRR81.055e-7962.94RAB8A, member RAS oncogene family OS=Oryzias melas... [more]
A0A4W4HJF91.201e-7961.46Uncharacterized protein OS=Electrophorus electricu... [more]
A0A4W4HJE91.291e-7961.46Uncharacterized protein OS=Electrophorus electricu... [more]
A0A3P9J7E82.409e-7962.94Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a2.473e-8160.98RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
rab8b3.574e-7960.70ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
megf82.323e-7860.98ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
RAB102.375e-7360.99RAB10, member RAS oncogene family [Source:NCBI gen... [more]
ENSAMXT00000056277.11.913e-7264.71ras-related protein Rab-10-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a5.240e-8260.29RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa8.614e-6854.36RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab8a3.910e-6653.40RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000010665.11.557e-5969.42pep scaffold:Pmarinus_7.0:GL482742:3398:12039:1 ge... [more]
rab2a4.820e-5951.70RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC46.252e-6359.54Rab family GTPase; essential for vesicle-mediated ... [more]
YPT16.065e-6156.14Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT323.265e-5846.41Rab family GTPase involved in the exocytic pathway... [more]
YPT312.732e-5745.67Rab family GTPase; involved in the exocytic pathwa... [more]
YPT63.174e-3745.28Rab family GTPase; required for endosome-to-Golgii... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO410181.310e-7858.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474711.410e-7859.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401672.048e-6657.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408452.222e-6663.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421441.008e-6251.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB8A9.068e-8362.94RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
RAB8A2.917e-7964.32RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
rab8a5.263e-7960.49ras-related protein Rab-8A [Source:NCBI gene;Acc:1... [more]
ENSORLT00000044845.15.741e-7859.61ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
megf85.943e-7457.89RAB8B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030619.14.610e-141100.00SMESG000030619.1[more]
SMESG000026178.14.071e-9063.73SMESG000026178.1[more]
SMESG000035214.13.196e-6657.37SMESG000035214.1[more]
SMESG000077710.14.305e-6660.00SMESG000077710.1[more]
SMESG000026323.14.578e-6555.19SMESG000026323.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017223 ID=SMED30017223|Name=Ras-related protein Rab-8A|organism=Schmidtea mediterranea sexual|type=transcript|length=970bp
ATCAAAACAAGCAAGCAAACAGTAGATATTTAAAAATTGGTCTTTCCTAA
TAATTATTAATGGCAAAAGATTATGATTATTTATTTAAACTATTATTAAT
TGGTGATTCTGGAGTTGGTAAAACCAGTTTACTTGTCAGATTTGCAGATG
AAACCTTTTCGACATCATTTATCACAACTATAGGTATTGATTTTAAAATC
AAAACCATGGATTTAGAAGGCAAGAAAGTCAAACTTCAAGTTTGGGATAC
TGCCGGTCAAGAAAGATTTAGAACTATAACAACGTCATATTATCGTGGAG
CTACTGGAATAATGCTTGTTTATGACGTAACAAGCGCCAGTTCATTCAAT
AACATCAATCAGTGGATGCAGAACATAGCTGAGCATGCCAACAGCGACGT
AGAAAAAATGCTAATAGGAAACAAGAGCGATTTGAATGATCGGCGTGAAA
TATCACGTGAAAGCGGATTAAAGGTGGCCCAAGAGCATGGAATTTTATTT
TCTGAAACAAGTGCAAAATCCAGTGACAATGTCGATCAAGCATTCAGAAT
GCTGACAATGGAAATAAAGAAAAAATTTGACATCCGTGGACAGAACGCCA
AAGCTCCTGAAAATGGTCACAAATTAACGAAAGAACCAAACAAACGAAAA
AAGAAGCGATTCGGTTGCATAATTTTGTAACGAATTCCTCTGTGATCGAT
TATTCATTATTATTTATTATTATTGATTTATTCTGATTTTGTCAGTAAAT
GTAAATTGGCCATTTATTGATTTTTATTATTATTATTATTGCAGAATTAT
TTATTTTCACTGTCGCATGCGCTCCGCTGCGTGTGTGTGTAAATTGTATG
TATCGATGTGTGCCAATGTGCCCTGTCGAGCTGTTGCTGTTGTTATTGGC
CATTCCATGAATCAACCAATGAATACTTGTAACTATTTTATGATGCGCCT
TTGTAATGTGATTGGTGGTT
back to top

protein sequence of SMED30017223-orf-1

>SMED30017223-orf-1 ID=SMED30017223-orf-1|Name=SMED30017223-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
MAKDYDYLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTM
DLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNIN
QWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSET
SAKSSDNVDQAFRMLTMEIKKKFDIRGQNAKAPENGHKLTKEPNKRKKKR
FGCIIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006914autophagy
GO:0010506regulation of autophagy
GO:0007264small GTPase mediated signal transduction
GO:0060271cilium morphogenesis
GO:0061024membrane organization
GO:0072659protein localization to plasma membrane
GO:0098969neurotransmitter receptor transport to postsynaptic membrane
GO:0006810transport
GO:0006904vesicle docking involved in exocytosis
GO:0007409axonogenesis
GO:0009306protein secretion
GO:0015031protein transport
GO:0030030cell projection organization
GO:0032869cellular response to insulin stimulus
GO:0032880regulation of protein localization
GO:0042593glucose homeostasis
GO:0046326positive regulation of glucose import
GO:0048169regulation of long-term neuronal synaptic plasticity
GO:0048210Golgi vesicle fusion to target membrane
GO:0051223regulation of protein transport
Vocabulary: molecular function
TermDefinition
GO:0017137Rab GTPase binding
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0019003GDP binding
GO:0019901protein kinase binding
GO:0031489myosin V binding
Vocabulary: cellular component
TermDefinition
GO:0030496midbody
GO:0005737cytoplasm
GO:0005768endosome
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0005814centriole
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0070062extracellular exosome
GO:0097546ciliary base
GO:0097730non-motile cilium
GO:0005929cilium
GO:0008021synaptic vesicle
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030140trans-Golgi network transport vesicle
GO:0030425dendrite
GO:0030659cytoplasmic vesicle membrane
GO:0030670phagocytic vesicle membrane
GO:0031012extracellular matrix
GO:0031410cytoplasmic vesicle
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0043025neuronal cell body
GO:0043197dendritic spine
GO:0045335phagocytic vesicle
GO:0055037recycling endosome
GO:0055038recycling endosome membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 112..125
score: 48.31
coord: 147..169
score: 42.09
coord: 50..72
score: 51.0
coord: 9..30
score: 54.47
coord: 32..48
score: 33.91
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 9..172
e-value: 1.6E-100
score: 350.0
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 11..172
e-value: 1.4E-12
score: 41.4
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..173
e-value: 4.5E-5
score: 23.1
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 6..172
e-value: 2.7E-31
score: 120.0
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 14..201
e-value: 2.6E-5
score: 26.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..204
e-value: 4.2E-69
score: 233.9
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 2..197
NoneNo IPR availablePANTHERPTHR24073:SF22RAS-RELATED PROTEIN RAB-8Bcoord: 2..197
NoneNo IPR availablePROSITEPS51419RABcoord: 4..203
score: 35.572
NoneNo IPR availableCDDcd01867Rab8_Rab10_Rab13_likecoord: 6..172
e-value: 1.44043E-104
score: 296.487
IPR001806Small GTPasePFAMPF00071Rascoord: 10..170
e-value: 6.3E-63
score: 211.2
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 7..165
e-value: 3.1E-31
score: 106.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..174